☺Stock list--40226

GMP, ISO custom synthesis Medicinal Chemistry; FDA new API and Intermediates, HPLC 99%+, NMR, LCMS, MSDS, COA, MOA all we provided.

Teva, Novartis, Pfizer, Hikma, Glenmark, Gilead all Site Audit approved us.

www.eosmedchem.com

LNK754, Alternative-names: , CAS# 439153-64-7, Formula: C29H22ClN3O2, MWT: 479.95688, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Farnesyl Transferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

CP-060, Alternative-names: , CAS# 180090-15-7, Formula: C30H42N2O5S, MWT: 542.72988, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

FRG8701, Alternative-names: , CAS# 108498-50-6, Formula: C22H30N2O4S, MWT: 418.5496, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Benzamide, N-[5-[3-[(4-chlorophenyl)sulfonyl]propyl]-2-(2H-tetrazol-5-ylmethoxy)phenyl]-3-[[4-(1,1-dimethylethyl)-2-thiazolyl]methoxy]-, Alternative-names: , CAS# 179102-65-9, Formula: C32H33ClN6O5S2, MWT: 681.22462, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Tertatolol, Alternative-names: (±)​-​Tertatolol; Racemic Tertatolol;dl-​Tertatolol, CAS# 83688-84-0, Formula: C16H25NO2S, MWT: 295.4402, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: Adrenergic Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Methanesulfonamide, N-[3-(2-amino-1-hydroxyethyl)-4-fluorophenyl]-, Alternative-names: , CAS# 137315-05-0, Formula: C9H13FN2O3S, MWT: 248.2745232, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

Compound 2, Alternative-names: , CAS# 872313-42-3, Formula: C21H23ClO6, MWT: 406.85672, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

SC58451, Alternative-names: , CAS# 168433-84-9, Formula: C20H19FO2S, MWT: 342.4270632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

1H-Indole-5-carboxamide, 3-[[2-methoxy-4-[[[(2-methylphenyl)sulfonyl]amino]carbonyl]phenyl]methyl]-1-methyl-N-(4,4,4-trifluoro-2-methylbutyl)-, Alternative-names: , CAS# 136564-67-5, Formula: C31H32F3N3O5S, MWT: 615.6630896, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Urea, N-[1-(3,3-dimethyl-2-oxobutyl)-2,3-dihydro-2-oxo-5-(2-pyridinyl)-1H-1,4-benzodiazepin-3-yl]-N'-[3-(methylamino)phenyl]-, Alternative-names: , CAS# 168161-71-5, Formula: C28H30N6O3, MWT: 498.5762, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SA72, Alternative-names: , CAS# 934809-60-6, Formula: C21H26N2O6, MWT: 402.44094, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

Carburazepam, Alternative-names: RGH 3331; Uxepam, CAS# 59009-93-7, Formula: C17H16ClN3O2, MWT: 329.78084, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

2-Furancarboxamide, N-[1-(3-cyclohexyl-3-hydroxypropyl)-4-piperidinyl]-N-(5-methyl-2-pyridinyl)-, hydrochloride, Alternative-names: , CAS# 793674-76-7, Formula: C25H36ClN3O3, MWT: 462.02464, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

2-Pyrrolidinecarboxamide, N-[2,3-dioxo-1-(phenylmethyl)-3-[(2-pyridinylmethyl)amino]propyl]-5-oxo-1-(phenylmethyl)-, Alternative-names: , CAS# 1254699-12-1, Formula: C28H28N4O4, MWT: 484.54632, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MK196, Alternative-names: Indacrinone; Indacrynic acid; Indanone, CAS# 56049-88-8, Formula: C18H14Cl2O4, MWT: 365.20736, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

1,4-Benzodioxin-5-carboxamide, 8-amino-7-chloro-N-[(2S)-1,4-diazabicyclo[2.2.2]oct-2-ylmethyl]-2,3-dihydro-, Alternative-names: , CAS# 186348-68-5, Formula: C16H21ClN4O3, MWT: 352.81594, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

1H-Indole-2-carboxamide, N-[(3R)-1-(2-fluorophenyl)-3,4,6,7-tetrahydro-4-oxopyrrolo[3,2,1-jk][1,4]benzodiazepin-3-yl]-, Alternative-names: , CAS# 167820-10-2, Formula: C26H19FN4O2, MWT: 438.4530632, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

Alpertine, Alternative-names: Win 31665, CAS# 27076-46-6, Formula: C25H31N3O4, MWT: 437.53134, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

P2647, Alternative-names: BZQ; Benzoquinamide; Benzquinamide; Emete-Con; Emeticon, CAS# 63-12-7, Formula: C22H32N2O5, MWT: 404.49988, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

KDR-in-4, Alternative-names: , CAS# 408502-06-7, Formula: C23H25N3O3, MWT: 391.4629, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

1H-Indole-2-carboxamide, 5-methoxy-3-(1-methylethoxy)-1-phenyl-N-2H-tetrazol-5-yl-, Alternative-names: , CAS# 104961-19-5, Formula: C20H20N6O3, MWT: 392.4112, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

L162441, Alternative-names: , CAS# 154512-46-6, Formula: C34H43N5O5S, MWT: 633.80072, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

5-HT2 antagonist 1, Alternative-names: , CAS# 191592-09-3, Formula: C22H29FN4O2, MWT: 400.4896632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: Adrenergic Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

S1PR1-MO-1, Alternative-names: , CAS# 1149727-61-6, Formula: C25H29N3O3, MWT: 419.51606, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

Biricodar, Alternative-names: VX-710, CAS# 159997-94-1, Formula: C34H41N3O7, MWT: 603.70524, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: P-glycoprotein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

(4E)-SUN9221, Alternative-names: , CAS# 222318-55-0, Formula: C25H31FN4O3, MWT: 454.5370432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: Adrenergic Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Phenol, 4-[1-[4-[2-(dimethylamino)ethoxy]phenyl]-2-[4-(1-methylethyl)phenyl]-1-butenyl]-, dihydrogen phosphate (ester), Alternative-names: , CAS# 115767-64-1, Formula: C29H36NO5P, MWT: 509.573602, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MCI826, Alternative-names: Biricodar; Incel, CAS# 140646-80-6, Formula: C22H28N2O3S, MWT: 400.53432, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: P-glycoprotein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

5-HT3 antagonist 1, Alternative-names: , CAS# 129294-09-3, Formula: C22H27N5O, MWT: 377.48268, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

LMP744, Alternative-names: MJ-III65; NSC706744, CAS# 308246-52-8, Formula: C24H24N2O7, MWT: 452.45656, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

Urea, N-[2,6-bis(1-methylethyl)phenyl]-N'-[[(4R,5R)-4,5-dimethyl-2-[4-(phosphonooxy)phenyl]-1,3-dioxolan-2-yl]methyl]-, Alternative-names: , CAS# 169474-77-5, Formula: C25H35N2O7P, MWT: 506.528362, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

R66905, Alternative-names: Saperconazole, CAS# 110588-57-3, Formula: C35H38F2N8O4, MWT: 672.7242264, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

PD0332334-0002, Alternative-names: PF00195889-01, CAS# 610300-00-0, Formula: C9H20ClNO2, MWT: 209.7136, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

KFM19, Alternative-names: , CAS# 133058-72-7, Formula: C16H22N4O3, MWT: 318.37088, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

2-Pyridineacetamide, 3-chloro-N-[(1R)-1-(3-chlorophenyl)ethyl]-6-[[2,2-difluoro-2-(1-oxido-2-pyridinyl)ethyl]amino]-, 1-oxide, Alternative-names: , CAS# 855998-46-8, Formula: C22H20Cl2F2N4O3, MWT: 497.3220064, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

AR-​08, Alternative-names: , CAS# 226081-74-9, Formula: C12H12N6, MWT: 240.26388, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg

2: PN: US20040072744 SEQID: 2 claimed protein, Alternative-names: , CAS# 389572-87-6, Formula: C43H67N13O17S, MWT: 1070.13398, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

ONO4057, Alternative-names: ONO-LB457, CAS# 134578-96-4, Formula: C27H34O7, MWT: 470.55466, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Revexepride, Alternative-names: , CAS# 219984-49-3, Formula: C21H32ClN3O4, MWT: 425.94948, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Neuronal Signaling;GPCR/G Protein, Target: Cytochrome P450;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sch59498, Alternative-names: , CAS# 224157-99-7, Formula: C17H25N5O, MWT: 315.4133, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Gastrin/CCK antagonist 1, Alternative-names: , CAS# 162271-52-5, Formula: C28H32FN5O4, MWT: 521.5831832, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cholecystokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

5α-reductase-IN-1 , Alternative-names: , CAS# 119348-12-8, Formula: C31H37NO5, MWT: 503.62918, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

KP496, Alternative-names: , CAS# 217799-03-6, Formula: C31H34ClN3O7S3, MWT: 692.26556, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Heptanamide, N-(1-cyanocyclopropyl)-4,4-difluoro-2-[[(1S)-2,2,2-trifluoro-1-(4-fluorophenyl)ethyl]amino]-, (2S)-, Alternative-names: , CAS# 1017931-53-1, Formula: C19H21F6N3O, MWT: 421.3799592, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Pyridinium, 1-ethyl-2-[[(2-methoxybenzoyl)[[2-methoxy-3-[[[4-[[(octadecylamino)carbonyl]oxy]-1-piperidinyl]carbonyl]oxy]propoxy]carbonyl]amino]methyl]-, chloride, Alternative-names: , CAS# 128400-55-5, Formula: C46H73ClN4O9, MWT: 861.54622, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

L791943, Alternative-names: , CAS# 192767-01-4, Formula: C24H17F10NO4, MWT: 573.380112, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Benzamide, 4-amino-5-chloro-2-propoxy-N-[1-[3-(tetrahydro-2-furanyl)propyl]-4-piperidinyl]-, Alternative-names: , CAS# 108226-05-7, Formula: C22H34ClN3O3, MWT: 423.97666, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

LM985, Alternative-names: , CAS# 87626-56-0, Formula: C23H25NO4, MWT: 379.4489, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Tigemonam, Alternative-names: , CAS# 102507-71-1, Formula: C12H15N5O9S2, MWT: 437.4056, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

BO3482, Alternative-names: , CAS# 198013-53-5, Formula: C14H20N2NaO5S2, MWT: 383.43876928, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

ZD8321, Alternative-names: , CAS# 182073-77-4, Formula: C18H28F3N3O5, MWT: 423.4272296, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Elastase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CMI-392, Alternative-names: , CAS# 205654-37-1, Formula: C31H37ClN2O8S, MWT: 633.15208, Solubility: , Clinical_Information: No Development Reported, Pathway: Others;Metabolic Enzyme/Protease, Target: Others;5-Lipoxygenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

3-Piperidinamine, N-[[3,4-dihydro-6-methoxy-1-methyl-1-(trifluoromethyl)-1H-2-benzopyran-7-yl]methyl]-2-phenyl-, (2S,3S)-, Alternative-names: , CAS# 225526-17-0, Formula: C24H29F3N2O2, MWT: 434.4944696, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

AZD1979, Alternative-names: , CAS# 1254035-84-1, Formula: C25H26N4O5, MWT: 462.49774, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Glycine, N,N-dimethyl-, 2-[4-[4-[5-[(acetylamino)methyl]-2-oxo-3-oxazolidinyl]-2-fluorophenyl]-1-piperazinyl]-2-oxoethyl ester, (S)-, Alternative-names: , CAS# 170104-58-2, Formula: C22H30FN5O6, MWT: 479.5019032, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

FPL59360, Alternative-names: Minocromil, CAS# 85118-44-1, Formula: C18H16N2O6, MWT: 356.32944, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Dodecanoic acid, (3R,​5R)​-​5-​[2-​[2-​[2-​(3-​methoxyphenyl)​ethyl]​phenoxy]​ethyl]​-​1-​methyl-​3-​pyrrolidinyl ester, Alternative-names: , CAS# 191155-65-4, Formula: C34H51NO4, MWT: 537.77304, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

1H-Pyrazolo[3,4-g]quinoline, 4,4a,5,6,7,8,8a,9-octahydro-7-[(methylthio)methyl]-5-propyl-, (4aR,8aR)-rel-, Alternative-names: , CAS# 374538-23-5, Formula: C15H25N3S, MWT: 279.4441, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Bometolol Hydrochloride, Alternative-names: , CAS# 65023-16-7, Formula: C25H33ClN2O7, MWT: 508.99172, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Pentanoic acid, 5-[(3-methoxypropyl)pentylamino]-4-[(2-naphthalenylsulfonyl)methyl]-5-oxo-, Alternative-names: , CAS# 137004-80-9, Formula: C25H35NO6S, MWT: 477.6135, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Octanoic acid, 3-(aminomethyl)-5-methyl-, hydrochloride, (3S,5R)-, Alternative-names: Octanoic acid, 3-(aminomethyl)-5-methyl-, hydrochloride, (3S,5R)-, CAS# 313653-15-5, Formula: C10H22ClNO2, MWT: 223.74018, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

WQ3810, Alternative-names: KPI-10 free base, CAS# 888032-58-4, Formula: C22H22F3N5O3, MWT: 461.4369896, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

1,6-Diazaspiro[3.5]nonane-1-propanenitrile, 3-methyl-β-oxo-6-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-, Alternative-names: , CAS# 1263774-57-7, Formula: C17H20N6O, MWT: 324.3803, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

L-Leucine, N-[4-[4-[[(2R)-2-hydroxy-2-[4-hydroxy-3-[(methylsulfonyl)amino]phenyl]ethyl]amino]-1-piperidinyl]benzoyl]-, Alternative-names: , CAS# 340757-05-3, Formula: C27H38N4O7S, MWT: 562.67822, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

1-Piperazinesulfonamide, 4-[1-[2-[1-(cyclopropylmethyl)-3-(3,4-dichlorophenyl)-6-oxo-3-piperidinyl]ethyl]-3-azetidinyl]-, Alternative-names: , CAS# 178310-77-5, Formula: C24H35Cl2N5O3S, MWT: 544.5374, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Spiro[2H-1-benzopyran-2,4'-piperidine], methanesulfonamide deriv., Alternative-names: , CAS# 136079-82-8, Formula: C25H29N3O4S, MWT: 467.58046, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

BM152054, Alternative-names: , CAS# 213411-84-8, Formula: C22H18N2O4S3, MWT: 470.58432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Propanoic acid, 2-[4-[3-[2-(2,4-dichlorophenyl)-5-(1-methylethyl)-4-oxazolyl]-1-oxopropyl]phenoxy]-2-methyl-, Alternative-names: , CAS# 400760-25-0, Formula: C25H25Cl2NO5, MWT: 490.3757, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Benzenepropanoic acid, β-1-propyn-1-yl-4-(spiro[5.5]undec-2-en-2-ylmethoxy)-, (βS)-, Alternative-names: , CAS# 1147729-48-3, Formula: C24H30O3, MWT: 366.4932, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Acetamide, N-[1-[5-chloro-2-[1-[[(3S,4R)-4-(2,4-difluorophenyl)-1-(1,1-dimethylethyl)-3-pyrrolidinyl]carbonyl]-4-piperidinyl]phenyl]ethyl]-, Alternative-names: , CAS# 455957-28-5, Formula: C30H38ClF2N3O2, MWT: 546.0914264, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Benzonitrile, 3-chloro-4-[2-(4-chlorophenyl)-4-[1-(4-cyanophenyl)ethyl]-1-piperazinyl]-, Alternative-names: , CAS# 890037-68-0, Formula: C26H22Cl2N4, MWT: 461.38568, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CMI977, Alternative-names: LDP977, CAS# 175212-04-1, Formula: C16H19FN2O4, MWT: 322.3314632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: 5-Lipoxygenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Bimoclomol, Alternative-names: N-[2-Hydroxy-3-(1-piperidinyl)propoxy]-3-pyridinecarboximidoyl chloride, CAS# 130493-03-7, Formula: C14H20ClN3O2, MWT: 297.7805, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

L-689502, Alternative-names: , CAS# 138483-63-3, Formula: C39H51N3O7, MWT: 673.83814, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HIV Protease, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Fiduxosin, Alternative-names: , CAS# 208993-54-8, Formula: C30H29N5O4S, MWT: 555.64736, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

ACT 178882, Alternative-names: , CAS# 1007392-69-9, Formula: C33H38Cl3N3O4, MWT: 647.03152, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Renin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

LY210073, Alternative-names: , CAS# 148291-65-0, Formula: C30H28O8, MWT: 516.53852, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Eravacycline (dihydrochloride), Alternative-names: TP-434 dihydrochloride;TP-434-046, CAS# 1334714-66-7, Formula: C27H33Cl2FN4O8, MWT: 631.4773232, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Fmoc-Ser(O-α-D-GalNAc(OAc)3)-OH, Alternative-names: Fmoc-Ser-(GalNAc(Ac)3-alpha-D)-OH;Fmoc-Ser[GalNAc(Ac)3-α-D]-OH;Fmoc-Ser(Ac3AcNH-α-Gal)-OH, CAS# 120173-57-1, Formula: C32H36N2O13, MWT: 656.63384, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

TYK2-IN-2, Alternative-names: , CAS# 2098466-94-3, Formula: C16H18N6O, MWT: 310.35372, Solubility: DMSO: ≥ 25 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Ioversol, Alternative-names: MP-328, CAS# 87771-40-2, Formula: C18H24I3N3O9, MWT: 807.1113, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Nicodicosapent, Alternative-names: , CAS# 1269181-69-2, Formula: C28H39N3O2, MWT: 449.6282, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

PRN1371, Alternative-names: , CAS# 1802929-43-6, Formula: C26H30Cl2N6O4, MWT: 561.4602, Solubility: DMSO: 15 mg/mL , Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

NITD609, Alternative-names: Cipargamin;KAE609, CAS# 1193314-23-6, Formula: C19H14Cl2FN3O, MWT: 390.2384, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

4-Allylcatechol, Alternative-names: 4-Allylpyrocatechol;Hydroxychavicol, CAS# 1126-61-0, Formula: C9H10O2, MWT: 150.1745, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

GNE-272, Alternative-names: , CAS# 1936428-93-1, Formula: C22H25FN6O2, MWT: 424.4713032, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Lanabecestat, Alternative-names: AZD3293;LY3314814, CAS# 1383982-64-6, Formula: C26H28N4O, MWT: 412.5267, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling, Target: Beta-secretase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Tavilermide, Alternative-names: MIM-D3, CAS# 263251-78-1, Formula: C24H32N6O11, MWT: 580.5445, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK, Target: Trk Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

LYC-55716, Alternative-names: , CAS# 2055536-64-4, Formula: C27H23F6NO6S, MWT: 603.5300392, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: ROR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

BMS-986158, Alternative-names: , CAS# 1800340-40-2, Formula: C30H33N5O2, MWT: 495.61532, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

2,4,6-Tribromophenyl caproate, Alternative-names: , CAS# 16732-09-5, Formula: C12H13Br3O2, MWT: 428.94242, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Diacetazotol, Alternative-names: Diacetotoluide, CAS# 83-63-6, Formula: C18H19N3O2, MWT: 309.36236, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

β-Apo-13-carotenone D3, Alternative-names: D'Orenone D3, CAS# 86530-28-1, Formula: C18H23D3O, MWT: 261.416925334, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Alisporivir, Alternative-names: DEB-025;Debio-025;UNIL-025;[D-MeAla]3-[EtVal]4-CsA, CAS# 254435-95-5, Formula: C63H113N11O12, MWT: 1216.63782, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Hispidol, Alternative-names: (Z)-Hispidol, CAS# 5786-54-9, Formula: C15H10O4, MWT: 254.2375, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Incyclinide, Alternative-names: CMT-3;COL-3, CAS# 15866-90-7, Formula: C19H17NO7, MWT: 371.3408, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

KIN1148, Alternative-names: , CAS# 1428729-56-9, Formula: C19H11N3OS2, MWT: 361.44014, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Phenol Red (sodium salt), Alternative-names: Phenolsulfonephthalein sodium salt, CAS# 34487-61-1, Formula: C19H13NaO5S, MWT: 376.3583, Solubility: H<sub>2</sub>O: 100 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Rhodamine 6G, Alternative-names: Basic Red 1, CAS# 989-38-8, Formula: C28H31ClN2O3, MWT: 479.0103, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg

Nile Blue A (sulfate), Alternative-names: Nile blue sulfate, CAS# 3625-57-8, Formula: C20H20N3O3S0.5, MWT: 366.42, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Agmatine (sulfate), Alternative-names: , CAS# 2482-00-0, Formula: C5H16N4O4S, MWT: 228.26994, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;Immunology/Inflammation, Target: Imidazoline Receptor;Imidazoline Receptor;NO Synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Moniliformin (sodium salt), Alternative-names: , CAS# 71376-34-6, Formula: C4HNaO3, MWT: 120.03870928, Solubility: DMSO: ≥45 mg/mL , Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Calcein Blue, Alternative-names: , CAS# 54375-47-2, Formula: C15H15NO7, MWT: 321.2821, Solubility: DMSO: ≥ 6 mg/mL(Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Lixivaptan, Alternative-names: VPA-985;WAY-VPA 985, CAS# 168079-32-1, Formula: C27H21ClFN3O2, MWT: 473.9259, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: Vasopressin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Acridine Orange (hydrochloride), Alternative-names: , CAS# 65-61-2, Formula: C17H20ClN3, MWT: 301.8138, Solubility: DMSO: ≥30 mg/mL; H<sub>2</sub>O: 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Bovine Serum Albumin, Alternative-names: Albumin bovine serum;BSA, CAS# 9048-46-8, Formula: N/A, MWT: 1000, Solubility: H<sub>2</sub>O: ≥ 176.66 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Isoorientin, Alternative-names: Homoorientin, CAS# 4261-42-1, Formula: C21H20O11, MWT: 448.3769, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Pyronin Y, Alternative-names: Pyronine G;C.I. 45005, CAS# 92-32-0, Formula: C17H19ClN2O, MWT: 302.79856, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

RVT-501, Alternative-names: E6005, CAS# 947620-48-6, Formula: C26H24N4O5, MWT: 472.4926, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

TC-G-1008, Alternative-names: GPR39-C3, CAS# 1621175-65-2, Formula: C18H19ClN6O2S, MWT: 418.90046, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GHSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

NSC 663284, Alternative-names: DA-3003-1, CAS# 383907-43-5, Formula: C15H16ClN3O3, MWT: 321.7589, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

KYA1797K, Alternative-names: , CAS# 1956356-56-1, Formula: C17H11KN2O6S2, MWT: 442.50734, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Stem Cell/Wnt, Target: β-catenin;Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

BT-11, Alternative-names: , CAS# 1912399-75-7, Formula: C30H24N8O2, MWT: 528.56396, Solubility: DMSO: ≥30 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

HMN-154, Alternative-names: , CAS# 173528-92-2, Formula: C20H18N2O3S, MWT: 366.43352, Solubility: DMSO: ≥15 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

SU5408, Alternative-names: , CAS# 15966-93-5, Formula: C18H18N2O3, MWT: 310.34712, Solubility: DMSO: 6 mg/mL , Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Leniolisib, Alternative-names: CDZ173, CAS# 1354690-24-6, Formula: C21H25F3N6O2, MWT: 450.4574, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: Phase 3, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Valrocemide, Alternative-names: TV1901, CAS# 92262-58-3, Formula: C10H20N2O2, MWT: 200.278, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Bromobimane, Alternative-names: Monobromobimane, CAS# 71418-44-5, Formula: C10H11BrN2O2, MWT: 271.1105, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Gadopentetate (dimeglumine), Alternative-names: SH-L-451A;Gadopentetic acid dimeglumine salt, CAS# 86050-77-3, Formula: C28H54GdN5O20, MWT: 937.99986, Solubility: DMSO: 5 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AZP-531, Alternative-names: , CAS# 1088543-62-7, Formula: C40H63N15O13, MWT: 962.02092, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: GPCR/G Protein, Target: GHSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

LXS196, Alternative-names: , CAS# 1874276-76-2, Formula: C22H23F3N8O, MWT: 472.4662296, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: Phase 1, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

NBD-Cl, Alternative-names: NBD chloride, CAS# 10199-89-0, Formula: C6H2ClN3O3, MWT: 199.5514, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Chrysin, Alternative-names: 5,7-Dihydroxyflavone, CAS# 480-40-0, Formula: C15H10O4, MWT: 254.2375, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Sulforhodamine B acid chloride, Alternative-names: , CAS# 62796-29-6, Formula: C27H29ClN2O6S2, MWT: 577.11196, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Congo Red, Alternative-names: , CAS# 573-58-0, Formula: C32H22N6Na2O6S2, MWT: 696.6632, Solubility: DMSO：≥ 150 mg/mL; H<sub>2</sub>O: 4.16 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

14-Deoxy-11,12-didehydroandrographolide, Alternative-names: 14-dehydro Andrographolide;AP10, CAS# 42895-58-9, Formula: C20H28O4, MWT: 332.4339, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sulforhodamine B (sodium salt), Alternative-names: Acid Red 52;Kiton Red 620, CAS# 3520-42-1, Formula: C27H29N2NaO7S2, MWT: 580.64812928, Solubility: DMSO or H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Pyranine, Alternative-names: HPTS;Solvent Green 7, CAS# 6358-69-6, Formula: C16H7Na3O10S3, MWT: 524.3851, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Fluorescein, Alternative-names: Resorcinol phthalein, CAS# 2321-07-5, Formula: C20H12O5, MWT: 332.3063, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg

Propidium (Iodide), Alternative-names: PI, CAS# 25535-16-4, Formula: C27H34I2N4, MWT: 668.3946, Solubility: H<sub>2</sub>O: 6 mg/mL (Need ultrasonic and warming), Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

H2DCFDA, Alternative-names: DCFH-DA;2',7'-Dichlorodihydrofluorescein diacetate, CAS# 4091-99-0, Formula: C24H16Cl2O7, MWT: 487.28564, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

2,3-Diaminonaphthalene, Alternative-names: , CAS# 771-97-1, Formula: C10H10N2, MWT: 158.1998, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g

Enasidenib (mesylate), Alternative-names: AG-221 mesylate, CAS# 1650550-25-6, Formula: C20H21F6N7O4S, MWT: 569.4806592, Solubility: DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Isocitrate Dehydrogenase (IDH), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

IU1, Alternative-names: , CAS# 314245-33-5, Formula: C18H21FN2O, MWT: 300.3705, Solubility: DMSO: ≥ 60 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Deubiquitinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Bromothymol Blue, Alternative-names: , CAS# 76-59-5, Formula: C27H28Br2O5S, MWT: 624.3812, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Melanotan I, Alternative-names: MT-I;[Nle4,D-Phe7]-α-MSH, CAS# 75921-69-6, Formula: C78H111N21O19, MWT: 1646.84524, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Betamethasone dipropionate, Alternative-names: Betamethasone 17,21-dipropionate, CAS# 5593-20-4, Formula: C28H37FO7, MWT: 504.5875832, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg

inS3-54A18, Alternative-names: , CAS# 328998-53-4, Formula: C23H16ClNO2, MWT: 373.83164, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Avoralstat, Alternative-names: BCX4161, CAS# 918407-35-9, Formula: C28H27N5O5, MWT: 513.5445, Solubility: DMSO: ≥ 60 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Thioflavin T, Alternative-names: Basic Yellow 1, CAS# 2390-54-7, Formula: C17H19ClN2S, MWT: 318.8642, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g

Sulfo-SMCC (sodium), Alternative-names: , CAS# 92921-24-9, Formula: C16H17N2NaO9S, MWT: 436.36894928, Solubility: H<sub>2</sub>O: 6 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AG 555, Alternative-names: Tyrphostin AG 555, CAS# 133550-34-2, Formula: C19H18N2O3, MWT: 322.3578, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ST271, Alternative-names: , CAS# 106392-48-7, Formula: C16H20N2O2, MWT: 272.3422, Solubility: DMSO: ≥ 110 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

R162, Alternative-names: , CAS# 64302-87-0, Formula: C17H12O3, MWT: 264.27538, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

AAI101, Alternative-names: , CAS# 1001404-83-6, Formula: C11H14N4O5S, MWT: 314.31766, Solubility: DMSO: ≥ 113.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ZK756326 (dihydrochloride), Alternative-names: , CAS# 1780259-94-0, Formula: C21H30Cl2N2O3, MWT: 429.3805, Solubility: DMSO: 6 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

E7046, Alternative-names: , CAS# 1369489-71-3, Formula: C22H18F5N3O4, MWT: 483.388036, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: Phase 1, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

4-Methylumbelliferone, Alternative-names: Hymecromone;4-MU, CAS# 90-33-5, Formula: C10H8O3, MWT: 176.1687, Solubility: DMSO: ≥ 300 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Lupeol, Alternative-names: Fagarasterol, CAS# 545-47-1, Formula: C30H50O, MWT: 426.7174, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Eravacycline, Alternative-names: TP-434, CAS# 1207283-85-9, Formula: C27H31FN4O8, MWT: 558.5554, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Mitoquinone (mesylate), Alternative-names: Mitoquinone methanesulfonate;MitoQ10 mesylate;MitoQ mesylate, CAS# 845959-50-4, Formula: C38H47O7PS, MWT: 678.814342, Solubility: H<sub>2</sub>O: 1.66 mg/mL(Need ultrasonic and warming at 60°C), Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

DMA (trihydrochloride), Alternative-names: , CAS# 2095832-33-8, Formula: C27H31Cl3N6O2, MWT: 577.93304, Solubility: H<sub>2</sub>O: 15.9 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Hoechst 33258 (trihydrochloride), Alternative-names: bisBenzimide H 33258 trihydrochloride;H 33258 trihydrochloride, CAS# 23491-45-4, Formula: C25H27Cl3N6O, MWT: 533.88048, Solubility: H<sub>2</sub>O: ≥ 72.85 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Hoechst 33342 analog 2 (trihydrochloride), Alternative-names: , CAS# 155815-98-8, Formula: C25H26Cl3IN6O, MWT: 659.77701, Solubility: H<sub>2</sub>O: 15.83 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Polaprezinc, Alternative-names: Zinc L-carnosine, CAS# 107667-60-7, Formula: C9H11N4O3Zn, MWT: 288.58864, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Cobimetinib (hemifumarate), Alternative-names: GDC-0973 hemifumarate;XL-518 hemifumarate, CAS# 1369665-02-0, Formula: C25H25F3IN3O6, MWT: 647.3821796, Solubility: DMSO, Clinical_Information: Launched, Pathway: MAPK/ERK Pathway, Target: MEK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

KY1220, Alternative-names: , CAS# 292168-79-7, Formula: C14H10N4O3S, MWT: 314.3192, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Stem Cell/Wnt, Target: β-catenin;Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

KDM4D-IN-1, Alternative-names: , CAS# 2098902-68-0, Formula: C11H7N5O, MWT: 225.20618, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Givinostat (hydrochloride monohydrate), Alternative-names: Gavinostat hydrochloride monohydrate;ITF-2357 hydrochloride monohydrate, CAS# 732302-99-7, Formula: C24H30ClN3O5, MWT: 475.9651, Solubility: DMSO：≥ 100 mg/mL, Clinical_Information: Phase 3, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Avapritinib, Alternative-names: BLU-285, CAS# 1703793-34-3, Formula: C26H27FN10, MWT: 498.5579832, Solubility: DMSO：≥ 83.33 mg/mL, Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Kit, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ro 10-5824 (dihydrochloride), Alternative-names: , CAS# 189744-94-3, Formula: C17H22Cl2N4, MWT: 353.28938, Solubility: H<sub>2</sub>O: ≥ 60 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Loxiglumide, Alternative-names: CR-1505, CAS# 107097-80-3, Formula: C21H30Cl2N2O5, MWT: 461.3793, Solubility: DMSO：≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cholecystokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AVN-492, Alternative-names: , CAS# 1220646-23-0, Formula: C17H21N5O2S, MWT: 359.44594, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

ER-000444793, Alternative-names: , CAS# 792957-74-5, Formula: C23H18N2O2, MWT: 354.40122, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

GIBH-130, Alternative-names: , CAS# 1252608-59-5, Formula: C20H20N6O, MWT: 360.4124, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Interleukin Related, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

SB-649868, Alternative-names: GSK649868, CAS# 380899-24-1, Formula: C26H24FN3O3S, MWT: 477.5504632, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Orexin Receptor (OX Receptor), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

ML-030, Alternative-names: , CAS# 1013750-77-0, Formula: C20H20N4O4S, MWT: 412.4622, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Mycro 3, Alternative-names: , CAS# 944547-46-0, Formula: C24H17ClF2N6O4, MWT: 526.8794, Solubility: DMSO：≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: c-Myc, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Biocytin, Alternative-names: (+)-Biocytin, CAS# 576-19-2, Formula: C16H28N4O4S, MWT: 372.48292, Solubility: H<sub>2</sub>O: 6 mg/mL(Need ultrasound), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Nociceptin, Alternative-names: Orphanin FQ, CAS# 170713-75-4, Formula: C79H129N27O22, MWT: 1809.03726, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Ac-DEVD-pNA, Alternative-names: N-Acetyl-Asp-Glu-Val-Asp-p-Nitroanilide, CAS# 189950-66-1, Formula: C26H34N6O13, MWT: 638.58056, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Octreotide, Alternative-names: SMS 201-995, CAS# 83150-76-9, Formula: C49H66N10O10S2, MWT: 1019.239, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Somatostatin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

VIP(6-28)(human, rat, porcine, bovine), Alternative-names: FTDNYTRLRKQMAVKKYLNSILN, CAS# 69698-54-0, Formula: C126H207N37O34S, MWT: 2816.28428, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug

M40, Alternative-names: GWTLNSAGYLLGPPPALALA, CAS# 143896-17-7, Formula: C95H146N22O24, MWT: 1980.30874, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Neuropeptide Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

NFAT Inhibitor, Alternative-names: VIVIT peptide;MAGPHPVIVITGPHEE, CAS# 249537-73-3, Formula: C75H120N20O22S, MWT: 1685.9411, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

LEP(116-130)(mouse), Alternative-names: SCSLPQTSGLQKPES, CAS# 258276-95-8, Formula: C64H109N19O24S, MWT: 1560.72816, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Hexa-D-arginine, Alternative-names: RRRRRR;Furin Inhibitor II, CAS# 673202-67-0, Formula: C36H75N25O6, MWT: 954.1446, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MLCK inhibitor peptide 18, Alternative-names: RKKYKYRRK, CAS# 224579-74-2, Formula: C60H105N23O11, MWT: 1324.6232, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Cytoskeleton, Target: CaMK;Myosin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Hemokinin 1 (mouse), Alternative-names: RSRTRQFYGLM, CAS# 208041-90-1, Formula: C61H100N22O15S, MWT: 1413.6501, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

[bAla8]-Neurokinin A(4-10), Alternative-names: DSFVXLM;MEN 10210, CAS# 122063-01-8, Formula: C35H56N8O10S, MWT: 780.93174, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Angiotensin 1 (Human), Alternative-names: DRVYIHPFHL;Angiotensin I (human, mouse, rat), CAS# 484-42-4, Formula: C62H89N17O14, MWT: 1296.47556, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

[Pyr1]-Apelin-13, Alternative-names: XRPRLSHKGPMPF;[pGlu1]-Apelin-13, CAS# 217082-60-5, Formula: C70H109N21O16S, MWT: 1532.81056, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

DAPTA, Alternative-names: ASTTTNYT;D-Ala-peptide T-amide;Adaptavir, CAS# 106362-34-9, Formula: C35H56N10O15, MWT: 856.87714, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation;GPCR/G Protein;Anti-infection, Target: CCR;CCR;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Neuropeptide W-23(human), Alternative-names: WYKHVASPRYHTVGRAAGL MGL;NPW-23, CAS# 383415-79-0, Formula: C120H184N34O28S, MWT: 2583.02096, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Motilin(human, porcine), Alternative-names: FVPIFTYGELQRMQEKERNKGQ, CAS# 52906-92-0, Formula: C120H188N34O35S, MWT: 2699.07, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Motilin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug

Compstatin, Alternative-names: ICVVQDWGHHRCT, CAS# 206645-99-0, Formula: C66H99N23O17S2, MWT: 1550.76616, Solubility: DMSO: ≥ 300 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Complement System, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug

[Sar9,Met(O2)11]-Substance P, Alternative-names: Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Sar-Leu-Met[O2]-NH2, CAS# 110880-55-2, Formula: C64H100N18O15S, MWT: 1393.6554, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Neurokinin A, Alternative-names: α-Neurokinin;Neuromedin L;Substance K, CAS# 86933-74-6, Formula: C50H80N14O14S, MWT: 1133.3206, Solubility: H<sub>2</sub>O: ≥ 60 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PLP(139-151), Alternative-names: HSLGKWLGHPDKF, CAS# 122018-58-0, Formula: C72H104N20O17, MWT: 1521.71996, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Deltorphin 2, Alternative-names: [D-Ala2]-Deltorphin II, CAS# 122752-16-3, Formula: C38H54N8O10, MWT: 782.88296, Solubility: H<sub>2</sub>O: 7.5 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GSK'872, Alternative-names: GSK872, CAS# 1346546-69-7, Formula: C19H17N3O2S2, MWT: 383.48718, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: RIP kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ferroquine, Alternative-names: Ferrochloroquine;SSR97193, CAS# 185055-67-8, Formula: C23H24ClFeN3, MWT: 433.7548, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Oclacitinib (maleate), Alternative-names: PF-03394197 maleate, CAS# 1208319-27-0, Formula: C19H27N5O6S, MWT: 453.51258, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GSK2193874, Alternative-names: , CAS# 1336960-13-4, Formula: C37H38BrF3N4O, MWT: 691.623, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Deoxycholic acid, Alternative-names: Cholanoic Acid;Desoxycholic acid, CAS# 83-44-3, Formula: C24H40O4, MWT: 392.572, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: GPCR19, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

PRIMA-1Met, Alternative-names: APR-246, CAS# 5291-32-7, Formula: C10H17NO3, MWT: 199.2469, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Autophagy;Apoptosis, Target: Autophagy;MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

CYC065, Alternative-names: , CAS# 1070790-89-4, Formula: C21H31N7O, MWT: 397.51714, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

JAK2 JH2 Tracer, Alternative-names: , CAS# 2101955-00-2, Formula: C38H27F2N7O6S, MWT: 747.7260864, Solubility: DMSO: ≥ 83.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

TMPA, Alternative-names: , CAS# 1258275-73-8, Formula: C21H32O6, MWT: 380.4752, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

MGAT2-IN-1, Alternative-names: , CAS# 1800025-30-2, Formula: C27H21ClF5N7O3S, MWT: 654.010756, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Soraprazan, Alternative-names: BY359, CAS# 261944-46-1, Formula: C21H25N3O3, MWT: 367.4415, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

NT-113, Alternative-names: , CAS# 1398833-56-1, Formula: C27H25ClFN5O2, MWT: 505.9711032, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

DS-1040 (Tosylate), Alternative-names: , CAS# 1335138-89-0, Formula: C23H35N3O5S, MWT: 465.6061, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

AS-35, Alternative-names: , CAS# 108427-72-1, Formula: C21H20N6O4, MWT: 420.4213, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Ethacridine (lactate), Alternative-names: Acrinol, CAS# 1837-57-6, Formula: C18H21N3O4, MWT: 343.37704, Solubility: DMSO：≥ 100 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Gastric mucin, Alternative-names: , CAS# 84082-64-4, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

CPI-444, Alternative-names: V81444, CAS# 1202402-40-1, Formula: C20H21N7O3, MWT: 407.42584, Solubility: DMSO: 75 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

TPX-0005, Alternative-names: , CAS# 1802220-02-5, Formula: C18H18FN5O2, MWT: 355.3662232, Solubility: DMSO: ≥ 83.3 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: ROS;Trk Receptor;ALK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Sulfogaiacol, Alternative-names: , CAS# 1321-14-8, Formula: C8H11KO5S, MWT: 258.33324, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Salicylamide, Alternative-names: 2-Hydroxybenzamide, CAS# 65-45-2, Formula: C7H7NO2, MWT: 137.136, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g

Piperazine (hexahydrate), Alternative-names: , CAS# 142-63-2, Formula: C4H22N2O6, MWT: 194.22728, Solubility: H<sub>2</sub>O: 150 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

FIN56, Alternative-names: , CAS# 1083162-61-1, Formula: C25H31N3O5S2, MWT: 517.66074, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Ferroptosis , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Tetrahydrouridine, Alternative-names: THU;NSC-112907, CAS# 18771-50-1, Formula: C9H16N2O6, MWT: 248.23314, Solubility: DMSO: ≥ 250 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 568ug

GLPG1690, Alternative-names: , CAS# 1628260-79-6, Formula: C30H33FN8O2S, MWT: 588.6988232, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Picrotoxin, Alternative-names: Cocculin, CAS# 124-87-8, Formula: C15H18O7 . C15H16O6, MWT: 301.29, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Lysozyme, Alternative-names: Muramidase, CAS# 9001-63-2, Formula: N/A, MWT: 1000, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 4, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug

Rhodamine B, Alternative-names: Basic Violet 10;Brilliant Pink B;Rhodamine O;Tetraethylrhodamine, CAS# 81-88-9, Formula: C28H31ClN2O3, MWT: 479.0103, Solubility: DMSO: 6 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Antifungal agent 1, Alternative-names: , CAS# 1265166-14-0, Formula: C19H13ClN2O3, MWT: 352.77112, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

IACS-9571, Alternative-names: , CAS# 1800477-30-8, Formula: C32H42N4O8S, MWT: 642.76288, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Aspartic acid (calcium), Alternative-names: Calcium L-aspartate, CAS# 21059-46-1, Formula: C4H5CaNO4, MWT: 171.1648, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

EP1013, Alternative-names: F1013, CAS# 223568-55-6, Formula: C18H23FN2O6, MWT: 382.3834232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Caspase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

(R)-GNE-140, Alternative-names: , CAS# 2003234-63-5, Formula: C25H23ClN2O3S2, MWT: 499.04472, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Lactate Dehydrogenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

ST034307, Alternative-names: , CAS# 133406-29-8, Formula: C10H4Cl4O2, MWT: 297.94956, Solubility: DMSO: 50 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

CPI-1205, Alternative-names: , CAS# 1621862-70-1, Formula: C27H33F3N4O3, MWT: 518.5711, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

sulfo-SPDB-DM4, Alternative-names: , CAS# 1626359-59-8, Formula: C46H63ClN4O17S3, MWT: 1075.65702, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

SPDB-DM4, Alternative-names: , CAS# 1626359-62-3, Formula: C46H63ClN4O14S2, MWT: 995.5938, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

SPB, Alternative-names: , CAS# 858128-57-1, Formula: C19H15NO8, MWT: 385.3243, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Gefarnate, Alternative-names: , CAS# 51-77-4, Formula: C27H44O2, MWT: 400.63706, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

S-Methyl-L-cysteine, Alternative-names: L-S-Methylcysteine, CAS# 1187-84-4, Formula: C4H9NO2S, MWT: 135.18476, Solubility: H<sub>2</sub>O: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

NVP-HDM201, Alternative-names: HDM201, CAS# 1448867-41-1, Formula: C26H24Cl2N6O4, MWT: 555.4125, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Asciminib, Alternative-names: ABL001, CAS# 1492952-76-7, Formula: C20H18ClF2N5O3, MWT: 449.8384264, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK, Target: Bcr-Abl, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

NAI-N3, Alternative-names: NAI-1, CAS# 1612756-29-2, Formula: C10H8N6O, MWT: 228.21012, Solubility: DMSO: ≥115 mg/mL; H<sub>2</sub>O: 1 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

NSC232003, Alternative-names: , CAS# 1905453-18-0, Formula: C6H7N3O3, MWT: 169.13808, Solubility: H<sub>2</sub>O: 17 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: E1/E2/E3 Enzyme, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Sulfisomidin, Alternative-names: Sulfaisodimidine, CAS# 515-64-0, Formula: C12H14N4O2S, MWT: 278.3302, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Piroctone olamine, Alternative-names: Piroctone ethanolamine, CAS# 68890-66-4, Formula: C16H30N2O3, MWT: 298.421, Solubility: DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

CCCP, Alternative-names: Carbonyl cyanide 3-chlorophenylhydrazone;Carbonyl Cyanide m-Chlorophenylhydrazone, CAS# 555-60-2, Formula: C9H5ClN4, MWT: 204.6158, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;Immunology/Inflammation, Target: IFNAR;STING, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Columbianadin, Alternative-names: , CAS# 5058-13-9, Formula: C19H20O5, MWT: 328.3591, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Piperazine (malate), Alternative-names: Piperazine DL-Malate, CAS# 14852-14-3, Formula: C8H16N2O5, MWT: 220.22304, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

LM22B-10, Alternative-names: , CAS# 342777-54-2, Formula: C27H33ClN2O4, MWT: 485.01492, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway;PI3K/Akt/mTOR;Protein Tyrosine Kinase/RTK, Target: ERK;ERK;Akt;Trk Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Dimemorfan (phosphate), Alternative-names: , CAS# 36304-84-4, Formula: C18H28NO4P, MWT: 353.392982, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Sigma Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Autophinib, Alternative-names: , CAS# 1644443-47-9, Formula: C14H11ClN6O3, MWT: 346.72854, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Perillartine, Alternative-names: DL-Perillartine, CAS# 30950-27-7, Formula: C10H15NO, MWT: 165.2322, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

WZ4141, Alternative-names: , CAS# 1222776-76-2, Formula: C16H13N3O2, MWT: 279.29332, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Ibuprofen piconol, Alternative-names: U75630, CAS# 64622-45-3, Formula: C19H23NO2, MWT: 297.39142, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Hydroxyethyl cellulose, Alternative-names: 2-Hydroxyethyl cellulose;Cellulose hydroxyethyl ether, CAS# 9004-62-0, Formula: N/A, MWT: 1000, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Lysozyme from chicken egg white, Alternative-names: KVFGRCELAA AMKRHGLDNY RGYSLGNWVC AAKFESNFNT QATNRNTDGSTDYGILQINS RWWCNDGRTP GSRNLCNIPC SALLSSDITA SVNCAKKIVS DGDGMNAWVA WRNRCKGTDV QAWIRGCRL, CAS# 12650-88-3, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

GDC-0326, Alternative-names: , CAS# 1282514-88-8, Formula: C19H22N6O3, MWT: 382.41638, Solubility: DMSO: ≥83.3 mg/mL , Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Thiamine nitrate, Alternative-names: Vitamin B1 nitrate, CAS# 532-43-4, Formula: C12H17N5O4S, MWT: 327.35948, Solubility: DMSO: 15 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

ATP, Alternative-names: Adenosine 5'-triphosphate, CAS# 56-65-5, Formula: C10H16N5O13P3, MWT: 507.181026, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

GI254023X, Alternative-names: GI4023;SRI028594, CAS# 260264-93-5, Formula: C21H33N3O4, MWT: 391.5044, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ac-DEVD-CHO, Alternative-names: N-Acetyl-Asp-Glu-Val-Asp-al, CAS# 169332-60-9, Formula: C20H30N4O11, MWT: 502.4724, Solubility: DMSO/H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Caspase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

CFSE, Alternative-names: 5(6)-Carboxyfluorescein diacetate succinimidyl ester;CFDA-SE;5(6)-CFDA N-succinmidyl ester, CAS# 150347-59-4, Formula: C29H19NO11, MWT: 557.46, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Suc-Leu-Leu-Val-Tyr-AMC, Alternative-names: Suc-LLVY-AMC, CAS# 94367-21-2, Formula: C40H53N5O10, MWT: 763.87632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Ac-DEVD-AMC, Alternative-names: N-Acetyl-Asp-Glu-Val-Asp-7-amido-4-Methylcoumarin, CAS# 169332-61-0, Formula: C30H37N5O13, MWT: 675.64048, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Coelenterazine, Alternative-names: , CAS# 55779-48-1, Formula: C26H21N3O3, MWT: 423.4632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug

Luciferase, Alternative-names: , CAS# 9014-00-0, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Biotin LC hydrazide, Alternative-names: Biotinamidocaproyl hydrazide;BACH;(+)-Biotinamidohexanoic Acid hydrazide;Biotin Aminocaproyl Hydrazide, CAS# 109276-34-8, Formula: C16H29N5O3S, MWT: 371.49816, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ac-DEVD-AFC, Alternative-names: N-Acetyl-Asp-Glu-Val-Asp-7-amido-4-trifluoromethylcoumarin, CAS# 201608-14-2, Formula: C30H34F3N5O13, MWT: 729.6118696, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

BAPTA-AM, Alternative-names: , CAS# 126150-97-8, Formula: C34H40N2O18, MWT: 764.684, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Amylase, Alternative-names: , CAS# 9000-92-4, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

gamma-DGG, Alternative-names: γDGG;γ-D-Glutamylglycine, CAS# 6729-55-1, Formula: C7H12N2O5, MWT: 204.1806, Solubility: H<sub>2</sub>O: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

FX1, Alternative-names: , CAS# 1426138-42-2, Formula: C14H9ClN2O4S2, MWT: 368.81526, Solubility: DMSO: 30 mg/mL  (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

ACY-775, Alternative-names: , CAS# 1375466-18-4, Formula: C17H19FN4O2, MWT: 330.3568, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

GGTI298 Trifluoroacetate, Alternative-names: , CAS# 1217457-86-7, Formula: C29H34F3N3O5S, MWT: 593.6576, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Ras, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

GLP-2(1-33)(human), Alternative-names: GLP-2 (human);Glucagon-like peptide 2 (human);HADGSFSDEMNTILDNLAARDFINWLIQTKITD, CAS# 223460-79-5, Formula: C126H207N37O34S, MWT: 2816.28428, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Benzamil hydrochloride, Alternative-names: Benzylamiloride hydrochloride, CAS# 161804-20-2, Formula: C13H15Cl2N7O, MWT: 356.2105, Solubility: DMSO: 100 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Rhodamine 123, Alternative-names: R-22420;RH-123, CAS# 62669-70-9, Formula: C21H17ClN2O3, MWT: 380.8243, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Dihydrofluorescein diacetate, Alternative-names: , CAS# 35340-49-9, Formula: C24H18O7, MWT: 418.39552, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Glycyrrhizic acid, Alternative-names: Glycyrrhizin, CAS# 1405-86-3, Formula: C42H62O16, MWT: 822.93208, Solubility: DMSO: ≥ 10 mM, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Trimethobenzamide hydrochloride, Alternative-names: Ro 2-9578, CAS# 554-92-7, Formula: C21H29ClN2O5, MWT: 424.91836, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Cloperastine fendizoate, Alternative-names: , CAS# 85187-37-7, Formula: C40H38ClNO5, MWT: 648.18642, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

(-)-Gallocatechin gallate, Alternative-names: (-)-Gallocatechol gallate, CAS# 4233-96-9, Formula: C22H18O11, MWT: 458.3717, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Rhodamine 110, Alternative-names: Rhodamine 110 chloride;RH110, CAS# 13558-31-1, Formula: C20H15ClN2O3, MWT: 366.7977, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

3,3'-Dioctadecyloxacarbocyanine perchlorate, Alternative-names: DiO;DiOC18(3), CAS# 34215-57-1, Formula: C53H85ClN2O6, MWT: 881.7048, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

D-Luciferin potassium salt, Alternative-names: , CAS# 115144-35-9, Formula: C11H7KN2O3S2, MWT: 318.41318, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Quin-2AM, Alternative-names: Quin-2 acetoxymethyl ester, CAS# 83104-85-2, Formula: C38H43N3O18, MWT: 829.75732, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Dabsyl chloride, Alternative-names: DABS-Cl, CAS# 56512-49-3, Formula: C14H14ClN3O2S, MWT: 323.79786, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Calcein, Alternative-names: Fluorexon, CAS# 1461-15-0, Formula: C30H26N2O13, MWT: 622.533, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Thioflavine S, Alternative-names: Direct Yellow 7;Thioflavin S, CAS# 1326-12-1, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

EGTA-​AM, Alternative-names: EGTA Acetoxymethyl ester, CAS# 99590-86-0, Formula: C26H40N2O18, MWT: 668.5984, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SNS-062, Alternative-names: , CAS# 1270014-40-8, Formula: C19H21ClN6O, MWT: 384.86264, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: Itk;Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Phe-Met-Arg-Phe amide trifluoroacetate, Alternative-names: Phe-Met-Arg-Phe-NH2 trifluoroacetate;FMRF-NH2 trifluoroacetate, CAS# 159237-99-7, Formula: C33H44F6N8O8S, MWT: 826.8066792, Solubility: H<sub>2</sub>O: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

DC260126, Alternative-names: , CAS# 346692-04-4, Formula: C16H18FNO2S, MWT: 307.3830232, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPR40, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ML167, Alternative-names: CID44968231;NCGC00188654, CAS# 1285702-20-6, Formula: C19H17N3O3, MWT: 335.3566, Solubility: DMSO: ≥ 125 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Phen-DC3 Trifluoromethanesulfonate, Alternative-names: Phen-DC3 Triflate, CAS# 929895-45-4, Formula: C36H26F6N6O8S2, MWT: 848.7474592, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: G-quadruplex, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

2-Aminoacridone, Alternative-names: , CAS# 27918-14-5, Formula: C13H10N2O, MWT: 210.236, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

5-IAF, Alternative-names: 5-Iodoacetamidofluorescein, CAS# 63368-54-7, Formula: C22H14INO6, MWT: 515.2542, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ADHP, Alternative-names: 10-Acetyl-3,7-dihydroxyphenoxazine, CAS# 119171-73-2, Formula: C14H11NO4, MWT: 257.24144, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ac-CoA Synthase Inhibitor1, Alternative-names: , CAS# 508186-14-9, Formula: C20H18N4O2S2, MWT: 410.51252, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: RSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

S 38093, Alternative-names: , CAS# 862896-30-8, Formula: C17H24N2O2, MWT: 288.38466, Solubility: DMSO: 15 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Deoxypseudouridine, Alternative-names: , CAS# 39967-60-7, Formula: C9H12N2O5, MWT: 228.20198, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Pseudothymidine, Alternative-names: , CAS# 65358-15-8, Formula: C10H14N2O5, MWT: 242.22856, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

2'-Deoxypseudoisocytidine, Alternative-names: , CAS# 65358-18-1, Formula: C9H13N3O4, MWT: 227.21722, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Hydroxocobalamin hydrochloride, Alternative-names: Vitamin B12a hydrochloride, CAS# 59461-30-2, Formula: C62H89ClCoN13O15P, MWT: 1381.808117, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

VH-298, Alternative-names: , CAS# 2097381-85-4, Formula: C27H33N5O4S, MWT: 523.64702, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: Ligand for E3 Ligase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Flavin Adenine Dinucleotide Disodium, Alternative-names: FAD-Na2;FAD sodium salt, CAS# 84366-81-4, Formula: C27H31N9Na2O15P2, MWT: 829.51340256, Solubility: DMSO: 6 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Apronal, Alternative-names: Allylisopropylacetylurea;Apronalide, CAS# 528-92-7, Formula: C9H16N2O2, MWT: 184.23554, Solubility: DMSO: ≥165 mg/mL , Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Hinokitiol, Alternative-names: β-Thujaplicin, CAS# 499-44-5, Formula: C10H12O2, MWT: 164.20108, Solubility: DMSO: ≥ 10 mM, Clinical_Information: No Development Reported, Pathway: Epigenetics;NF-κB, Target: DNA Methyltransferase;Keap1-Nrf2, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

7-Amino-4-(trifluoromethyl)coumarin, Alternative-names: AFC;Coumarin 151, CAS# 53518-15-3, Formula: C10H6F3NO2, MWT: 229.158, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Calcein-AM, Alternative-names: Calcein acetoxymethyl ester, CAS# 148504-34-1, Formula: C46H46N2O23, MWT: 994.8571, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100ug

Proxyphylline, Alternative-names: , CAS# 603-00-9, Formula: C10H14N4O3, MWT: 238.2432, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

CAY10602, Alternative-names: , CAS# 374922-43-7, Formula: C22H15FN4O2S, MWT: 418.4435032, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: Sirtuin;Sirtuin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

BCECF, Alternative-names: 2′,7′-Bis(2-carboxyethyl)-5(6)-carboxyfluorescein, CAS# 85138-49-4, Formula: C27H20O11, MWT: 520.44, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Norethindrone acetate, Alternative-names: 19-Norethindrone acetate, CAS# 51-98-9, Formula: C22H28O3, MWT: 340.4559, Solubility: , Clinical_Information: Launched, Pathway: Others, Target: Progesterone Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand 1, Alternative-names: , CAS# 1948273-03-7, Formula: C23H33ClN4O3S, MWT: 481.05112, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: Ligand for E3 Ligase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2g

E3 ligase Ligand 2, Alternative-names: , CAS# 5054-59-1, Formula: C13H10N2O5, MWT: 274.2289, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: Ligand for E3 Ligase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

E3 ligase Ligand 3, Alternative-names: , CAS# 1061605-21-7, Formula: C15H12N2O7, MWT: 332.26498, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: Ligand for E3 Ligase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

E3 ligase Ligand-Linker Conjugates 12, Alternative-names: , CAS# 1797406-80-4, Formula: C30H43N7O7S, MWT: 645.77012, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand-Linker Conjugates 13, Alternative-names: , CAS# 2010159-45-0, Formula: C28H39N7O6S, MWT: 601.71756, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2g

E3 ligase Ligand-Linker Conjugates 3, Alternative-names: , CAS# 2101200-09-1, Formula: C26H35N7O5S, MWT: 557.665, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand-Linker Conjugates 4, Alternative-names: , CAS# 1797406-81-5, Formula: C32H47N7O8S, MWT: 689.82268, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand-Linker Conjugates 5, Alternative-names: , CAS# 2097971-11-2, Formula: C30H46ClN5O7S, MWT: 656.23354, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

E3 ligase Ligand-Linker Conjugates 6, Alternative-names: , CAS# 2097973-72-1, Formula: C28H42ClN5O6S, MWT: 612.18098, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand-Linker Conjugates 7, Alternative-names: , CAS# 2064292-52-8, Formula: C32H50ClN5O8S, MWT: 700.2861, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Allantoin, Alternative-names: 5-Ureidohydantoin, CAS# 97-59-6, Formula: C4H6N4O3, MWT: 158.1154, Solubility: DMSO: 6 mg/mL , Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Imidazoline Receptor;Imidazoline Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AKP-11, Alternative-names: , CAS# 1220973-37-4, Formula: C22H22ClN3O5, MWT: 443.88018, Solubility: DMSO: ≥125 mg/mL , Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Revefenacin, Alternative-names: TD-4208;GSK1160724, CAS# 864750-70-9, Formula: C35H43N5O4, MWT: 597.747, Solubility: DMSO: ≥125 mg/mL , Clinical_Information: Phase 3, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Polyvinylpyrrolidone, Alternative-names: PVP;Polyvidone;Povidone, CAS# 9003-39-8, Formula: (C6H9NO)n, MWT: 1000, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Polidocanol, Alternative-names: Polyoxyethylene lauryl ether;Polyoxyethyleneglycol Dodecyl Ether, CAS# 9002-92-0, Formula: (C2H4O)nC12H26O, MWT: 1000, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Stigmasterol, Alternative-names: Stigmasterin, CAS# 83-48-7, Formula: C29H48O, MWT: 412.6908, Solubility: 10 mM in Ethanol, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Hyaluronic acid sodium salt, Alternative-names: Sodium hyaluronate, CAS# 9067-32-7, Formula: N/A, MWT: 1000, Solubility: H<sub>2</sub>O: 6.8 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

E3 ligase Ligand-Linker Conjugates 8, Alternative-names: , CAS# 1835705-55-9, Formula: C38H59ClN4O7S, MWT: 751.41566, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand-Linker Conjugates 9, Alternative-names: , CAS# 1835705-59-3, Formula: C40H63ClN4O10S, MWT: 827.46702, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand-Linker Conjugates 10, Alternative-names: , CAS# 1835705-57-1, Formula: C32H47ClN4O6S, MWT: 651.25678, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand-Linker Conjugates 11, Alternative-names: , CAS# 1835705-61-7, Formula: C39H61ClN4O6S, MWT: 749.44284, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

(R,R)-Palonosetron Hydrochloride, Alternative-names: , CAS# 135729-75-8, Formula: C19H25ClN2O, MWT: 332.8676, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

E3 ligase Ligand-Linker Conjugates 14, Alternative-names: , CAS# 1957236-21-3, Formula: C25H31F3N4O11, MWT: 620.5290496, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand-Linker Conjugates 16, Alternative-names: , CAS# 1799711-25-3, Formula: C21H23F3N4O8, MWT: 516.4245296, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 ligase Ligand-Linker Conjugates 17, Alternative-names: , CAS# 1950635-16-1, Formula: C25H31F3N4O8, MWT: 572.5308496, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2g

E3 ligase Ligand-Linker Conjugates 18, Alternative-names: , CAS# 2098488-36-7, Formula: C19H20N6O6, MWT: 428.3987, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

(+)-Borneol, Alternative-names: d-Borneol, CAS# 464-43-7, Formula: C10H18O, MWT: 154.2493, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Fadrozole, Alternative-names: , CAS# 102676-47-1, Formula: C14H13N3, MWT: 223.2731, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: Launched, Pathway: Others, Target: Aromatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Triclocarban, Alternative-names: 3,4,4′-Trichlorocarbanilide, CAS# 101-20-2, Formula: C13H9Cl3N2O, MWT: 315.5824, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Riboflavin Tetrabutyrate, Alternative-names: , CAS# 752-56-7, Formula: C33H44N4O10, MWT: 656.72326, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Bromisoval, Alternative-names: Bromovalerylurea, CAS# 496-67-3, Formula: C6H11BrN2O2, MWT: 223.0677, Solubility: DMSO: 300 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Piperazine adipate, Alternative-names: , CAS# 142-88-1, Formula: C10H20N2O4, MWT: 232.2768, Solubility: H<sub>2</sub>O: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Benzalkonium chloride, Alternative-names: Alkyldimethylbenzylammonium chloride, CAS# 8001-54-5, Formula: C6H5CH2N(CH3)2RCl (R=C8H17 to C18H37), MWT: 1000, Solubility: DMSO, Clinical_Information: Phase 4, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

p38-α MAPK-IN-1, Alternative-names: , CAS# 443913-15-3, Formula: C27H35N5O3, MWT: 477.5985, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

SGD-1882, Alternative-names: , CAS# 1222490-34-7, Formula: C42H39N5O7, MWT: 725.78836, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Pyridoxal phosphate, Alternative-names: Pyridoxal 5′-phosphate;Pyridoxyl phosphate, CAS# 54-47-7, Formula: C8H10NO6P, MWT: 247.1419, Solubility: H<sub>2</sub>O: 10 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Reverse Transcriptase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

GW842166X, Alternative-names: , CAS# 666260-75-9, Formula: C18H17Cl2F3N4O2, MWT: 449.2544, Solubility: DMSO: ≥83.3 mg/mL , Clinical_Information: Phase 1, Pathway: GPCR/G Protein, Target: Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

hVEGF-IN-1, Alternative-names: , CAS# 1637443-98-1, Formula: C34H43N7O2, MWT: 581.75092, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MKC9989, Alternative-names: , CAS# 1338934-20-5, Formula: C17H20O7, MWT: 336.3365, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: IRE1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

BCECF-AM, Alternative-names: , CAS# 117464-70-7, Formula: C40H36O19, MWT: 820.7, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Cresyl Violet acetate, Alternative-names: , CAS# 10510-54-0, Formula: C18H15N3O3, MWT: 321.33, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Cresyl Violet perchlorate, Alternative-names: Oxazine 9 perchlorate, CAS# 41830-80-2, Formula: C16H12ClN3O5, MWT: 361.73658, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Cy5.5, Alternative-names: , CAS# 210892-23-2, Formula: C41H44N2O14S4, MWT: 917.053, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Di-8-ANEPPS, Alternative-names: , CAS# 157134-53-7, Formula: C36H52N2O3S, MWT: 592.87468, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Cellulase, Alternative-names: , CAS# 9012-54-8, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Uridine triphosphate, Alternative-names: UTP;Uridine 5'-triphosphate, CAS# 63-39-8, Formula: C9H15N2O15P3, MWT: 484.141086, Solubility: H<sub>2</sub>O: ≥ 150 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Selamectin, Alternative-names: , CAS# 220119-17-5, Formula: C43H63NO11, MWT: 769.96042, Solubility: DMSO: 100 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

(+)-Cloprostenol, Alternative-names: D-Cloprostenol, CAS# 54276-21-0, Formula: C22H29ClO6, MWT: 424.91506, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Indole-3-carbinol, Alternative-names: 3-Indolemethanol, CAS# 700-06-1, Formula: C9H9NO, MWT: 147.1739, Solubility: DMSO: 150 mg/mL, Clinical_Information: Phase 2, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

L-Hisidine, Alternative-names: , CAS# 71-00-1, Formula: C6H9N3O2, MWT: 155.1546, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

L755507, Alternative-names: , CAS# 159182-43-1, Formula: C30H40N4O6S, MWT: 584.7268, Solubility: DMSO: 125 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Dimethylfraxetin, Alternative-names: 6,7,8-Trimethoxycoumarin;Fraxetin dimethyl ether, CAS# 6035-49-0, Formula: C12H12O5, MWT: 236.2207, Solubility: DMSO: 125 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Carbonic Anhydrase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

9-Aminocamptothecin, Alternative-names: 9-Amino-20(S)-camptothecin, CAS# 91421-43-1, Formula: C20H17N3O4, MWT: 363.3667, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

4,4'-Dimethoxybenzil, Alternative-names: p-Anisil, CAS# 1226-42-2, Formula: C16H14O4, MWT: 270.27996, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

4-Butylresorcinol, Alternative-names: Butylresorcinol, CAS# 18979-61-8, Formula: C10H14O2, MWT: 166.21696, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Tyrosinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Pamidronic acid, Alternative-names: , CAS# 40391-99-9, Formula: C3H11NO7P2, MWT: 235.0695, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Stem Cell/Wnt;Stem Cell/Wnt, Target: β-catenin;Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

L-Glutamic acid monosodium salt , Alternative-names: Monosodium glutamate, CAS# 142-47-2, Formula: C5H8NNaO4, MWT: 169.11108928, Solubility: DMSO: 100 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Benzo[a]pyrene, Alternative-names: 3,4-Benzopyrene, CAS# 50-32-8, Formula: C20H12, MWT: 252.30928, Solubility: DMSO: 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

NSC95682, Alternative-names: 6-Bromo-2-hydroxy-3-methoxybenzaldehyde, CAS# 20035-41-0, Formula: C8H7BrO3, MWT: 231.04338, Solubility: DMSO: 113 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: IRE1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Sulcotrione, Alternative-names: , CAS# 99105-77-8, Formula: C14H13ClO5S, MWT: 328.76802, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

β-Chloro-L-alanine, Alternative-names: L-β-Chloroalanine, CAS# 2731-73-9, Formula: C3H6ClNO2, MWT: 123.53824, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Thiamine monochloride, Alternative-names: Vitamin B1, CAS# 59-43-8, Formula: C12H17ClN4OS, MWT: 300.80758, Solubility: DMSO: 6 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Hypromellose, Alternative-names: Celacol HPM 5000;(Hydroxypropyl)methyl cellulose;HPMC, CAS# 9004-65-3, Formula: N/A, MWT: 1000, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Letrazuril, Alternative-names: , CAS# 103337-74-2, Formula: C17H9Cl2FN4O2, MWT: 391.1833632, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Colestyramine, Alternative-names: Cholestyramine resin;cholestyramine, CAS# 11041-12-6, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

(-)-Borneol, Alternative-names: L-Borneol, CAS# 464-45-9, Formula: C10H18O, MWT: 154.2493, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Rislenemdaz, Alternative-names: MK-0657;CERC-301, CAS# 808732-98-1, Formula: C19H23FN4O2, MWT: 358.4099232, Solubility: DMSO: 150 mg/mL, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

RET Kinase inhibitor 1, Alternative-names: , CAS# 1627856-64-7, Formula: C22H21F4N3O4, MWT: 467.4135, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Papaverine, Alternative-names: , CAS# 58-74-2, Formula: C20H21NO4, MWT: 339.385, Solubility: DMSO: ≥6.4 mg/mL , Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Stiripentol, Alternative-names: BCX2600, CAS# 49763-96-4, Formula: C14H18O3, MWT: 234.29092, Solubility: DMSO: 150 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

ML402, Alternative-names: , CAS# 298684-44-3, Formula: C14H14ClNO2S, MWT: 295.78446, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

BET bromodomain inhibitor, Alternative-names: , CAS# 1505453-59-7, Formula: C24H20ClN5O2, MWT: 445.9009, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

DL-α-Tocopherol acetate, Alternative-names: Vitamin E acetate, CAS# 52225-20-4, Formula: C31H52O3, MWT: 472.74278, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

CRT0066101 dihydrochloride, Alternative-names: , CAS# 1883545-60-5, Formula: C18H23ClN6O, MWT: 374.8678, Solubility: DMSO: ≥25mg/mL , Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: PKD, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

DL-Lysine, Alternative-names: (±)-2,6-Diaminocaproic acid, CAS# 70-54-2, Formula: C6H14N2O2, MWT: 146.18756, Solubility: H<sub>2</sub>O: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Eugenol, Alternative-names: , CAS# 97-53-0, Formula: C10H12O2, MWT: 164.2011, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection;Anti-infection, Target: Bacterial;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

740 Y-P, Alternative-names: 740YPDGFR;PDGFR 740Y-P, CAS# 1236188-16-1, Formula: C141H222N43O39PS3, MWT: 3270.704842, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sulforaphane, Alternative-names: , CAS# 4478-93-7, Formula: C6H11NOS2, MWT: 177.2876, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Tetrahydrobiopterin, Alternative-names: Sapropterin, CAS# 17528-72-2, Formula: C9H15N5O3, MWT: 241.2471, Solubility: DMSO: 160 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Quinidine, Alternative-names: , CAS# 56-54-2, Formula: C20H24N2O2, MWT: 324.41676, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Pentosan Polysulfate, Alternative-names: , CAS# 9062-57-1, Formula: N/A, MWT: 1000, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Apoptosis;NF-κB, Target: HIV;TNF-alpha;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Proteinase, Alternative-names: , CAS# 9001-92-7, Formula: N/A, MWT: 1000, Solubility: , Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Povidone iodine, Alternative-names: iodopovidone, CAS# 25655-41-8, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

α-Amylase, Alternative-names: , CAS# 9000-90-2, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Tannic acid, Alternative-names: , CAS# 1401-55-4, Formula: C76H52O46, MWT: 1701.198, Solubility: DMSO: 15 mg/mL, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

RORγ-IN-1, Alternative-names: , CAS# 1802706-04-2, Formula: C27H35F3N4O3S, MWT: 552.652, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: ROR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

DFO, Alternative-names: 9H-1,8-Diazafluoren-9-one, CAS# 54078-29-4, Formula: C11H6N2O, MWT: 182.1781, Solubility: , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Phosphorylcholine, Alternative-names: Phosphocholine chloride, CAS# 107-73-3, Formula: C5H15ClNO4P, MWT: 219.603662, Solubility: H<sub>2</sub>O: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

AGK2, Alternative-names: , CAS# 304896-28-4, Formula: C23H13Cl2N3O2, MWT: 434.2742, Solubility: DMSO: 6 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: Sirtuin;Sirtuin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Eniporide hydrochloride, Alternative-names: EMD-96785 hydrochloride, CAS# 211813-86-4, Formula: C14H17ClN4O3S, MWT: 356.82778, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

WR-1065 dihydrochloride, Alternative-names: , CAS# 14653-77-1, Formula: C5H16Cl2N2S, MWT: 207.16494, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CP 376395, Alternative-names: CP-316311, CAS# 175140-00-8, Formula: C21H30N2O, MWT: 326.4757, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SC-560, Alternative-names: , CAS# 188817-13-2, Formula: C17H12ClF3N2O, MWT: 352.7382, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ethoxzolamide, Alternative-names: Redupresin;L-643786;PNU-4191, CAS# 452-35-7, Formula: C9H10N2O3S2, MWT: 258.3173, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Carbonic Anhydrase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

HSF1A, Alternative-names: , CAS# 1196723-93-9, Formula: C21H19N3O2S2, MWT: 409.52446, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

AS8351, Alternative-names: , CAS# 796-42-9, Formula: C17H13N3O2, MWT: 291.304, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Pocapavir, Alternative-names: SCH-48973;V-073, CAS# 146949-21-5, Formula: C21H17Cl3O3, MWT: 423.71688, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Enterovirus, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Fisetin, Alternative-names: , CAS# 528-48-3, Formula: C15H10O6, MWT: 286.2363, Solubility: DMSO: ≥50 mg/mL , Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;Epigenetics;Cell Cycle/DNA Damage;Apoptosis;NF-κB, Target: PPAR;Sirtuin;Sirtuin;TNF-alpha;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

3-TYP, Alternative-names: , CAS# 120241-79-4, Formula: C7H6N4, MWT: 146.14934, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: Sirtuin;Sirtuin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Brequinar, Alternative-names: DUP785;Biphenquinate;BPQ, CAS# 96187-53-0, Formula: C23H15F2NO2, MWT: 375.3675064, Solubility: DMSO: ≥ 25 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

LP-533401, Alternative-names: , CAS# 945976-43-2, Formula: C27H22F4N4O3, MWT: 526.4822, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Tryptophan Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Sofosbuvir impurity A, Alternative-names: , CAS# 1496552-16-9, Formula: C22H29FN3O9P, MWT: 529.4525, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sofosbuvir impurity C, Alternative-names: , CAS# 1496552-28-3, Formula: C22H29FN3O9P, MWT: 529.4525, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sofosbuvir impurity F, Alternative-names: , CAS# 1337482-17-3, Formula: C34H45FN4O13P2, MWT: 798.686, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sofosbuvir impurity G, Alternative-names: , CAS# 1337482-15-1, Formula: C22H29FN3O9P, MWT: 529.4525, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Sofosbuvir impurity J, Alternative-names: , CAS# 1334513-10-8, Formula: C22H30FN4O8P, MWT: 528.4678, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Sofosbuvir impurity K, Alternative-names: , CAS# 1496552-51-2, Formula: C22H29ClN3O9P, MWT: 545.9071, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sofosbuvir impurity M, Alternative-names: , CAS# 2095551-10-1, Formula: C22H30N3O10P, MWT: 527.4615, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sofosbuvir impurity N, Alternative-names: , CAS# 1394157-34-6, Formula: C20H25FN3O9P, MWT: 501.3994, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Gamithromycin, Alternative-names: ML-1709460, CAS# 145435-72-9, Formula: C40H76N2O12, MWT: 777.03764, Solubility: DMSO: 160 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PF-05175157, Alternative-names: , CAS# 1301214-47-0, Formula: C23H27N5O2, MWT: 405.4928, Solubility: DMSO: 30 mg/mL, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Acetyl-CoA Carboxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Philanthotoxin 74 dihydrochloride, Alternative-names: PhTx 74 dihydrochloride, CAS# 1227301-51-0, Formula: C24H44Cl2N4O3, MWT: 507.53716, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Jujuboside A, Alternative-names: , CAS# 55466-04-1, Formula: C58H94O26, MWT: 1207.35136, Solubility: DMSO: ≥ 10 mM, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

2-Amino-6-methylheptane hydrochloride, Alternative-names: , CAS# 5984-59-8, Formula: C8H20ClN, MWT: 165.7041, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

(2R)-Octyl-α-hydroxyglutarate, Alternative-names: (2R)-Octyl-2-HG, CAS# 1391194-67-4, Formula: C13H24O5, MWT: 260.32666, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

(2S)-Octyl-α-hydroxyglutarate, Alternative-names: (2S)-Octyl-2-HG, CAS# 1391194-64-1, Formula: C13H24O5, MWT: 260.32666, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

IKK-IN-1, Alternative-names: , CAS# 406211-06-1, Formula: C22H26ClN3O4, MWT: 431.91254, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: IKK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Dichlorisone acetate, Alternative-names: , CAS# 79-61-8, Formula: C23H28Cl2O5, MWT: 455.3714, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

NBTGR, Alternative-names: , CAS# 13153-27-0, Formula: C17H18N6O6S, MWT: 434.42642, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Sultiame, Alternative-names: , CAS# 61-56-3, Formula: C10H14N2O4S2, MWT: 290.35916, Solubility: DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Carbonic Anhydrase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Dibenzoyl Thiamine, Alternative-names: Bentiamine, CAS# 299-88-7, Formula: C26H26N4O4S, MWT: 490.57404, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

L-NIL, Alternative-names: , CAS# 53774-63-3, Formula: C8H17N3O2, MWT: 187.2395, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NO Synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Perhexiline maleate, Alternative-names: , CAS# 6724-53-4, Formula: C23H39NO4, MWT: 393.56006, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Treprostinil, Alternative-names: LRX-15, CAS# 81846-19-7, Formula: C23H34O5, MWT: 390.5131, Solubility: DMSO: ≥125 mg/mL , Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Iclaprim, Alternative-names: AR-100, CAS# 192314-93-5, Formula: C19H22N4O3, MWT: 354.40298, Solubility: DMSO: 30 mg/mL, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Lecithin, Alternative-names: , CAS# 8002-43-5, Formula: C42H80NO8P, MWT: 758.060262, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Teijin compound 1, Alternative-names: , CAS# 226226-39-7, Formula: C21H21ClF3N3O2, MWT: 439.8585496, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SB-224289 hydrochloride, Alternative-names: SB-224289A, CAS# 180084-26-8, Formula: C32H33ClN4O3, MWT: 557.08242, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

2OH-BNPP1, Alternative-names: , CAS# 833481-73-5, Formula: C16H19N5O, MWT: 297.35496, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

AKR1C3-IN-1, Alternative-names: , CAS# 327092-81-9, Formula: C16H15NO4S, MWT: 317.3596, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

PD173212, Alternative-names: , CAS# 217171-01-2, Formula: C38H53N3O3, MWT: 599.84572, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

MRX-1024, Alternative-names: D-Methionine, CAS# 348-67-4, Formula: C5H11NO2S, MWT: 149.2113, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

4-Phenoxybenzylamine, Alternative-names: , CAS# 107622-80-0, Formula: C13H13NO, MWT: 199.2484, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Loureirin B, Alternative-names: , CAS# 119425-90-0, Formula: C18H20O5, MWT: 316.3484, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway;Stem Cell/Wnt;MAPK/ERK Pathway;Metabolic Enzyme/Protease;Membrane Transporter/Ion Channel, Target: JNK;ERK;ERK;PAI-1;Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Loureirin A, Alternative-names: , CAS# 119425-89-7, Formula: C17H18O4, MWT: 286.3224, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

(RS)-Carbocisteine, Alternative-names: S-(Carboxymethyl)-DL-cysteine, CAS# 25390-17-4, Formula: C5H9NO4S, MWT: 179.1943, Solubility: H<sub>2</sub>O: 6 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

L-Lysine hydrochloride, Alternative-names: , CAS# 657-27-2, Formula: C6H15ClN2O2, MWT: 182.6485, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

CA-074, Alternative-names: , CAS# 134448-10-5, Formula: C18H29N3O6, MWT: 383.43936, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cathepsin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

ND-646, Alternative-names: , CAS# 1434639-57-2, Formula: C28H32N4O7S, MWT: 568.64128, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Acetyl-CoA Carboxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Fructose 2,6-biphosphate, Alternative-names: D-Fructose 2,6-diphosphate;Fructose 2,6-bisphosphate;Fructose 2,6-diphosphate, CAS# 79082-92-1, Formula: C6H14O12P2, MWT: 340.1157, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

E3 Ligase Ligand-Linker Conjugates 19, Alternative-names: , CAS# 1799711-24-2, Formula: C19H22N4O6, MWT: 402.40118, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;PROTAC, Target: Epigenetic Reader Domain;E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 Ligase Ligand-Linker Conjugates 20, Alternative-names: , CAS# 1950635-15-0, Formula: C23H30N4O6, MWT: 458.5075, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;PROTAC, Target: Epigenetic Reader Domain;E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 Ligase Ligand-Linker Conjugates 21, Alternative-names: , CAS# 1957236-20-2, Formula: C23H30N4O9, MWT: 506.5057, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;PROTAC, Target: Epigenetic Reader Domain;E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

PSB-12379, Alternative-names: , CAS# 1802226-78-3, Formula: C18H23N5O9P2, MWT: 515.3508, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Sofalcone, Alternative-names: , CAS# 64506-49-6, Formula: C27H30O6, MWT: 450.5235, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Sodium copper chlorophyllin, Alternative-names: , CAS# 28302-36-5, Formula: C34H29CuN4Na3O7, MWT: 738.13196784, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection;Anti-infection, Target: Influenza Virus;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Secoisolariciresinol diglucoside, Alternative-names: SDG, CAS# 158932-33-3, Formula: C32H46O16, MWT: 686.69804, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Succinobucol, Alternative-names: AGI-1067;Probucol monosuccinate, CAS# 216167-82-7, Formula: C35H52O5S2, MWT: 616.91438, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

D-myo-Inositol 1,4,5-trisphosphate hexapotassium salt, Alternative-names: Ins(1,4,5)-P3 hexapotassium salt;1,4,5-IP3 hexapotassium salt, CAS# 103476-24-0, Formula: C6H9K6O15P3, MWT: 648.637746, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

γ-Oryzanol, Alternative-names: , CAS# 11042-64-1, Formula: C40H58O4, MWT: 602.88612, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: DNA Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Guacetisal, Alternative-names: , CAS# 55482-89-8, Formula: C16H14O5, MWT: 286.2794, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

β-Glycerol phosphate disodium salt pentahydrate, Alternative-names: β-Glycerophosphate disodium salt pentahydrate, CAS# 13408-09-8, Formula: C3H19Na2O11P+2, MWT: 308.1286, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PTEN, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

S-(+)-Marmesin, Alternative-names: (+)-Marmesin;(S)-Marmesin, CAS# 13849-08-6, Formula: C14H14O4, MWT: 246.2586, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Immunology/Inflammation, Target: 5-Lipoxygenase;COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

O-Phospho-L-serine, Alternative-names: L-Serine O-phosphate;L-SOP, CAS# 407-41-0, Formula: C3H8NO6P, MWT: 185.072482, Solubility: H<sub>2</sub>O: ≥ 16.66 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

RF9, Alternative-names: , CAS# 876310-60-0, Formula: C26H38N6O3, MWT: 482.61832, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Neuropeptide Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

AVex-73 hydrochloride, Alternative-names: AE-37 hydrochloride, CAS# 195615-84-0, Formula: C19H24ClNO, MWT: 317.85296, Solubility: DMSO: 37.5 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Sigma Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Insulin(human), Alternative-names: , CAS# 11061-68-0, Formula: C257H383N65O77S6, MWT: 5807.57, Solubility: Dilute hydrochloric acid, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK, Target: Insulin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Insulin(cattle), Alternative-names: Insulin from bovine pancreas, CAS# 11070-73-8, Formula: C254H377N65O75S6, MWT: 5733.49, Solubility: Dilute hydrochloric acid, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Insulin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

T-00127_HEV1, Alternative-names: , CAS# 900874-91-1, Formula: C22H29N5O3, MWT: 411.49736, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI4K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Oxiconazole nitrate, Alternative-names: Ro 13-8996, CAS# 64211-46-7, Formula: C18H14Cl4N4O4, MWT: 492.1402, Solubility: DMSO: 150 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Methylbenactyzium Bromide, Alternative-names: , CAS# 3166-62-9, Formula: C21H28BrNO3, MWT: 422.3559, Solubility: DMSO: 6 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

L-Valyl-L-phenylalanine, Alternative-names: Valylphenylalanine;H-VAL-PHE-OH, CAS# 3918-92-1, Formula: C14H20N2O3, MWT: 264.3202, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Zofenopril, Alternative-names: , CAS# 81872-10-8, Formula: C22H23NO4S2, MWT: 429.55232, Solubility: DMSO: 5 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

DL-Borneol, Alternative-names: (±)-Borneol, CAS# 507-70-0, Formula: C10H18O, MWT: 154.24932, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

GSK-LSD1 Dihydrochloride, Alternative-names: , CAS# 2102933-95-7, Formula: C14H22Cl2N2, MWT: 289.24388, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: Epigenetics;Neuronal Signaling, Target: Histone Demethylase;Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Glucoraphanin, Alternative-names: , CAS# 21414-41-5, Formula: C12H23NO10S3, MWT: 437.50672, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GSK1059865, Alternative-names: , CAS# 1191044-58-2, Formula: C20H23BrFN3O2, MWT: 436.3179232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Orexin Receptor (OX Receptor), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

QC6352, Alternative-names: , CAS# 1851373-36-8, Formula: C24H25N3O2, MWT: 387.4742, Solubility: DMSO: ≥ 25 mg/mL , Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Pumosetrag Hydrochloride, Alternative-names: MKC-733;DDP-733, CAS# 194093-42-0, Formula: C15H18ClN3O2S, MWT: 339.84032, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

SKA-121, Alternative-names: , CAS# 1820708-73-3, Formula: C12H10N2O, MWT: 198.2206, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MK-4256, Alternative-names: , CAS# 1104599-69-0, Formula: C27H23FN8O, MWT: 494.5229, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Somatostatin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sulbutiamine, Alternative-names: Bisibuthiamine, CAS# 3286-46-2, Formula: C32H46N8O6S2, MWT: 702.88764, Solubility: DMSO: ≥ 75 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Derazantinib, Alternative-names: ARQ-087, CAS# 1234356-69-4, Formula: C29H29FN4O, MWT: 468.5652, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

GW7647, Alternative-names: , CAS# 265129-71-3, Formula: C29H46N2O3S, MWT: 502.7521, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

IRAK4-IN-1, Alternative-names: , CAS# 1820787-94-7, Formula: C19H23N5O, MWT: 337.41882, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;Protein Tyrosine Kinase/RTK, Target: IRAK;IRAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

BMS-852927, Alternative-names: XL041, CAS# 1256918-39-4, Formula: C29H28Cl2F2N2O4S, MWT: 609.5114264, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: LXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Rat CGRP-(8-37), Alternative-names: VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF, CAS# 129121-73-9, Formula: C138H224N42O41, MWT: 3127.51196, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: CGRP Receptor;CGRP Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug

Sodium gualenate, Alternative-names: Guaiazulenesulfonate sodium, CAS# 6223-35-4, Formula: C15H17NaO3S, MWT: 300.34844928, Solubility: DMSO: 30 mg/mL , Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

MTX-211, Alternative-names: , CAS# 1952236-05-3, Formula: C20H14Cl2FN5O2S, MWT: 478.3268632, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: PI3K;EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Squalamine lactate, Alternative-names: MSI-1256F, CAS# 320725-47-1, Formula: C37H71N3O8S, MWT: 718.03994, Solubility: DMSO: ≥ 36.66 mg/mL, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

MSI-1436 lactate, Alternative-names: Trodusquemine lactate;Aminosterol-1436 lactate, CAS# 1309370-86-2, Formula: C37H72N4O5S . 7/2C3H6O3, MWT: 1000.165, Solubility: DMSO: 54 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MSI-1701, Alternative-names: , CAS# 390808-64-7, Formula: C37H72N4O5S, MWT: 685.05638, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

IMD-0560, Alternative-names: , CAS# 439144-66-8, Formula: C15H8BrF6NO2, MWT: 428.1239392, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: IKK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GSK369796 Dihydrochloride, Alternative-names: , CAS# 1010411-21-8, Formula: C20H24Cl3N3O, MWT: 428.78306, Solubility: DMSO: 75 mg/mL (Need ultrasonic), Clinical_Information: Phase 1, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

EIPA, Alternative-names: L593754;MH 12-43;Ethylisopropylamiloride, CAS# 1154-25-2, Formula: C11H18ClN7O, MWT: 299.75992, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Membrane Transporter/Ion Channel, Target: TRP Channel;Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Tolimidone, Alternative-names: MLR-1023, CAS# 41964-07-2, Formula: C11H10N2O2, MWT: 202.2093, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

(-)-(S)-Equol, Alternative-names: , CAS# 531-95-3, Formula: C15H14O3, MWT: 242.2699, Solubility: DMSO: 100 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

TPPB, Alternative-names: , CAS# 497259-23-1, Formula: C27H30F3N3O3, MWT: 501.5406, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Pyrotinib, Alternative-names: SHR-1258, CAS# 1269662-73-8, Formula: C32H31ClN6O3, MWT: 583.07994, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

ICA, Alternative-names: N-[4-(2-Pyridinyl)-2-thiazolyl]-2-pyridinamine, CAS# 3374-88-7, Formula: C13H10N4S, MWT: 254.3103, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Trilaciclib hydrochloride, Alternative-names: G1T28 hydrochloride, CAS# 1977495-97-8, Formula: C24H32Cl2N8O, MWT: 519.46988, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Fmoc-1,6-diaminohexane, Alternative-names: , CAS# 166410-37-3, Formula: C21H26N2O2, MWT: 338.44334, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

RO5028442, Alternative-names: , CAS# 920022-47-5, Formula: C25H28ClN3O2, MWT: 437.9617, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Vasopressin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

ML349, Alternative-names: , CAS# 890819-86-0, Formula: C23H22N2O4S2, MWT: 454.5618, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Sparsentan, Alternative-names: RE-021;BMS-346567;PS433540;DARA-a, CAS# 254740-64-2, Formula: C32H40N4O5S, MWT: 592.7488, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein;GPCR/G Protein, Target: Endothelin Receptor;Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

L-Glutathione reduced, Alternative-names: GSH;γ-L-Glutamyl-L-cysteinyl-glycine, CAS# 70-18-8, Formula: C10H17N3O6S, MWT: 307.3235, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Sarsasapogenin, Alternative-names: Parigenin;Sarsagenin, CAS# 126-19-2, Formula: C27H44O3, MWT: 416.6365, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Fezolinetant, Alternative-names: ESN-364, CAS# 1629229-37-3, Formula: C16H15FN6OS, MWT: 358.3933, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

6-Aminochrysene, Alternative-names: 6-Chrysenamine, CAS# 2642-98-0, Formula: C18H13N, MWT: 243.30252, Solubility: DMSO: ≥62.5 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Pimavanserin tartrate, Alternative-names: ACP-103 tartrate, CAS# 706782-28-7, Formula: C54H74F2N6O10, MWT: 1005.196, Solubility: DMSO: ≥75 mg/mL , Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

LY2955303, Alternative-names: , CAS# 1433497-19-8, Formula: C36H42N4O3, MWT: 578.74368, Solubility: DMSO: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CaCCinh-A01, Alternative-names: , CAS# 407587-33-1, Formula: C18H21NO4S, MWT: 347.4286, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Chloride Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Fluensulfone, Alternative-names: MCW-2, CAS# 318290-98-1, Formula: C7H5ClF3NO2S2, MWT: 291.6983096, Solubility: 10 mM in DMSO , Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

L-Canavanine sulfate, Alternative-names: , CAS# 2219-31-0, Formula: C5H14N4O7S, MWT: 274.2523, Solubility: H<sub>2</sub>O: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NO Synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

(Z)-Thiothixene, Alternative-names: , CAS# 3313-26-6, Formula: C23H29N3O2S2, MWT: 443.62526, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

UCPH-101, Alternative-names: , CAS# 1118460-77-7, Formula: C27H22N2O3, MWT: 422.47518, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Prinomastat, Alternative-names: AG3340;KB-R9896, CAS# 192329-42-3, Formula: C18H21N3O5S2, MWT: 423.50644, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Dicoumarol, Alternative-names: Dicumarol, CAS# 66-76-2, Formula: C19H12O6, MWT: 336.29498, Solubility: DMSO: 6.4 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PDK-1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Acefylline, Alternative-names: Theophyllineacetic acid;Theophylline-7-acetic acid, CAS# 652-37-9, Formula: C9H10N4O4, MWT: 238.2001, Solubility: DMSO: 17 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

LDN-192960, Alternative-names: , CAS# 184582-62-5, Formula: C18H20N2O2S, MWT: 328.4286, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Haspin Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Salicylanilide, Alternative-names: 2-Hydroxybenzanilide, CAS# 87-17-2, Formula: C13H11NO2, MWT: 213.2319, Solubility: DMSO: 170 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HIV Integrase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

ABL127, Alternative-names: , CAS# 1073529-41-5, Formula: C17H20N2O5, MWT: 332.3511, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ML218, Alternative-names: , CAS# 1346233-68-8, Formula: C19H26Cl2N2O, MWT: 369.32854, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

PF-3893787 hydrochloride, Alternative-names: , CAS# 2096455-90-0, Formula: C13H25Cl3N6, MWT: 371.7368, Solubility: DMSO: ≥ 83.33 mg/mL, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Gastrodin, Alternative-names: Gastrodine, CAS# 62499-27-8, Formula: C13H18O7, MWT: 286.2778, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Sulfachloropyridazine, Alternative-names: Sulfachlorpyridazine, CAS# 80-32-0, Formula: C10H9ClN4O2S, MWT: 284.722, Solubility: DMSO: 160 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg

Penicillin G sodium salt, Alternative-names: Benzylpenicillin sodium salt, CAS# 69-57-8, Formula: C16H17N2NaO4S, MWT: 356.37194928, Solubility: DMSO: 100 mg/mL, Clinical_Information: Phase 4, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Theobromine, Alternative-names: 3,7-Dimethylxanthine, CAS# 83-67-0, Formula: C7H8N4O2, MWT: 180.164, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Paroxypropione, Alternative-names: 4'-Hydroxypropiophenone, CAS# 70-70-2, Formula: C9H10O2, MWT: 150.1745, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Chloropyramine hydrochloride, Alternative-names: , CAS# 6170-42-9, Formula: C16H21Cl2N3, MWT: 326.264, Solubility: DMSO: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: Histamine Receptor;Histamine Receptor;VEGFR;FAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Oxaprozin, Alternative-names: Oxaprozinum;Wy21743, CAS# 21256-18-8, Formula: C18H15NO3, MWT: 293.3166, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation;NF-κB, Target: COX;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Ethosuximide, Alternative-names: , CAS# 77-67-8, Formula: C7H11NO2, MWT: 141.1677, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Cyclic-di-GMP, Alternative-names: c-di-GMP;cyclic diguanylate;5GP-5GP, CAS# 61093-23-0, Formula: C20H24N10O14P2, MWT: 690.410684, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: STING, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Epristeride, Alternative-names: ONO-9302;SKF105657, CAS# 119169-78-7, Formula: C25H37NO3, MWT: 399.56618, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: 5 alpha Reductase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

MLE-4901, Alternative-names: AZD4901;AZ12472520;AZD2624, CAS# 941690-55-7, Formula: C26H25N3O3S, MWT: 459.56, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Juglanin, Alternative-names: , CAS# 5041-67-8, Formula: C20H18O10, MWT: 418.35092, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: JNK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

(S)-GNE-140, Alternative-names: , CAS# 2003234-64-6, Formula: C25H23ClN2O3S2, MWT: 499.04472, Solubility: DMSO: 14 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Lactate Dehydrogenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

SAR-20347, Alternative-names: , CAS# 1450881-55-6, Formula: C21H18ClFN4O4, MWT: 444.8434232, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

MD2-IN-1, Alternative-names: , CAS# 111797-22-9, Formula: C20H22O6, MWT: 358.38508, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Toll-like Receptor (TLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

2-HBA, Alternative-names: , CAS# 131359-24-5, Formula: C17H14O3, MWT: 266.29126, Solubility: DMSO: 107 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Caspase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

2-Aminobenzenesulfonamide, Alternative-names: Orthanilamide, CAS# 3306-62-5, Formula: C6H8N2O2S, MWT: 172.2049, Solubility: DMSO: 160 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Carbonic Anhydrase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

DiBAC4(3), Alternative-names: , CAS# 70363-83-6, Formula: C27H40N4O6, MWT: 516.6297, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Dihydrorhodamine 123, Alternative-names: DHR 123, CAS# 109244-58-8, Formula: C21H18N2O3, MWT: 346.37922, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Fluorescein di(β-D-galactopyranoside), Alternative-names: FDG, CAS# 17817-20-8, Formula: C32H32O15, MWT: 656.58748, Solubility: DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Fluo-4 AM, Alternative-names: , CAS# 273221-67-3, Formula: C51H50F2N2O23, MWT: 1096.9391064, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100ug

Fura-2 AM, Alternative-names: Fura-2 Acetoxymethyl ester, CAS# 108964-32-5, Formula: C44H47N3O24, MWT: 1001.84968, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Indo-1 AM, Alternative-names: Indo-1 Acetoxymethyl ester, CAS# 112926-02-0, Formula: C47H51N3O22, MWT: 1009.91474, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Monochlorobimane, Alternative-names: Chlorobimane, CAS# 76421-73-3, Formula: C10H11ClN2O2, MWT: 226.65954, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

4-Methylumbelliferyl-β-D-glucuronide hydrate, Alternative-names: MUG, CAS# 881005-91-0, Formula: C16H18O10, MWT: 370.30812, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

NBD-F, Alternative-names: 4-Fluoro-7-nitrobenzofurazan, CAS# 29270-56-2, Formula: C6H2FN3O3, MWT: 183.0968, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Oxazine 1 perchlorate, Alternative-names: , CAS# 24796-94-9, Formula: C20H26ClN3O5, MWT: 423.89054, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Phalloidin, Alternative-names: , CAS# 17466-45-4, Formula: C35H48N8O11S, MWT: 788.8676, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Statine, Alternative-names: (3S,4S)-Statine;(S,S)-Statine, CAS# 49642-07-1, Formula: C8H17NO3, MWT: 175.22548, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Sulforhodamine 101, Alternative-names: SR101, CAS# 60311-02-6, Formula: C31H30N2O7S2, MWT: 606.7091, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

PF-06260933, Alternative-names: , CAS# 1811510-56-1, Formula: C16H13ClN4, MWT: 296.7542, Solubility: DMSO: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

AX-024 hydrochloride, Alternative-names: , CAS# 1704801-24-0, Formula: C21H23ClFNO2, MWT: 375.8642232, Solubility: DMSO: 33 mg/mL, Clinical_Information: Phase 1, Pathway: Immunology/Inflammation;Immunology/Inflammation;Apoptosis, Target: Interleukin Related;IFNAR;TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Nikethamide, Alternative-names: N,N-Diethylnicotinamide, CAS# 59-26-7, Formula: C10H14N2O, MWT: 178.231, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

7-Aminoactinomycin D, Alternative-names: 7-AAD, CAS# 7240-37-1, Formula: C62H87N13O16, MWT: 1270.43168, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

AA-dUTP sodium salt, Alternative-names: Aminoallyl-dUTP sodium salt, CAS# 936327-10-5, Formula: C12H20N3NaO14P3+, MWT: 546.2094067, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

5-BrdUTP sodium salt, Alternative-names: 5-Bromo-2'-deoxyuridine 5'-triphosphate sodium salt, CAS# 102212-99-7, Formula: C9H14BrN2Na4O14P3 4+, MWT: 638.9946288, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

5-BrUTP sodium salt, Alternative-names: 5-Bromouridine 5'-triphosphate sodium salt, CAS# 161848-60-8, Formula: C9H14BrN2NaO15P3+, MWT: 586.0263667, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Bendazol, Alternative-names: , CAS# 621-72-7, Formula: C14H12N2, MWT: 208.2585, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: NO Synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

TDCPP, Alternative-names: Tris(1,3-dichloroisopropyl)phosphate, CAS# 13674-87-8, Formula: C9H15Cl6O4P, MWT: 430.904762, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Oxiracetam, Alternative-names: ISF2522, CAS# 62613-82-5, Formula: C6H10N2O3, MWT: 158.1552, Solubility: DMSO: 10 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

L-Tyrosine, Alternative-names: , CAS# 60-18-4, Formula: C9H11NO3, MWT: 181.1885, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Piribedil, Alternative-names: , CAS# 3605-01-4, Formula: C16H18N4O2, MWT: 298.3397, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Myclobutanil, Alternative-names: , CAS# 88671-89-0, Formula: C15H17ClN4, MWT: 288.7753, Solubility: DMSO: 103 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Clorprenaline hydrochloride, Alternative-names: , CAS# 6933-90-0, Formula: C11H17Cl2NO, MWT: 250.16478, Solubility: DMSO: 100 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Hydroxychloroquine sulfate, Alternative-names: HCQ sulfate, CAS# 747-36-4, Formula: C18H28ClN3O5S, MWT: 433.95002, Solubility: H<sub>2</sub>O: 110 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;Anti-infection, Target: Toll-like Receptor (TLR);Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Carbinoxamine maleate salt, Alternative-names: , CAS# 3505-38-2, Formula: C20H23ClN2O5, MWT: 406.86, Solubility: H<sub>2</sub>O: 160 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Doxofylline, Alternative-names: , CAS# 69975-86-6, Formula: C11H14N4O4, MWT: 266.2533, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;GPCR/G Protein, Target: Phosphodiesterase (PDE);Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ertapenem sodium, Alternative-names: L-749345;MK-826, CAS# 153773-82-1, Formula: C22H24N3NaO7S, MWT: 497.49662928, Solubility: H<sub>2</sub>O: 50 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Chlorazanil, Alternative-names: , CAS# 500-42-5, Formula: C9H8ClN5, MWT: 221.6463, Solubility: DMSO: 110 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

BI 689648, Alternative-names: , CAS# 1633009-87-6, Formula: C16H18N4O2, MWT: 298.33972, Solubility: DMSO: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Xanthotoxol, Alternative-names: , CAS# 2009-24-7, Formula: C11H6O4, MWT: 202.16294, Solubility: DMSO: 123 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Timonacic, Alternative-names: 1,3-Thiazolidine-4-carboxylic acid, CAS# 444-27-9, Formula: C4H7NO2S, MWT: 133.1689, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Carbasalate calcium, Alternative-names: , CAS# 5749-67-7, Formula: C9H7O4 .CH4N2O .1/2Ca, MWT: 259.24374, Solubility: H<sub>2</sub>O: 103 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Felbinac, Alternative-names: 4-Biphenylacetic acid, CAS# 5728-52-9, Formula: C14H12O2, MWT: 212.2439, Solubility: DMSO: 100 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Salicin, Alternative-names: D-(−)-Salicin;Salicoside, CAS# 138-52-3, Formula: C13H18O7, MWT: 286.2778, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Ethopabate, Alternative-names: Ethyl pabate, CAS# 59-06-3, Formula: C12H15NO4, MWT: 237.2518, Solubility: DMSO: 106 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Proglumide, Alternative-names: , CAS# 6620-60-6, Formula: C18H26N2O4, MWT: 334.41, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Cholecystokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Carbendazim, Alternative-names: , CAS# 10605-21-7, Formula: C9H9N3O2, MWT: 191.1867, Solubility: DMSO: 6.8 mg/mL (Need ultrasonic), Clinical_Information: Phase 1, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Bendazac L-Lysine, Alternative-names: , CAS# 81919-14-4, Formula: C22H28N4O5, MWT: 428.48152, Solubility: H<sub>2</sub>O: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AG126, Alternative-names: Tyrphostin AG126, CAS# 118409-62-4, Formula: C10H5N3O3, MWT: 215.165, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Vorasidenib, Alternative-names: AG-881, CAS# 1644545-52-7, Formula: C14H13ClF6N6, MWT: 414.7366392, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: Isocitrate Dehydrogenase (IDH), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Desidustat, Alternative-names: , CAS# 1616690-16-4, Formula: C16H16N2O6, MWT: 332.30804, Solubility: DMSO: ≥30 mg/mL , Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Trolox, Alternative-names: , CAS# 53188-07-1, Formula: C14H18O4, MWT: 250.29032, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

HAE, Alternative-names: , CAS# 64111-99-5, Formula: C14H21N5O6, MWT: 355.34644, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Cynaropicrin, Alternative-names: , CAS# 35730-78-0, Formula: C19H22O6, MWT: 346.37438, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Apoptosis;NF-κB, Target: MMP;TNF-alpha;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ribocil B, Alternative-names: Ribocil S enantiomer;ent-Ribocil A, CAS# 1825355-55-2, Formula: C19H22N6OS, MWT: 382.4826, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AZD1208 hydrochloride, Alternative-names: , CAS# 1621866-96-3, Formula: C21H22ClN3O2S, MWT: 415.93628, Solubility: DMSO: 83.3 mg/mL, Clinical_Information: Phase 1, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Esaxerenone, Alternative-names: CS-3150;XL-550, CAS# 1632006-28-0, Formula: C22H21F3N2O4S, MWT: 466.4733496, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Mineralocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

3-Methoxytyramine hydrochloride, Alternative-names: 3-O-methyl Dopamine hydrochloride, CAS# 1477-68-5, Formula: C9H14ClNO2, MWT: 203.66596, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Deoxycholic acid sodium salt, Alternative-names: Sodium deoxycholate, CAS# 302-95-4, Formula: C24H39NaO4, MWT: 414.5538, Solubility: DMSO: 6 mg/mL(Need ultrasonic), Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: GPCR19, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Larazotide acetate, Alternative-names: AT-1001, CAS# 881851-50-9, Formula: C34H59N9O12, MWT: 785.88536, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

LOXL2-IN-1 hydrochloride, Alternative-names: , CAS# 916210-98-5, Formula: C6H8Cl2N2, MWT: 179.04712, Solubility: DMSO: ≥33 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

RK-24466, Alternative-names: KIN 001-51, CAS# 213743-31-8, Formula: C23H22N4O, MWT: 370.44698, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Stem Cell/Wnt;MAPK/ERK Pathway;PI3K/Akt/mTOR, Target: Src;ERK;ERK;Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

AX-024, Alternative-names: , CAS# 1370544-73-2, Formula: C21H22FNO2, MWT: 339.4032832, Solubility: DMSO: 35 mg/mL, Clinical_Information: Phase 1, Pathway: Immunology/Inflammation;Immunology/Inflammation;Apoptosis, Target: Interleukin Related;IFNAR;TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Asimadoline, Alternative-names: EMD-61753, CAS# 153205-46-0, Formula: C27H30N2O2, MWT: 414.5393, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

EED inhibitor-1, Alternative-names: , CAS# 1951408-58-4, Formula: C20H17FN6O, MWT: 376.3869832, Solubility: DMSO: ≥30 mg/mL , Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

VI 16832, Alternative-names: , CAS# 1430218-51-1, Formula: C22H25N5O2, MWT: 391.4662, Solubility: DMSO: 83.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Tradipitant, Alternative-names: VLY-686;LY686017, CAS# 622370-35-8, Formula: C28H16ClF6N5O, MWT: 587.903, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

CY-09, Alternative-names: , CAS# 1073612-91-5, Formula: C19H12F3NO3S2, MWT: 423.4286896, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NOD-like Receptor (NLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

NIM811, Alternative-names: SDZ NIM811, CAS# 143205-42-9, Formula: C62H111N11O12, MWT: 1202.611, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others;Anti-infection, Target: Others;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Vps34-IN-2, Alternative-names: , CAS# 1523404-29-6, Formula: C18H25F3N4O3, MWT: 402.4113, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

CB-1158, Alternative-names: INCB01158, CAS# 2095732-06-0, Formula: C11H22BN3O5, MWT: 287.12048, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

cFMS-IN-2, Alternative-names: , CAS# 791587-67-2, Formula: C19H21N3O3, MWT: 339.3883, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Fms, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

(+)-SJ733, Alternative-names: SJ000557733, CAS# 1424799-20-1, Formula: C24H16F4N4O2, MWT: 468.403, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Membrane Transporter/Ion Channel;Anti-infection, Target: Na+/K+ ATPase;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

3α-Aminocholestane, Alternative-names: , CAS# 2206-20-4, Formula: C27H49N, MWT: 387.6847, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Visomitin, Alternative-names: SKQ1, CAS# 934826-68-3, Formula: C36H42BrO2P, MWT: 617.5952, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Edonerpic maleate, Alternative-names: T-817 maleate;T-817MA, CAS# 519187-97-4, Formula: C20H25NO6S, MWT: 407.4806, Solubility: DMSO: 155 mg/mL, Clinical_Information: Phase 2, Pathway: Neuronal Signaling, Target: Amyloid-β, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

BQR-695, Alternative-names: NVP-BQR695, CAS# 1513879-21-4, Formula: C19H20N4O3, MWT: 352.3871, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI4K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PF-06409577, Alternative-names: , CAS# 1467057-23-3, Formula: C19H16ClNO3, MWT: 341.78824, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: Phase 1, Pathway: Epigenetics;PI3K/Akt/mTOR, Target: AMPK;AMPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

PF-06726304, Alternative-names: , CAS# 1616287-82-1, Formula: C22H21Cl2N3O3, MWT: 446.32644, Solubility: DMSO: ≥15 mg/mL , Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Benactyzine hydrochloride, Alternative-names: , CAS# 57-37-4, Formula: C20H26ClNO3, MWT: 363.8783, Solubility: DMSO: 150 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: AChE, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Coelenterazine h, Alternative-names: 2-Deoxycoelenterazine;CLZN-h, CAS# 50909-86-9, Formula: C26H21N3O2, MWT: 407.46384, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50ug

C-Phycocyanin, Alternative-names: C-PC, CAS# 11016-15-2, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

CUG, Alternative-names: 3-Carboxyumbelliferyl-β-D-galactopyranoside, CAS# 64664-99-9, Formula: C16H16O10, MWT: 368.29224, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CAY10566, Alternative-names: , CAS# 944808-88-2, Formula: C18H17ClFN5O2, MWT: 389.8113, Solubility: DMSO: 8 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Stearoyl-CoA Desaturase (SCD), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Dansylcadaverine, Alternative-names: Monodansyl cadaverine, CAS# 10121-91-2, Formula: C17H25N3O2S, MWT: 335.4643, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

3,3'-Dihexyloxacarbocyanine iodide, Alternative-names: DiOC6(3) iodide, CAS# 53213-82-4, Formula: C29H37IN2O2, MWT: 572.5208, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

DiD perchlorate, Alternative-names: , CAS# 127274-91-3, Formula: C61H99ClN2O4, MWT: 959.90276, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Fluorescein Biotin, Alternative-names: , CAS# 134759-22-1, Formula: C42H50N6O8S2, MWT: 831.0118, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

IDH-305, Alternative-names: , CAS# 1628805-46-8, Formula: C23H22F4N6O2, MWT: 490.4533928, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Isocitrate Dehydrogenase (IDH), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Hydroxystilbamidine bis(methanesulfonate), Alternative-names: , CAS# 223769-64-0, Formula: C18H24N4O7S2, MWT: 472.53576, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

LDS-751, Alternative-names: , CAS# 181885-68-7, Formula: C25H30ClN3O4, MWT: 471.9764, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

MCLA hydrochloride, Alternative-names: , CAS# 128322-44-1, Formula: C14H14ClN3O2, MWT: 291.73286, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MESG, Alternative-names: 7-methyl-6-Thioguanosine, CAS# 55727-10-1, Formula: C11H15N5O4S, MWT: 313.3329, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

4-Methylumbelliferyl phosphate, Alternative-names: 4-MUP;MUP, CAS# 3368-04-5, Formula: C10H9O6P, MWT: 256.148622, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Acridine Orange 10-Nonyl Bromide, Alternative-names: Nonylacridine orange, CAS# 75168-11-5, Formula: C26H38BrN3, MWT: 472.50402, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Senktide, Alternative-names: , CAS# 106128-89-6, Formula: C40H55N7O11S, MWT: 841.97, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Rotundine, Alternative-names: (-)-Tetrahydropalmatine;L-Tetrahydropalmatine, CAS# 483-14-7, Formula: C21H25NO4, MWT: 355.4275, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Amenamevir, Alternative-names: ASP2151, CAS# 841301-32-4, Formula: C24H26N4O5S, MWT: 482.552, Solubility: DMSO: 160 mg/mL, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: HSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PKM2-IN-1, Alternative-names: , CAS# 94164-88-2, Formula: C18H19NO2S2, MWT: 345.47896, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Pyruvate Dehydrogenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Daurisoline, Alternative-names: (R,R)-Daurisoline, CAS# 70553-76-3, Formula: C37H42N2O6, MWT: 610.7392, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;Membrane Transporter/Ion Channel, Target: Autophagy;Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Solifenacin, Alternative-names: YM905, CAS# 242478-37-1, Formula: C23H26N2O2, MWT: 362.4648, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Trigonelline chloride, Alternative-names: Trigonelline hydrochloride, CAS# 6138-41-6, Formula: C7H8ClNO2, MWT: 173.59692, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Glecaprevir, Alternative-names: ABT-493, CAS# 1365970-03-1, Formula: C38H46F4N6O9S, MWT: 838.8652, Solubility: DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Verucerfont, Alternative-names: GSK561679, CAS# 885220-61-1, Formula: C22H26N6O2, MWT: 406.4808, Solubility: DMSO: 86.7 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Rhod-2 AM, Alternative-names: , CAS# 129787-64-0, Formula: C51H57BrN4O19, MWT: 1109.91768, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Rhodamine 800, Alternative-names: , CAS# 137993-41-0, Formula: C26H26ClN3O5, MWT: 495.95474, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Stains-All, Alternative-names: , CAS# 7423-31-6, Formula: C30H27BrN2S2, MWT: 559.58278, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

TMA-DPH, Alternative-names: , CAS# 115534-33-3, Formula: C28H32NO3S+, MWT: 462.62303142, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

TMRE, Alternative-names: Tetramethylrhodamine ethyl ester perchlorate, CAS# 115532-52-0, Formula: C26H27ClN2O7, MWT: 514.95478, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

HCGRP-(8-37), Alternative-names: Human α-CGRP (8-37), CAS# 119911-68-1, Formula: C139H230N44O38, MWT: 3125.5855, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: CGRP Receptor;CGRP Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

TNP-470, Alternative-names: AGM-1470, CAS# 129298-91-5, Formula: C19H28ClNO6, MWT: 401.88172, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CR4056, Alternative-names: , CAS# 1004997-71-0, Formula: C17H12N4, MWT: 272.304, Solubility: DMSO: 30 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling, Target: Imidazoline Receptor;Imidazoline Receptor;Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

(+)-Talarozole, Alternative-names: , CAS# 201410-66-4, Formula: C21H23N5S, MWT: 377.50582, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

(-)-Talarozole, Alternative-names: , CAS# 201410-67-5, Formula: C21H23N5S, MWT: 377.50582, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Taranabant racemate, Alternative-names: MK-0364 racemate, CAS# 701977-00-6, Formula: C27H25ClF3N3O2, MWT: 515.9545, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Fursultiamine, Alternative-names: , CAS# 804-30-8, Formula: C17H26N4O3S2, MWT: 398.5433, Solubility: DMSO: 106.7 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

CDN1163, Alternative-names: , CAS# 892711-75-0, Formula: C20H20N2O2, MWT: 320.385, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Fructose, Alternative-names: , CAS# 7660-25-5, Formula: C6H12O6, MWT: 180.1559, Solubility: H<sub>2</sub>O: 6.8 mg/mL, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

BPTU, Alternative-names: BMS-646786, CAS# 870544-59-5, Formula: C23H22F3N3O3, MWT: 445.4343, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: P2Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Targocil, Alternative-names: , CAS# 1200443-21-5, Formula: C21H22ClN5O4S, MWT: 475.9485, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ML335, Alternative-names: , CAS# 825658-06-8, Formula: C15H14Cl2N2O3S, MWT: 373.25426, Solubility: DMSO: 155 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

MRX-2843, Alternative-names: UNC2371, CAS# 1429882-07-4, Formula: C29H40N6O, MWT: 488.6675, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: FLT3, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

TMRM, Alternative-names: , CAS# 115532-49-5, Formula: C25H25N2O3+, MWT: 401.47705142, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Trypan red, Alternative-names: C.I. 22850, CAS# 574-64-1, Formula: C32H19N6Na5O15S5, MWT: 1002.7983064, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Zinquin, Alternative-names: , CAS# 151606-29-0, Formula: C19H18N2O5S, MWT: 386.42162, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Xylan, Alternative-names: , CAS# 9014-63-5, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

H-Lys-Trp-Lys-OH, Alternative-names: , CAS# 38579-27-0, Formula: C23H36N6O4, MWT: 460.56974, Solubility: H<sub>2</sub>O: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Takinib, Alternative-names: , CAS# 1111556-37-6, Formula: C18H18N4O2, MWT: 322.36112, Solubility: DMSO: 6.8 mg/mlL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: TAK1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

JQEZ5, Alternative-names: , CAS# 1913252-04-6, Formula: C30H38N8O2, MWT: 542.67512, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Iopanoic acid, Alternative-names: , CAS# 96-83-3, Formula: C11H12I3NO2, MWT: 570.9319, Solubility: DMSO: 113.3 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

BAY 73-6691 racemate, Alternative-names: , CAS# 794568-90-4, Formula: C15H12ClF3N4O, MWT: 356.7301896, Solubility: DMSO: 160 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Rogaratinib, Alternative-names: BAY1163877, CAS# 1443530-05-9, Formula: C23H26N6O3S, MWT: 466.5559, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sucralose, Alternative-names: E955;Trichlorosucrose, CAS# 56038-13-2, Formula: C12H19Cl3O8, MWT: 397.63346, Solubility: H<sub>2</sub>O: 53.3 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

NECA, Alternative-names: 5'-N-Ethylcarboxamidoadenosine, CAS# 35920-39-9, Formula: C12H16N6O4, MWT: 308.29324, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Tacrine hydrochloride hydrate, Alternative-names: , CAS# 206658-92-6, Formula: C13H17ClN2O, MWT: 252.73988, Solubility: DMSO: 32 mg/mL, Clinical_Information: Phase 4, Pathway: Neuronal Signaling, Target: AChE, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

BDP5290, Alternative-names: , CAS# 1817698-21-7, Formula: C17H18ClN7O, MWT: 371.8241, Solubility: DMSO: 12.5 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ciprofloxacin hydrochloride, Alternative-names: , CAS# 93107-08-5, Formula: C17H19ClFN3O3, MWT: 367.8025, Solubility: H<sub>2</sub>O: 12.5 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Erythrosin B, Alternative-names: Erythrosin extra bluish, CAS# 16423-68-0, Formula: C20H6I4Na2O5, MWT: 879.8561, Solubility: H<sub>2</sub>O: 20.7 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

6-Mercaptopurine hydrate, Alternative-names: , CAS# 6112-76-1, Formula: C5H6N4OS, MWT: 170.1923, Solubility: DMSO: 32 mg/mL, Clinical_Information: Phase 4, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Glutathione oxidized, Alternative-names: L-Glutathione oxidized;GSSG, CAS# 27025-41-8, Formula: C20H32N6O12S2, MWT: 612.6311, Solubility: DMSO: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

1A-116, Alternative-names: , CAS# 1430208-73-3, Formula: C16H16F3N3, MWT: 307.3135496, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Ras, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Vitamin CK3, Alternative-names: , CAS# 1085703-32-7, Formula: C17H18Na2O11S+2, MWT: 476.3617, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Abiraterone metabolite 1, Alternative-names: 3β-OH-5α-Abi, CAS# 1940176-03-3, Formula: C24H33NO, MWT: 351.52492, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

RIG-1 modulator 1, Alternative-names: , CAS# 1428729-63-8, Formula: C14H17N5OS2, MWT: 335.44768, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection;Anti-infection;Anti-infection;Anti-infection, Target: HBV;Influenza Virus;HIV;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AZ7550, Alternative-names: , CAS# 1421373-99-0, Formula: C27H31N7O2, MWT: 485.5807, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK, Target: IGF-1R, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Eucalyptol, Alternative-names: 1,8-Cineole, CAS# 470-82-6, Formula: C10H18O, MWT: 154.2493, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Immunology/Inflammation;Neuronal Signaling;GPCR/G Protein;Membrane Transporter/Ion Channel;Apoptosis, Target: Interleukin Related;5-HT Receptor;5-HT Receptor;Potassium Channel;TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Coumarin, Alternative-names: , CAS# 91-64-5, Formula: C9H6O2, MWT: 146.1427, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

p-Coumaric acid, Alternative-names: trans-4-Hydroxycinnamic acid, CAS# 501-98-4, Formula: C9H8O3, MWT: 164.158, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

18α-Glycyrrhetinic acid, Alternative-names: , CAS# 1449-05-4, Formula: C30H46O4, MWT: 470.68384, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;NF-κB, Target: Proteasome;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Artesunate, Alternative-names: , CAS# 88495-63-0, Formula: C19H28O8, MWT: 384.4208, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Phenolphthalein, Alternative-names: , CAS# 77-09-8, Formula: C20H14O4, MWT: 318.3228, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Tropifexor, Alternative-names: , CAS# 1383816-29-2, Formula: C29H25F4N3O5S, MWT: 603.5845128, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: FXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Trofinetide, Alternative-names: NNZ-2566, CAS# 853400-76-7, Formula: C13H21N3O6, MWT: 315.3223, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

COTI-2, Alternative-names: , CAS# 1039455-84-9, Formula: C19H22N6S, MWT: 366.4832, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Emeramide, Alternative-names: BDTH2, CAS# 351994-94-0, Formula: C12H16N2O2S2, MWT: 284.3976, Solubility: DMSO: 100 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Aminooxyacetic acid hemihydrochloride, Alternative-names: Carboxymethoxylamine Hemihydrochloride, CAS# 2921-14-4, Formula: NH2OCH2COOH · 0.5HCl , MWT: 109.3, Solubility: DMSO: 42.9 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Adenosine 5'-monophosphate monohydrate, Alternative-names: 5'-AMP monohydrate, CAS# 18422-05-4, Formula: C10H16N5O8P, MWT: 365.236502, Solubility: H<sub>2</sub>O: 6.4 mg/mL (Need ultrasonic), Clinical_Information: Phase 4, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

SB-399885 hydrochloride, Alternative-names: , CAS# 402713-81-9, Formula: C18H22Cl3N3O4S, MWT: 482.80898, Solubility: DMSO: 125 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

(+)-α-Tocopherol, Alternative-names: D-α-Tocopherol;α-Vitamin E, CAS# 59-02-9, Formula: C29H50O2, MWT: 430.7061, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Amiloride hydrochloride dihydrate, Alternative-names: MK-870 hydrochloride dihydrate, CAS# 17440-83-4, Formula: C6H13Cl2N7O3, MWT: 302.11852, Solubility: DMSO: 100 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

α-L-Rhamnose monohydrate, Alternative-names: , CAS# 6155-35-7, Formula: C6H14O6, MWT: 182.17176, Solubility: H<sub>2</sub>O: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Thiamine hydrochloride, Alternative-names: Vitamin B1 hydrochloride;Thiamine chloride hydrochloride, CAS# 67-03-8, Formula: C12H18Cl2N4OS, MWT: 337.2685, Solubility: DMSO: 10 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Sulfalene, Alternative-names: Sulfametopyrazine;AS-18908, CAS# 152-47-6, Formula: C11H12N4O3S, MWT: 280.303, Solubility: DMSO: 100 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Spiramycin, Alternative-names: Formacidine, CAS# 8025-81-8, Formula: C43H74N2O14, MWT: 843.05266, Solubility: DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Fucoxanthin, Alternative-names: all-trans-Fucoxanthin, CAS# 3351-86-8, Formula: C42H58O6, MWT: 658.9063, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GC7 Sulfate, Alternative-names: , CAS# 150417-90-6, Formula: C8H22N4O4S, MWT: 270.34968, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Fulvestrant S enantiomer, Alternative-names: ICI 182780 S enantiomer;ZD 182780 S enantiomer;ZD 9238 S enantiomer;ZM 182780 S enantiomer, CAS# 1316849-17-8, Formula: C32H47F5O3S, MWT: 606.770796, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Tebuconazole, Alternative-names: , CAS# 107534-96-3, Formula: C16H22ClN3O, MWT: 307.8184, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection;Metabolic Enzyme/Protease, Target: Fungal;Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

HJC0152 hydrochloride, Alternative-names: , CAS# 1420290-99-8, Formula: C15H14Cl3N3O4, MWT: 406.64836, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Fulvestrant R enantiomer, Alternative-names: ICI 182780 R enantiomer;ZD 182780 R enantiomer;ZD 9238 R enantiomer;ZM 182780 R enantiomer, CAS# 1807900-80-6, Formula: C32H47F5O3S, MWT: 606.770796, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

S-(+)-Ketoprofen, Alternative-names: (S)-Ketoprofen;Dexketoprofen, CAS# 22161-81-5, Formula: C16H14O3, MWT: 254.2806, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Asapiprant, Alternative-names: S-555739, CAS# 932372-01-5, Formula: C24H27N3O7S, MWT: 501.5521, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

D-Panthenol, Alternative-names: Dexpanthenol, CAS# 81-13-0, Formula: C9H19NO4, MWT: 205.2515, Solubility: DMSO: 33 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Valpromide, Alternative-names: , CAS# 2430-27-5, Formula: C8H17NO, MWT: 143.2267, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Cilastatin, Alternative-names: , CAS# 82009-34-5, Formula: C16H26N2O5S, MWT: 358.453, Solubility: DMSO: 15 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Alimemazine hemitartrate, Alternative-names: Trimeprazine hemitartrate, CAS# 4330-99-8, Formula: C18H22N2S.1/2C4H6O6, MWT: 373.49, Solubility: DMSO: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

NPPB, Alternative-names: Hoechst 144;HOE 144, CAS# 107254-86-4, Formula: C16H16N2O4, MWT: 300.30924, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Chloride Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Diosmin, Alternative-names: , CAS# 520-27-4, Formula: C28H32O15, MWT: 608.5447, Solubility: DMSO: 32 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Vitamin K4, Alternative-names: acetomenaphthone, CAS# 573-20-6, Formula: C15H14O4, MWT: 258.2693, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

(R)-Equol, Alternative-names: (+)-Equol, CAS# 221054-79-1, Formula: C15H14O3, MWT: 242.26986, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Methylprednisolone succinate, Alternative-names: Methylprednisolone hydrogen succinate, CAS# 2921-57-5, Formula: C26H34O8, MWT: 474.5434, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Flopropione, Alternative-names: , CAS# 2295-58-1, Formula: C9H10O4, MWT: 182.1733, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Metabolic Enzyme/Protease;Neuronal Signaling;GPCR/G Protein, Target: COMT;COMT;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

A-485, Alternative-names: , CAS# 1889279-16-6, Formula: C25H24F4N4O5, MWT: 536.4754728, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Dulaglutide, Alternative-names: LY2189265, CAS# 923950-08-7, Formula: C2646H4044N704O836S18, MWT: 59669.81, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Retinyl acetate, Alternative-names: Retinol acetate;Vitamin A acetate, CAS# 127-47-9, Formula: C22H32O2, MWT: 328.4883, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Tetracycline, Alternative-names: , CAS# 60-54-8, Formula: C22H24N2O8, MWT: 444.4346, Solubility: DMSO: 150 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Roflumilast N-oxide, Alternative-names: , CAS# 292135-78-5, Formula: C17H14Cl2F2N2O4, MWT: 419.2069, Solubility: DMSO: 320 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Acetylspiramycin, Alternative-names: Spiramycin B;Spiramycin II;Foromacidin B, CAS# 24916-51-6, Formula: C45H76N2O15, MWT: 885.08934, Solubility: DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Gallic acid, Alternative-names: 3,4,5-Trihydroxybenzoic acid, CAS# 149-91-7, Formula: C7H6O5, MWT: 170.1195, Solubility: DMSO: 100 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;Metabolic Enzyme/Protease, Target: COX;Acetyl-CoA Carboxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Toxicarol isoflavone, Alternative-names: , CAS# 3044-60-8, Formula: C23H22O7, MWT: 410.4166, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Aspirin Aluminum, Alternative-names: Aluminum diacetylsalicylate, CAS# 23413-80-1, Formula: C18H15AlO9, MWT: 402.2878386, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

DPP-IV-IN-2, Alternative-names: , CAS# 136259-18-2, Formula: C18H26N4O5, MWT: 378.42284, Solubility: DMSO: 125 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Warangalone, Alternative-names: Scandenolone, CAS# 4449-55-2, Formula: C25H24O5, MWT: 404.455, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Protein Tyrosine Kinase/RTK;Anti-infection, Target: PKA;PKA;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Sinomenine hydrochloride, Alternative-names: Cucoline hydrochloride, CAS# 6080-33-7, Formula: C19H24ClNO4, MWT: 365.85116, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;NF-κB, Target: Opioid Receptor;Opioid Receptor;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

WWL70, Alternative-names: , CAS# 947669-91-2, Formula: C27H23N3O3, MWT: 437.4898, Solubility: 10 mM in DMSO (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MAGL, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Sodium tauroglycocholate, Alternative-names: Tauroglycocholic acid sodium salt, CAS# 41945-48-6, Formula: C28H47N2NaO8S, MWT: 594.73614928, Solubility: DMSO: 30 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ethoxyquin, Alternative-names: , CAS# 91-53-2, Formula: C14H19NO, MWT: 217.3068, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Desipramine hydrochloride, Alternative-names: , CAS# 58-28-6, Formula: C18H23ClN2, MWT: 302.84162, Solubility: DMSO: 83.3 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Transporter;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

SecinH3, Alternative-names: , CAS# 853625-60-2, Formula: C24H20N4O4S, MWT: 460.505, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Troxerutin, Alternative-names: Trihydroxyethylrutin, CAS# 7085-55-4, Formula: C33H42O19, MWT: 742.6752, Solubility: DMSO: 100 mg/mL, Clinical_Information: Phase 4, Pathway: Protein Tyrosine Kinase/RTK;Immunology/Inflammation, Target: ROS;NOD-like Receptor (NLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Caffeic acid, Alternative-names: , CAS# 331-39-5, Formula: C9H8O4, MWT: 180.1574, Solubility: DMSO: 106.7 mg/mL, Clinical_Information: Phase 4, Pathway: Membrane Transporter/Ion Channel;Metabolic Enzyme/Protease, Target: TRP Channel;5-Lipoxygenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Robenidine hydrochloride, Alternative-names: , CAS# 25875-50-7, Formula: C15H14Cl3N5, MWT: 370.66416, Solubility: DMSO: 3 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection;Anti-infection, Target: Bacterial;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Calf thymus DNA, Alternative-names: , CAS# 91080-16-9, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

Carglumic Acid, Alternative-names: N-Carbamyl-L-glutamic acid, CAS# 1188-38-1, Formula: C6H10N2O5, MWT: 190.154, Solubility: H<sub>2</sub>O: 3 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Quinine, Alternative-names: , CAS# 130-95-0, Formula: C20H24N2O2, MWT: 324.41676, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Anti-infection, Target: Potassium Channel;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Carbadox, Alternative-names: , CAS# 6804-07-5, Formula: C11H10N4O4, MWT: 262.2215, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Sulfaquinoxaline sodium salt, Alternative-names: , CAS# 967-80-6, Formula: C14H11N4NaO2S, MWT: 322.3175, Solubility: DMSO: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Isoxsuprine hydrochloride, Alternative-names: , CAS# 579-56-6, Formula: C18H24ClNO3, MWT: 337.84106, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Membrane Transporter/Ion Channel;Neuronal Signaling, Target: Adrenergic Receptor;iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Quinidine hydrochloride monohydrate, Alternative-names: , CAS# 6151-40-2, Formula: C20H27ClN2O3, MWT: 378.893, Solubility: DMSO: 106.7 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Calmagite, Alternative-names: , CAS# 3147-14-6, Formula: C17H14N2O5S, MWT: 358.3685, Solubility: DMSO: 6 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Leucocrystal violet, Alternative-names: , CAS# 603-48-5, Formula: C25H31N3, MWT: 373.5338, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

ASTX660, Alternative-names: , CAS# 1799328-86-1, Formula: C30H42FN5O3, MWT: 539.6845832, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Apoptosis, Target: IAP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

AZD1390, Alternative-names: , CAS# 2089288-03-7, Formula: C27H32FN5O2, MWT: 477.5736832, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage;PI3K/Akt/mTOR, Target: ATM/ATR;ATM/ATR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

CC-671, Alternative-names: , CAS# 1618658-88-0, Formula: C28H28N6O4, MWT: 512.55972, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

3-arylisoquinolinamine derivative, Alternative-names: , CAS# 1029008-71-6, Formula: C18H19N3O, MWT: 293.3629, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Asparagusic acid, Alternative-names: , CAS# 2224-02-4, Formula: C4H6O2S2, MWT: 150.2192, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Esterase chromogenic substrate-1, Alternative-names: , CAS# 3252-36-6, Formula: C10H7BrClNO2, MWT: 288.5251, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Monobehenin, Alternative-names: , CAS# 30233-64-8, Formula: C25H52O5, MWT: 432.67738, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Benzocaine, Alternative-names: , CAS# 94-09-7, Formula: C9H11NO2, MWT: 165.1891, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g

BCI-121, Alternative-names: , CAS# 432529-82-3, Formula: C14H18BrN3O2, MWT: 340.21562, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

E3 Ligase Ligand-Linker Conjugates 1, Alternative-names: , CAS# 2097938-44-6, Formula: C23H29N3O10, MWT: 507.49046, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

E3 ligase Ligand 4, Alternative-names: , CAS# 835616-60-9, Formula: C13H9FN2O4, MWT: 276.22, Solubility: DMSO: 200 mg/mL, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: Ligand for E3 Ligase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Tyrphostin AG 879, Alternative-names: AG 879, CAS# 148741-30-4, Formula: C18H24N2OS, MWT: 316.461, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR;Trk Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Lurasidone, Alternative-names: , CAS# 367514-87-2, Formula: C28H36N4O2S, MWT: 492.676, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

GSK-4716, Alternative-names: , CAS# 101574-65-6, Formula: C17H18N2O2, MWT: 282.33702, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Calcipotriol Impurity C, Alternative-names: , CAS# 113082-99-8, Formula: C27H40O3, MWT: 412.6047, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Calcitriol Impurities A, Alternative-names: , CAS# 73837-24-8, Formula: C27H44O3, MWT: 416.6365, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Faropenem sodium, Alternative-names: , CAS# 122547-49-3, Formula: C12H15NNaO5S+, MWT: 308.3054207, Solubility: DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Bergaptol, Alternative-names: 5-Hydroxypsoralen;4-Hydroxybergapten, CAS# 486-60-2, Formula: C11H6O4, MWT: 202.1629, Solubility: DMSO: < 2.1 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Vitamin D2, Alternative-names: Ergocalciferol;Calciferol;Ercalciol, CAS# 50-14-6, Formula: C28H44O, MWT: 396.64836, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Impurity of Doxercalciferol, Alternative-names: , CAS# 127516-23-8, Formula: C28H44O2, MWT: 412.64776, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Calcitriol Impurities D, Alternative-names: , CAS# 103656-40-2, Formula: C28H46O3, MWT: 430.663, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

(E)-[6]-Dehydroparadol, Alternative-names: , CAS# 878006-06-5, Formula: C17H24O3, MWT: 276.3707, Solubility: DMSO: ≥ 140 mg/mL , Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Nelociguat, Alternative-names: BAY60-4552, CAS# 625115-52-8, Formula: C19H17FN8O2, MWT: 408.3891, Solubility: DMSO: ≥ 105 mg/mL (Need ultrasonic) , Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Guanylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Bacteria chromogenic substrate-1, Alternative-names: , CAS# 129541-43-1, Formula: C12H11BrClNO2, MWT: 316.5782, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

JQ-1 (carboxylic acid), Alternative-names: (+)-JQ-1 carboxylic acid;6H-Thieno[3,2-f][1,2,4]triazolo[4,3-a][1,4]diazepine-6-acetic acid, 4-(4-chlorophenyl)-2,3,9-trimethyl-, (6S)-, CAS# 202592-23-2, Formula: C19H17ClN4O2S, MWT: 400.8819, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Dabigatran (ethyl ester hydrochloride), Alternative-names: , CAS# 211914-50-0, Formula: C27H30ClN7O3, MWT: 536.0252, Solubility: DMSO: 10 mM, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

MC-Val-Cit-PAB, Alternative-names: , CAS# 159857-80-4, Formula: C28H40N6O7, MWT: 572.6532, Solubility: DMSO: 22 mg/mL, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: ADC Linker, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

FAAH-IN-2, Alternative-names: , CAS# 184475-71-6, Formula: C15H11ClFN3O2, MWT: 319.7181, Solubility: DMSO: 20 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Metabolic Enzyme/Protease, Target: FAAH;FAAH, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

(S)-Dolaphenine (hydrochloride), Alternative-names: , CAS# 135383-60-7, Formula: C11H13ClN2S, MWT: 240.7523, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

p-Aminosalicylic acid (sodium salt dihydrate), Alternative-names: 4-Aminosalicylic acid, CAS# 6018-19-5, Formula: C7H11NNaO5+, MWT: 212.1551607, Solubility: H<sub>2</sub>O: ≥ 49 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

MNS, Alternative-names: NSC 170724;5-(2-Nitrovinyl)benzodioxole, CAS# 1485-00-3, Formula: C9H7NO4, MWT: 193.15618, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: Src;Syk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

E3 Ligase Ligand-Linker Conjugates 2, Alternative-names: , CAS# 1818885-63-0, Formula: C27H32N4O8, MWT: 540.565, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: E3 Ligase Ligand-Linker Conjugate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Dopamine serotonin antagonist-1, Alternative-names: , CAS# 1977-07-7, Formula: C18H20N4, MWT: 292.3782, Solubility: DCM: ≥ 65 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein;Neuronal Signaling, Target: Serotonin Transporter;Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

7-Amino-4-methylcoumarin, Alternative-names: Coumarin 120, CAS# 26093-31-2, Formula: C10H9NO2, MWT: 175.184, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

EOS Med Chem, Medchem is Big

執大象，天下往，往而無害，安平泰

網址: www.eosmedchem.com 

2018. 4.18 Janpan CPHI, Attend

2018. 5.15 Israel Biomed, Attend

2018. 6. 20 China CPHI, W4E82

2018. 8. 28 Korea CPHI, Attend

2018. 10. 9 Spain World CPHI, Attend

郵箱: info@eosmedchem.com ; eosmedchem@gmail.com 

辦公室: 0086-531-69905422-806(直通)

攜帶番號 & WhatsApp & Wechat: +8618653174435

住所: Diaozhen Chemical Industrial Park, Jinan City, China