| TP-3654, Alternative-names: , CAS# 1361951-15-6, Formula: C22H25F3N4O, MWT: 418.4553096, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Nicotinamide N-oxide, Alternative-names: , CAS# 1986-81-8, Formula: C6H6N2O2, MWT: 138.12404, Solubility: DMSO: 6.6 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Diethyl phosphate, Alternative-names: Diethyl phosphoric acid, CAS# 598-02-7, Formula: C4H11O4P, MWT: 154.101502, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| 3-(Methylthio)propionic acid, Alternative-names: 3-Methylsulfanylpropionic acid, CAS# 646-01-5, Formula: C4H8O2S, MWT: 120.17012, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Chlorotoxin, Alternative-names: , CAS# 163515-35-3, Formula: C158H249N53O47S11, MWT: 3995.71, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 1, Pathway: Membrane Transporter/Ion Channel, Target: Chloride Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| 11beta-Hydroxyprogesterone, Alternative-names: 11β-Hydroxyprogesterone, CAS# 600-57-7, Formula: C21H30O3, MWT: 330.4611, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| N-(5-Aminopentyl)acetamide, Alternative-names: N-Acetylcadaverine, CAS# 32343-73-0, Formula: C7H16N2O, MWT: 144.21474, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Glycoursodeoxycholic acid, Alternative-names: Ursodeoxycholylglycine, CAS# 64480-66-6, Formula: C26H43NO5, MWT: 449.6233, Solubility: DMSO: ≥ 23 mg/mLL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| O-Acetylserine, Alternative-names: O-Acetyl-L-serine, CAS# 5147-00-2, Formula: C5H9NO4, MWT: 147.12926, Solubility: H<sub>2</sub>O: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Campesterol, Alternative-names: (24R)-5-Ergosten-3β-ol, CAS# 474-62-4, Formula: C28H48O, MWT: 400.6801, Solubility: 10 mM in Ethanol, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Evobrutinib, Alternative-names: M2951;MSC2364447C, CAS# 1415823-73-2, Formula: C25H27N5O2, MWT: 429.51418, Solubility: DMSO: 6.4 mg/mL (Need ultrasonic), Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SDMA, Alternative-names: NG,NG'-Dimethyl-L-arginine, CAS# 30344-00-4, Formula: C8H18N4O2, MWT: 202.25412, Solubility: DMSO: 8.33 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Urolithin A, Alternative-names: , CAS# 1143-70-0, Formula: C13H8O4, MWT: 228.2002, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Elacestrant, Alternative-names: RAD1901, CAS# 722533-56-4, Formula: C30H38N2O2, MWT: 458.6349, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BAY-1143572, Alternative-names: , CAS# 1414943-88-6, Formula: C18H18FN5O2S, MWT: 387.4312, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BGB-283, Alternative-names: , CAS# 1446090-77-2, Formula: C25H17F3N4O3, MWT: 478.4227, Solubility: DMSO: ≥ 125 mg/mL, Clinical_Information: Phase 1, Pathway: MAPK/ERK Pathway;JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: Raf;EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SMCC-DM1, Alternative-names: DM1-SMCC, CAS# 1228105-51-8, Formula: C51H66ClN5O16S, MWT: 1072.61164, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| AK-1, Alternative-names: , CAS# 330461-64-8, Formula: C19H21N3O5S, MWT: 403.45214, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: Sirtuin;Sirtuin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Pyrvinium pamoate, Alternative-names: Pyrvinium embonate, CAS# 3546-41-6, Formula: C26H28N3 . 1/2 C23H14O6, MWT: 575.7, Solubility: DMSO: ≥ 24 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Oxyphenisatine, Alternative-names: Oxyphenisatin, CAS# 125-13-3, Formula: C20H15NO3, MWT: 317.338, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Thyroxine sulfate, Alternative-names: , CAS# 77074-49-8, Formula: C15H11I4NO7S, MWT: 856.93322, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| L-DABA, Alternative-names: L-2,4-Diaminobutyric acid, CAS# 1758-80-1, Formula: C4H10N2O2, MWT: 118.1344, Solubility: H<sub>2</sub>O: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| TPPU, Alternative-names: , CAS# 1222780-33-7, Formula: C16H20F3N3O3, MWT: 359.3435096, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BAY 11-7085, Alternative-names: BAY 11-7083, CAS# 196309-76-9, Formula: C13H15NO2S, MWT: 249.3287, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| JNJ-42153605, Alternative-names: , CAS# 1254977-87-1, Formula: C22H23F3N4, MWT: 400.44, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vanilpyruvic acid, Alternative-names: Vanylpyruvic acid, CAS# 1081-71-6, Formula: C10H10O5, MWT: 210.1834, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Membrane Transporter/Ion Channel;GPCR/G Protein;Neuronal Signaling, Target: Adrenergic Receptor;Monoamine Transporter;Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Glycochenodeoxycholic acid, Alternative-names: Chenodeoxycholylglycine, CAS# 640-79-9, Formula: C26H43NO5, MWT: 449.62332, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Cyclo(his-pro), Alternative-names: Cyclo(histidyl-proline);Histidylproline diketopiperazine, CAS# 53109-32-3, Formula: C11H14N4O2, MWT: 234.25446, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Olcegepant (hydrochloride), Alternative-names: BIBN-4096 hydrochloride;BIBN4096BS hydrochloride, CAS# 586368-06-1, Formula: C38H47Br2N9O5.HCl, MWT: 906.11, Solubility: H<sub>2</sub>O: ≥ 66.66 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: CGRP Receptor;CGRP Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
TAS-102, Alternative-names: Trifluridine-tipiracil hydrochloride mixture, CAS# 733030-01-8, Formula: C10H11F3N2O5 . 1/2C9H11ClN4O2 . 1/2HCl, MWT: 435.76, Solubility: DMSO: 2.34 mg/mL (Need ultrasonic and warming)
, Clinical_Information: Launched, Pathway: Apoptosis;Cell Cycle/DNA Damage, Target: Thymidylate Synthase;Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Lurbinectedin, Alternative-names: PM01183, CAS# 497871-47-3, Formula: C41H44N4O10S, MWT: 784.87386, Solubility: DMSO: 10 mM, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Elacestrant (dihydrochloride), Alternative-names: RAD1901 dihydrochloride, CAS# 1349723-93-8, Formula: C30H40Cl2N2O2, MWT: 531.5568, Solubility: DMSO: 17.6 mg/mL; H<sub>2</sub>O, Clinical_Information: Phase 2, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| JD-5037, Alternative-names: , CAS# 1392116-14-1, Formula: C27H27Cl2N5O3S, MWT: 572.506, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vps34-PIK-III, Alternative-names: , CAS# 1383716-40-2, Formula: C17H17N7, MWT: 319.3638, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;Autophagy, Target: PI3K;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Cholesterol myristate, Alternative-names: Cholesteryl myristate;Cholesteryl tetradecanoate, CAS# 1989-52-2, Formula: C41H72O2, MWT: 597.00918, Solubility: Ethanol：2 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg |
| D-(+)-Melezitose, Alternative-names: (+)-Melezitose;D-Melezitose, CAS# 597-12-6, Formula: C18H32O16, MWT: 504.43708, Solubility: H<sub>2</sub>O: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Taurochenodeoxycholic acid, Alternative-names: 12-Deoxycholyltaurine, CAS# 516-35-8, Formula: C26H45NO6S, MWT: 499.7036, Solubility: DMSO: ≥ 25 mg/mL, Clinical_Information: Launched, Pathway: Apoptosis;Apoptosis;Apoptosis, Target: Apoptosis;Caspase;TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Phytic acid, Alternative-names: myo-Inositol, hexakis(dihydrogen phosphate);Inositol hexaphosphate, CAS# 83-86-3, Formula: C6H18O24P6, MWT: 660.0353, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Xanthine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg |
| PF-01247324, Alternative-names: , CAS# 875051-72-2, Formula: C13H10Cl3N3O, MWT: 330.597, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Methyl-β-cyclodextrin, Alternative-names: Methyl-beta-cyclodextrin, CAS# 128446-36-6, Formula: N/A, MWT: 1000, Solubility: DMSO: ≥ 31 mg/mL; H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| [6]-Gingerol, Alternative-names: (S)-(+)-[6]Gingerol;6-Gingerol, CAS# 23513-14-6, Formula: C17H26O4, MWT: 294.3859, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Apoptosis;Epigenetics;PI3K/Akt/mTOR, Target: Apoptosis;AMPK;AMPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RG14620, Alternative-names: Tyrphostin RG14620, CAS# 136831-49-7, Formula: C14H8Cl2N2, MWT: 275.13272, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bamaquimast, Alternative-names: , CAS# 135779-82-7, Formula: C16H21N3O3, MWT: 303.35624, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ISCK03, Alternative-names: , CAS# 945526-43-2, Formula: C19H21N3O2S, MWT: 355.45394, Solubility: DMSO: ≥ 38 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Kit, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NS-638, Alternative-names: , CAS# 150493-34-8, Formula: C15H11ClF3N3, MWT: 325.7161496, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PGD2-IN-1, Alternative-names: , CAS# 885066-67-1, Formula: C23H23Cl2N3O3, MWT: 460.35302, Solubility: DMSO: ≥ 25 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NIH-12848, Alternative-names: , CAS# 959551-10-1, Formula: C20H14F3N3S, MWT: 385.4054696, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| GAL-021, Alternative-names: , CAS# 1380341-99-0, Formula: C11H22N6O, MWT: 254.33198, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BVT-14225, Alternative-names: , CAS# 376638-65-2, Formula: C16H20ClN3O3S2, MWT: 401.9313, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Nicaraven, Alternative-names: , CAS# 79455-30-4, Formula: C15H16N4O2, MWT: 284.3131, Solubility: DMSO: 10 mM (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Coumestrol, Alternative-names: , CAS# 479-13-0, Formula: C15H8O5, MWT: 268.22102, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Palmitelaidic Acid, Alternative-names: 9-trans-Hexadecenoic acid;trans-Palmitoleic acid, CAS# 10030-73-6, Formula: C16H30O2, MWT: 254.4082, Solubility: Ethanol: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;PI3K/Akt/mTOR;Membrane Transporter/Ion Channel;Neuronal Signaling, Target: AMPK;AMPK;iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Docosatrienoic Acid, Alternative-names: cis-13,16,19-docosatrienoic acid;(13Z,16Z,19Z)-13,16,19-Docosatrienoic acid, CAS# 28845-86-5, Formula: C22H38O2, MWT: 334.53592, Solubility: Ethanol: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Iberin, Alternative-names: , CAS# 505-44-2, Formula: C5H9NOS2, MWT: 163.26106, Solubility: Ethanol: 10 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| MLi-2, Alternative-names: , CAS# 1627091-47-7, Formula: C21H25N5O2, MWT: 379.4555, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: LRRK2, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 4-Acetamidobutanoic acid, Alternative-names: N-acetyl GABA, CAS# 3025-96-5, Formula: C6H11NO3, MWT: 145.15644, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| RAD51 Inhibitor B02, Alternative-names: BO2, CAS# 1290541-46-6, Formula: C22H17N3O, MWT: 339.38988, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: RAD51, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Omadacycline (hydrochloride), Alternative-names: PTK0796 hydrochloride;Amadacycline hydrochloride, CAS# 1196800-39-1, Formula: C29H40N4O7.HCl, MWT: 593.11, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| IT1t, Alternative-names: , CAS# 864677-55-4, Formula: C21H34N4S2, MWT: 406.65146, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Chondroitin (sulfate), Alternative-names: Chondroitin polysulfate, CAS# 9007-28-7, Formula: (C14H21NO14S)n, MWT: 1000, Solubility: H<sub>2</sub>O: ≥ 1666.66 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Apoptosis;NF-κB, Target: Apoptosis;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg |
| RG13022, Alternative-names: Tyrphostin RG13022;, CAS# 136831-48-6, Formula: C16H14N2O2, MWT: 266.29456, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Bradykinin, Alternative-names: , CAS# 58-82-2, Formula: C50H73N15O11, MWT: 1060.20852, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Bradykinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| N2-Methylguanine, Alternative-names: , CAS# 10030-78-1, Formula: C6H7N5O, MWT: 165.15268, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection;Cell Cycle/DNA Damage, Target: Bacterial;DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Lys01 (trihydrochloride), Alternative-names: Lys05, CAS# 1391426-24-6, Formula: C23H26Cl5N5, MWT: 549.751, Solubility: H<sub>2</sub>O: 6.4 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Coenzyme Q9, Alternative-names: Ubiquinone Q9;CoQ9;Ubiquinone 9, CAS# 303-97-9, Formula: C54H82O4, MWT: 795.22648, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Gentamicin (sulfate), Alternative-names: , CAS# 1405-41-0, Formula: C(19-21)H(39-43)N5O7·H2SO4, MWT: 1000, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Trichlormethine (hydrochloride), Alternative-names: Tris(2-chloroethyl)amine hydrochloride, CAS# 817-09-4, Formula: C6H13Cl4N, MWT: 240.98612, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Gestrinone, Alternative-names: , CAS# 16320-04-0, Formula: C21H24O2, MWT: 308.41406, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CHZ868, Alternative-names: , CAS# 1895895-38-1, Formula: C22H19F2N5O2, MWT: 423.4154, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Cenerimod, Alternative-names: ACT-334441, CAS# 1262414-04-9, Formula: C25H31N3O5, MWT: 453.5307, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Vapreotide (acetate), Alternative-names: RC-160 acetate;BMY-41606 acetate, CAS# 849479-74-9, Formula: C59H74N12O11S2, MWT: 1191.42266, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: Somatostatin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| (±)-Zanubrutinib, Alternative-names: (±)-BGB-3111, CAS# 1633350-06-7, Formula: C27H29N5O3, MWT: 471.55086, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MK-0557, Alternative-names: , CAS# 328232-95-7, Formula: C22H19FN4O3, MWT: 406.4097, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: Neuropeptide Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| HSP70-IN-1, Alternative-names: , CAS# 1268273-90-0, Formula: C24H28N6O2S, MWT: 464.5831, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Omapatrilat, Alternative-names: BMS-186716, CAS# 167305-00-2, Formula: C19H24N2O4S2, MWT: 408.5349, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Diquafosol (tetrasodium), Alternative-names: INS365, CAS# 211427-08-6, Formula: C18H22N4Na4O23P4, MWT: 878.23, Solubility: H<sub>2</sub>O: ≥ 32 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: P2Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CEP-40783, Alternative-names: RXDX-106, CAS# 1437321-24-8, Formula: C31H26F2N4O6, MWT: 588.5581464, Solubility: DMSO: 7.6 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR;TAM Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| 10074-G5, Alternative-names: , CAS# 413611-93-5, Formula: C18H12N4O3, MWT: 332.31288, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: c-Myc, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vadadustat, Alternative-names: PG-1016548;AKB-6548, CAS# 1000025-07-9, Formula: C14H11ClN2O4, MWT: 306.70114, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| ISA-2011B, Alternative-names: , CAS# 1395347-24-6, Formula: C22H18ClN3O4, MWT: 423.849, Solubility: DMSO: ≥ 57 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tenalisib, Alternative-names: RP6530, CAS# 1639417-53-0, Formula: C23H18FN5O2, MWT: 415.4197, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vitamin K1, Alternative-names: Phylloquinone;Phytomenadione, CAS# 84-80-0, Formula: C31H46O2, MWT: 450.6957, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Kinetin riboside, Alternative-names: N6-Furfuryladenosine, CAS# 4338-47-0, Formula: C15H17N5O5, MWT: 347.32598, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Lycopene, Alternative-names: , CAS# 502-65-8, Formula: C40H56, MWT: 536.8726, Solubility: DMSO: 6.4 mg/mL, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Migalastat (hydrochloride), Alternative-names: 1-Deoxygalactonojirimycin hydrochloride, CAS# 75172-81-5, Formula: C6H14ClNO4, MWT: 199.6327, Solubility: H<sub>2</sub>O: ≥ 200 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PDE1-IN-2, Alternative-names: , CAS# 1904611-63-7, Formula: C16H21BrN4O2, MWT: 381.26754, Solubility: DMSO: 10mM, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| D-Galactose, Alternative-names: D-(+)-Galactose, CAS# 59-23-4, Formula: C6H12O6, MWT: 180.1559, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| SUN11602, Alternative-names: , CAS# 704869-38-5, Formula: C26H37N5O2, MWT: 451.60428, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| T56-LIMKi, Alternative-names: T5601640, CAS# 924473-59-6, Formula: C19H14F3N3O3, MWT: 389.328, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: LIM Kinase (LIMK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Coproporphyrin III, Alternative-names: , CAS# 14643-66-4, Formula: C36H38N4O8, MWT: 654.70892, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pipequaline, Alternative-names: PK-8165, CAS# 77472-98-1, Formula: C22H24N2, MWT: 316.4394, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Rolapitant, Alternative-names: SCH619734, CAS# 552292-08-7, Formula: C25H26F6N2O2, MWT: 500.4766, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| GSK180736A, Alternative-names: , CAS# 817194-38-0, Formula: C19H16FN5O2, MWT: 365.3611, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| ARV-771, Alternative-names: , CAS# 1949837-12-0, Formula: C49H60ClN9O7S2, MWT: 986.6398, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;PROTAC, Target: Epigenetic Reader Domain;PROTAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
Framycetin, Alternative-names: Fradiomycin B;Neomycin B, CAS# 119-04-0, Formula: C23H46N6O13, MWT: 614.6437, Solubility: DMSO: ≥ 60 mg/mL
, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| EED226, Alternative-names: , CAS# 2083627-02-3, Formula: C17H15N5O3S, MWT: 369.3977, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Dasotraline (hydrochloride), Alternative-names: SEP-225289 hydrochloride, CAS# 675126-08-6, Formula: C16H16Cl3N, MWT: 328.6639, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;Neuronal Signaling, Target: Dopamine Transporter;Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MT-DADMe-ImmA, Alternative-names: Methylthio-DADMe-Immucillin A;MTDIA, CAS# 653592-04-2, Formula: C13H19N5OS, MWT: 293.38786, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| L-Homocysteine thiolactone (hydrochloride), Alternative-names: , CAS# 31828-68-9, Formula: C4H8ClNOS, MWT: 153.63042, Solubility: H<sub>2</sub>O: ≥ 23 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ipriflavone, Alternative-names: , CAS# 35212-22-7, Formula: C18H16O3, MWT: 280.3178, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| LF3, Alternative-names: , CAS# 664969-54-4, Formula: C20H24N4O2S2, MWT: 416.56016, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: β-catenin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ICA-069673, Alternative-names: , CAS# 582323-16-8, Formula: C11H6ClF2N3O, MWT: 269.6346464, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| WAY-200070, Alternative-names: , CAS# 440122-66-7, Formula: C13H8BrNO3, MWT: 306.11152, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Setmelanotide, Alternative-names: RM-493;BIM-22493;IRC-022493, CAS# 920014-72-8, Formula: C49H68N18O9S2, MWT: 1117.309, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tebanicline (hydrochloride), Alternative-names: Ebanicline hydrochloride;ABT-594 hydrochloride, CAS# 203564-54-9, Formula: C9H12Cl2N2O, MWT: 235.11038, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Allopregnanolone, Alternative-names: 3α,5α-THP;SAGE-547;Brexanolone, CAS# 516-54-1, Formula: C21H34O2, MWT: 318.49346, Solubility: DMSO: 10 mM, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Deoxycytidine triphosphate, Alternative-names: dCTP, CAS# 2056-98-6, Formula: C9H16N3O13P3, MWT: 467.156926, Solubility: H<sub>2</sub>O: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog;DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Cardamonin, Alternative-names: Alpinetin chalcone;Cardamomin, CAS# 19309-14-9, Formula: C16H14O4, MWT: 270.28, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RA190, Alternative-names: , CAS# 1617495-03-0, Formula: C28H23Cl5N2O2, MWT: 596.7594, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Proteasome, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MSDC 0160, Alternative-names: Mitoglitazone;CAY10415, CAS# 146062-49-9, Formula: C19H18N2O4S, MWT: 370.4222, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Insulin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Emodepside, Alternative-names: PF 1022-221, CAS# 155030-63-0, Formula: C60H90N6O14, MWT: 1119.3884, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 1, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PD-166866, Alternative-names: , CAS# 192705-79-6, Formula: C20H24N6O3, MWT: 396.44296, Solubility: DMSO: 10.33 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Allopurinol riboside, Alternative-names: , CAS# 16220-07-8, Formula: C10H12N4O5, MWT: 268.22608, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 4μ8C, Alternative-names: IRE1 Inhibitor III, CAS# 14003-96-4, Formula: C11H8O4, MWT: 204.1788, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: IRE1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| tBID, Alternative-names: , CAS# 1639895-85-4, Formula: C11H3Br4N3O2, MWT: 528.7764, Solubility: DMSO: 26 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Q203, Alternative-names: IAP6;Telacebec, CAS# 1334719-95-7, Formula: C29H28ClF3N4O2, MWT: 557.0064296, Solubility: DMSO: 10 mM, Clinical_Information: Phase 1, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Neohesperidin, Alternative-names: Hesperetin 7-O-neohesperidoside, CAS# 13241-33-3, Formula: C28H34O15, MWT: 610.5605, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| Naringin Dihydrochalcone, Alternative-names: Naringin DC, CAS# 18916-17-1, Formula: C27H34O14, MWT: 582.5505, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| CYM-5541, Alternative-names: ML249, CAS# 945128-26-7, Formula: C19H28N2O2, MWT: 316.43782, Solubility: DMSO: ≥ 39 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| γ-Glu-Phe, Alternative-names: γ-Glutamylphenylalanine, CAS# 7432-24-8, Formula: C14H18N2O5, MWT: 294.30312, Solubility: DMSO: ≥ 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Olumacostat glasaretil, Alternative-names: , CAS# 1261491-89-7, Formula: C26H43NO7, MWT: 481.6221, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Acetyl-CoA Carboxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Ubiquitin Isopeptidase Inhibitor I, G5, Alternative-names: NSC144303, CAS# 108477-18-5, Formula: C19H14N2O7S, MWT: 414.3887, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Neohesperidin dihydrochalcone, Alternative-names: Neohesperidin DC;NHDC, CAS# 20702-77-6, Formula: C28H36O15, MWT: 612.5764, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: ROS, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| S63845, Alternative-names: , CAS# 1799633-27-4, Formula: C39H37ClF4N6O6S, MWT: 829.2593, Solubility: DMSO: ≥100 mg/mL; , Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Naringenin, Alternative-names: , CAS# 480-41-1, Formula: C15H12O5, MWT: 272.2528, Solubility: DMSO: ≥ 42 mg/mL, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage;Apoptosis;NF-κB;NF-κB, Target: PPAR;Caspase;NF-κB;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| VUF10460, Alternative-names: , CAS# 1028327-66-3, Formula: C15H19N5, MWT: 269.34486, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Pimodivir, Alternative-names: VX-787, CAS# 1629869-44-8, Formula: C20H19F2N5O2, MWT: 399.394, Solubility: DMSO: ≥ 12.5 mg/mL, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Influenza Virus, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| PZM21, Alternative-names: , CAS# 1997387-43-5, Formula: C19H27N3O2S, MWT: 361.50158, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| AC260584, Alternative-names: , CAS# 560083-42-3, Formula: C20H29FN2O2, MWT: 348.4549, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Bay 41-4109, Alternative-names: Bayer 41-4109, CAS# 298708-81-3, Formula: C18H13ClF3N3O2, MWT: 395.7629, Solubility: DMSO: ≥ 44 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HBV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pagoclone, Alternative-names: (+)-RP-59037;IP-456;RP-62955;CI-1043, CAS# 133737-32-3, Formula: C23H22ClN3O2, MWT: 407.89268, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| PE859, Alternative-names: , CAS# 1402727-29-0, Formula: C28H24N4O2, MWT: 448.5157, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| GPR120-IN-1, Alternative-names: , CAS# 1599477-75-4, Formula: C19H23ClF3NO3, MWT: 405.8390296, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPR120, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| (±)-SLV319, Alternative-names: (±)-Ibipinabant;(±)-BMS6462, CAS# 362519-49-1, Formula: C23H20Cl2N4O2S, MWT: 487.4015, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MI-538, Alternative-names: , CAS# 1857417-10-7, Formula: C27H25F3N8OS, MWT: 566.6006, Solubility: DMSO; Need ultrasonic and warming, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| IPSU, Alternative-names: , CAS# 1373765-19-5, Formula: C23H27N5O2, MWT: 405.4928, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Orexin Receptor (OX Receptor), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| INH6, Alternative-names: , CAS# 1001753-24-7, Formula: C19H18N2OS, MWT: 322.424, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Sufugolix, Alternative-names: TAK-013, CAS# 308831-61-0, Formula: C36H31F2N5O4S, MWT: 667.7242, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| alpha-Mangostin, Alternative-names: α-Mangostin, CAS# 6147-11-1, Formula: C24H26O6, MWT: 410.4596, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Bay 41-4109 (less active enantiomer), Alternative-names: Bayer 41-4109 less active enantiomer, CAS# 476617-51-3, Formula: C18H13ClF3N3O2, MWT: 395.7629296, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HBV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Polyoxyethylene stearate, Alternative-names: POES, CAS# 9004-99-3, Formula: C20H40O3, MWT: 328.5298, Solubility: DMSO: ≥ 49 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: P-glycoprotein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| XMD8-87, Alternative-names: ACK1-B19, CAS# 1234480-46-6, Formula: C24H27N7O2, MWT: 445.5169, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Tyrosinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LW6, Alternative-names: HIF-1α inhibitor;LW8, CAS# 934593-90-5, Formula: C26H29NO5, MWT: 435.51216, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| XMD16-5, Alternative-names: , CAS# 1345098-78-3, Formula: C23H24N6O2, MWT: 416.47566, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Tyrosinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NCB-0846, Alternative-names: , CAS# 1792999-26-8, Formula: C21H21N5O2, MWT: 375.4237, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AZD5153 (6-Hydroxy-2-naphthoic acid), Alternative-names: AZD 5153 6-Hydroxy-2-naphthoic acid;AZD-5153 6-Hydroxy-2-naphthoic acid, CAS# 1869912-40-2, Formula: C36H41N7O6, MWT: 667.75404, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 1, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
KDM5-IN-1, Alternative-names: , CAS# 1628210-26-3, Formula: C17H20N6O, MWT: 324.3803, Solubility: DMSO: ≥ 30 mg/mL
, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ilaprazole, Alternative-names: IY-81149, CAS# 172152-36-2, Formula: C19H18N4O2S, MWT: 366.43682, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vaborbactam, Alternative-names: RPX7009, CAS# 1360457-46-0, Formula: C12H16BNO5S, MWT: 297.1351, Solubility: DMSO: 10 mM, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| IT1t (dihydrochloride), Alternative-names: , CAS# 1092776-63-0, Formula: C21H36Cl2N4S2, MWT: 479.57334, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ML385, Alternative-names: , CAS# 846557-71-9, Formula: C31H29N3O2S, MWT: 507.6459, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: Keap1-Nrf2, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| LGD-6972, Alternative-names: , CAS# 1207989-09-0, Formula: C43H46N2O5S, MWT: 702.9008, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TPI-1, Alternative-names: , CAS# 79756-69-7, Formula: C12H6Cl2O2, MWT: 253.0808, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Discoidin Domain Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| GSK3326595, Alternative-names: , CAS# 1616392-22-3, Formula: C24H32N6O3, MWT: 452.54928, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 1, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| C29, Alternative-names: , CAS# 363600-92-4, Formula: C16H15NO4, MWT: 285.2946, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Toll-like Receptor (TLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| (±)-Carnitine (chloride), Alternative-names: DL-Carnitine chloride, CAS# 461-05-2, Formula: C7H16ClNO3, MWT: 197.6598, Solubility: H<sub>2</sub>O: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
Acrivastine, Alternative-names: BW825C, CAS# 87848-99-5, Formula: C22H24N2O2, MWT: 348.4382, Solubility: DMSO: 10.45 mg/mL (Need ultrasonic)
, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| BD1063 (dhydrochloride), Alternative-names: , CAS# 206996-13-6, Formula: C13H20Cl4N2, MWT: 346.1233, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Sigma Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Terconazole, Alternative-names: R42470, CAS# 67915-31-5, Formula: C26H31Cl2N5O3, MWT: 532.462, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| UK-371804, Alternative-names: , CAS# 256477-09-5, Formula: C14H16ClN5O4S, MWT: 385.82594, Solubility: DMSO: 10 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Ser/Thr Protease, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| YKL-05-099, Alternative-names: , CAS# 1936529-65-5, Formula: C32H34ClN7O3, MWT: 600.11046, Solubility: DMSO: ≥ 103.33 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Salt-inducible Kinase (SIK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| GDC-0077, Alternative-names: , CAS# 2060571-02-8, Formula: C18H19F2N5O4, MWT: 407.3713664, Solubility: DMSO≥ 180 mg/mL, Clinical_Information: Phase 1, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Rosmarinic acid (racemate), Alternative-names: , CAS# 537-15-5, Formula: C18H16O8, MWT: 360.31484, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Nodinitib-1, Alternative-names: ML130;CID-1088438, CAS# 799264-47-4, Formula: C14H13N3O2S, MWT: 287.3369, Solubility: DMSO: 20 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NOD-like Receptor (NLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
STK16-IN-1, Alternative-names: , CAS# 1223001-53-3, Formula: C17H12FN3O, MWT: 293.2950832, Solubility: DMSO: 15 mg/mL
, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Clinofibrate, Alternative-names: S-8527, CAS# 30299-08-2, Formula: C28H36O6, MWT: 468.5818, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Lodoxamide (tromethamine), Alternative-names: , CAS# 63610-09-3, Formula: C19H28ClN5O12, MWT: 553.9049, Solubility: DMSO: 20 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pan-RAS-IN-1, Alternative-names: , CAS# 1835283-94-7, Formula: C36H41Cl2F3N6O2, MWT: 717.6509496, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Ras, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| CXCR2-IN-1, Alternative-names: , CAS# 1873376-49-8, Formula: C19H20Cl2FN3O4S, MWT: 476.3492032, Solubility: DMSO: ≥5.4 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GSK864, Alternative-names: , CAS# 1816331-66-4, Formula: C30H31FN6O4, MWT: 558.6033, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Isocitrate Dehydrogenase (IDH), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| AZD8797, Alternative-names: , CAS# 911715-90-7, Formula: C19H25N5OS2, MWT: 403.5647, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Seletalisib, Alternative-names: UCB5857, CAS# 1362850-20-1, Formula: C23H14ClF3N6O, MWT: 482.8451, Solubility: DMSO: ≥83.3 mg/mL, Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BMS-214662, Alternative-names: , CAS# 195987-41-8, Formula: C25H23N5O2S2, MWT: 489.6124, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: Farnesyl Transferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| FMK 9a, Alternative-names: , CAS# 1955550-51-2, Formula: C23H21FN2O3, MWT: 392.4229, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| ST-193, Alternative-names: , CAS# 489416-12-8, Formula: C24H25N3O, MWT: 371.4748, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Arenavirus , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| SF2523, Alternative-names: , CAS# 1174428-47-7, Formula: C19H17NO5S, MWT: 371.40698, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;Cell Cycle/DNA Damage;PI3K/Akt/mTOR;Epigenetics, Target: DNA-PK;DNA-PK;PI3K;Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
ML329, Alternative-names: , CAS# 19992-50-8, Formula: C16H12N2O4S, MWT: 328.34248, Solubility: DMSO: ≥ 31 mg/mL
, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GLPG0187, Alternative-names: , CAS# 1320346-97-1, Formula: C29H37N7O5S, MWT: 595.713, Solubility: DMSO: 15 mg/mL, Clinical_Information: Phase 1, Pathway: Cytoskeleton, Target: Integrin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| RG7800, Alternative-names: , CAS# 1449598-06-4, Formula: C24H28N6O, MWT: 416.51872, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TPOP146, Alternative-names: , CAS# 2018300-62-2, Formula: C27H35N3O5, MWT: 481.5839, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SCH 23390 (hydrochloride), Alternative-names: R-(+)-SCH23390 hydrochloride, CAS# 125941-87-9, Formula: C17H19Cl2NO, MWT: 324.2449, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
AMG9810, Alternative-names: , CAS# 545395-94-6, Formula: C21H23NO3, MWT: 337.41222, Solubility: DMSO: ≥ 33 mg/mL
, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| MBP146-78, Alternative-names: , CAS# 188343-77-3, Formula: C21H22FN3, MWT: 335.4178832, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Lu AF21934, Alternative-names: , CAS# 1445605-23-1, Formula: C14H16Cl2N2O2, MWT: 315.195, Solubility: DMSO: ≥ 80 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
EDO-S101, Alternative-names: Tinostamustine, CAS# 1236199-60-2, Formula: C19H28Cl2N4O2, MWT: 415.35722, Solubility: DMSO: ≥ 30 mg/mL
, Clinical_Information: Phase 2, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| FLAG peptide, Alternative-names: DYKDDDDK;Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, CAS# 98849-88-8, Formula: C41H60N10O20, MWT: 1012.9701, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Leucylarginylproline, Alternative-names: Leu-Arg-Pro;LRP, CAS# 133943-59-6, Formula: C17H32N6O4, MWT: 384.4738, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| (Arg)9, Alternative-names: Nona-L-arginine;Peptide R9;Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg;RRRRRRRRR, CAS# 143413-47-2, Formula: C54H110N36O10, MWT: 1423.686, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Gap 27, Alternative-names: Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile, CAS# 198284-64-9, Formula: C60H101N15O17, MWT: 1304.534, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cytoskeleton, Target: Gap Junction Protein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| N-Formyl-Met-Leu-Phe, Alternative-names: fMLP;N-Formyl-MLF, CAS# 59880-97-6, Formula: C21H31N3O5S, MWT: 437.55294, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PLP (139-151), Alternative-names: HCLGKWLGHPDKF;His-Cys-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe, CAS# 131334-43-5, Formula: C72H104N20O16S, MWT: 1537.786, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SN50, Alternative-names: NF-kB Inhibitor;AAVALLPAVLLALLAPVQRKRQKLMP;Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Val-Gln-Arg-Lys-Arg-Gln-Lys-Leu-Met-Pro, CAS# 213546-53-3, Formula: C129H230N36O29S, MWT: 2781.495, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Autocamtide 2, Alternative-names: Autocamtide II;Lys-Lys-Ala-Leu-Arg-Arg-Gln-Glu-Thr-Val-Asp-Ala-Leu;KKALRRQETVDAL, CAS# 129198-88-5, Formula: C65H118N22O20, MWT: 1527.76782, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: CaMK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Gly6, Alternative-names: Hexaglycine;Gly-Gly-Gly-Gly-Gly-Gly;GGGGGG, CAS# 3887-13-6, Formula: C12H20N6O7, MWT: 360.3232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TFLLR-NH2, Alternative-names: PAR-1-AP;Thr-Phe-Leu-Leu-Arg-NH2, CAS# 197794-83-5, Formula: C31H53N9O6, MWT: 647.80922, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Protease-Activated Receptor (PAR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SHU 9119, Alternative-names: MBX36;XDHXRWK;Ac-Nle-cyclo[Asp-His-D-Nal(2')-Arg-Trp-Lys]-NH2, CAS# 168482-23-3, Formula: C54H71N15O9, MWT: 1074.23664, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Calcineurin substrate, Alternative-names: DLDVPIPGRFDRRVSVAAE;Asp-Leu-Asp-Val-Pro-Ile-Pro-Gly-Arg-Phe-Asp-Arg-Arg-Val-Ser-Val-Ala-Ala-Glu, CAS# 113873-67-9, Formula: C92H150N28O29, MWT: 2112.3456, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
Lodoxamide, Alternative-names: , CAS# 53882-12-5, Formula: C11H6ClN3O6, MWT: 311.63484, Solubility: DMSO: ≥ 30 mg/mL
, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
666-15, Alternative-names: , CAS# 1433286-70-4, Formula: C33H31Cl2N3O5, MWT: 620.52234, Solubility: DMSO: ≥ 30 mg/mL
, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Puromycin, Alternative-names: CL13900, CAS# 53-79-2, Formula: C22H29N7O5, MWT: 471.5096, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Homoplantaginin, Alternative-names: , CAS# 17680-84-1, Formula: C22H22O11, MWT: 462.4035, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis;NF-κB, Target: TNF-alpha;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Hispidulin, Alternative-names: Dinatin, CAS# 1447-88-7, Formula: C16H12O6, MWT: 300.2629, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Forsythoside B, Alternative-names: , CAS# 81525-13-5, Formula: C34H44O19, MWT: 756.7018, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis;NF-κB, Target: TNF-alpha;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 8-O-Acetyl shanzhiside methyl ester, Alternative-names: , CAS# 57420-46-9, Formula: C19H28O12, MWT: 448.4184, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Dihydroisotanshinone I, Alternative-names: , CAS# 20958-18-3, Formula: C18H14O3, MWT: 278.302, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vitamin K, Alternative-names: , CAS# 12001-79-5, Formula: N/A, MWT: 1000, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| ND-630, Alternative-names: , CAS# 1434635-54-7, Formula: C28H31N3O8S, MWT: 569.626, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Acetyl-CoA Carboxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| HJC0350, Alternative-names: , CAS# 885434-70-8, Formula: C15H19NO2S, MWT: 277.3819, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Iberdomide, Alternative-names: CC-220, CAS# 1323403-33-3, Formula: C25H27N3O5, MWT: 449.49898, Solubility: DMSO: ≥30 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ibiglustat, Alternative-names: Venglustat;GZ/SAR402671;GZ402671;SAR402671, CAS# 1401090-53-6, Formula: C20H24FN3O2S, MWT: 389.4869, Solubility: DMSO: 10 mM, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| TRC051384, Alternative-names: , CAS# 867164-40-7, Formula: C25H31N5O4, MWT: 465.54474, Solubility: DMSO: ≥100 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| TCN238, Alternative-names: , CAS# 125404-04-8, Formula: C12H11N3, MWT: 197.2358, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| WT-161, Alternative-names: , CAS# 1206731-57-8, Formula: C27H30N4O3, MWT: 458.5521, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Glafenine (hydrochloride), Alternative-names: Glafenin hydrochloride, CAS# 65513-72-6, Formula: C19H18Cl2N2O4, MWT: 409.26322, Solubility: DMSO: ≥60 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| N6-(2-Phenylethyl)adenosine, Alternative-names: N6-Phenethyladenosine;N6-Phenylethyladenosine, CAS# 20125-39-7, Formula: C18H21N5O4, MWT: 371.39044, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Oxyphenisatin acetate, Alternative-names: , CAS# 115-33-3, Formula: C24H19NO5, MWT: 401.41136, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| ZINC00881524, Alternative-names: , CAS# 557782-81-7, Formula: C21H20N2O3S, MWT: 380.4601, Solubility: DMSO: ≥ 300 mg/mL , Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AA26-9, Alternative-names: , CAS# 1312782-34-5, Formula: C7H10N4O, MWT: 166.1805, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Anle138b, Alternative-names: , CAS# 882697-00-9, Formula: C16H11BrN2O2, MWT: 343.17474, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BTB-1, Alternative-names: , CAS# 86030-08-2, Formula: C12H8ClNO4S, MWT: 297.71422, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bombesin, Alternative-names: {pGLU}QRLGNQWAVGHLM-NH2;GLP-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2, CAS# 31362-50-2, Formula: C71H110N24O18S, MWT: 1619.8481, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Bombesin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Fluralaner, Alternative-names: A1443;AH252723, CAS# 864731-61-3, Formula: C22H17Cl2F6N3O3, MWT: 556.2851, Solubility: DMSO: ≥ 221 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CFI-402257, Alternative-names: , CAS# 1610759-22-2, Formula: C28H30N6O3, MWT: 498.5762, Solubility: DMSO: 10 mM (Need Warming and Ultrasonic), Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Mps1;Mps1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Biotin-VAD-FMK, Alternative-names: , CAS# 1135688-15-1, Formula: C30H49FN6O8S, MWT: 672.8088632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Caspase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pipendoxifene (hydrochloride), Alternative-names: Pipindoxifene hydrochloride, CAS# 245124-69-0, Formula: C29H33ClN2O3, MWT: 493.0369, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Photo-lysine, Alternative-names: Photo lysine, CAS# 1863117-91-2, Formula: C6H12N4O2, MWT: 172.1851, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Gepotidacin, Alternative-names: GSK2140944, CAS# 1075236-89-3, Formula: C24H28N6O3, MWT: 448.5175, Solubility: DMSO: 10 mM, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PSI-7409, Alternative-names: , CAS# 1015073-42-3, Formula: C10H16FN2O14P3, MWT: 500.1587, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CHMFL-BMX-078, Alternative-names: CHMFL-BMX 078, CAS# 1808288-51-8, Formula: C33H35N7O6, MWT: 625.6743, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: BMX Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 24-Norursodeoxycholic acid, Alternative-names: , CAS# 99697-24-2, Formula: C23H38O4, MWT: 378.54542, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
Teludipine (hydrochloride), Alternative-names: GR53992B;GX1296B
, CAS# 108700-03-4, Formula: C28H39ClN2O6, MWT: 535.07206, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Rimeporide (hydrochloride), Alternative-names: , CAS# 187870-95-7, Formula: C11H16ClN3O5S2, MWT: 369.8448, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Saterinone (hydrochloride), Alternative-names: BDF 8634 hydrochloride, CAS# 102685-83-6, Formula: C27H31ClN4O4, MWT: 511.01244, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Temiverine (hydrochloride), Alternative-names: , CAS# 136529-33-4, Formula: C24H36ClNO3, MWT: 422.00054, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Prodipine (hydrochloride), Alternative-names: , CAS# 31314-39-3, Formula: C20H26ClN, MWT: 315.88014, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tasidotin (hydrochloride), Alternative-names: BSF 223651; ILX 651; LU 223651; Synthadotin;, CAS# 623174-20-9, Formula: C32H59ClN6O5, MWT: 643.3011, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ZT 52656A (hydrochloride), Alternative-names: , CAS# 115730-24-0, Formula: C19H26ClF3N2O, MWT: 390.8707496, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Triamcinolone Benetonide, Alternative-names: , CAS# 31002-79-6, Formula: C35H42FNO8, MWT: 623.7082832, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Pargolol (hydrochloride), Alternative-names: Ko 1400 hydrochloride, CAS# 36902-82-6, Formula: C16H24ClNO3, MWT: 313.81966, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tiapamil (hydrochloride), Alternative-names: Ro 11-1781, CAS# 57010-32-9, Formula: C26H38ClNO8S2, MWT: 592.16482, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ReN-1869 (hydrochloride), Alternative-names: , CAS# 170149-76-5, Formula: C24H28ClNO2, MWT: 397.93762, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| CNS-5161 (hydrochloride), Alternative-names: CNS 5161A, CAS# 160756-38-7, Formula: C16H19Cl2N3S2, MWT: 388.37816, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Naveglitazar (racemate), Alternative-names: , CAS# 916085-47-7, Formula: C25H26O6, MWT: 422.47034, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PAβN (dihydrochloride), Alternative-names: MC-207,110 dihydrochloride;Phe-Arg-β-naphthylamide dihydrochloride, CAS# 100929-99-5, Formula: C25H32Cl2N6O2, MWT: 519.46658, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| FK1052 hydrochloride, Alternative-names: , CAS# 129299-81-6, Formula: C18H20ClN3O, MWT: 329.8239, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| LTURM34, Alternative-names: , CAS# 1879887-96-3, Formula: C24H18N2O3S, MWT: 414.47632, Solubility: DMSO: ≥ 37.5 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;Cell Cycle/DNA Damage, Target: DNA-PK;DNA-PK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ABT-639 (hydrochloride), Alternative-names: , CAS# 1235560-31-2, Formula: C20H21Cl2F2N3O3S, MWT: 492.3668464, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Peliglitazar (racemate), Alternative-names: BMS 426707-01 racemate, CAS# 331744-72-0, Formula: C30H30N2O7, MWT: 530.5684, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TD-5471 (hydrochloride), Alternative-names: , CAS# 530084-35-6, Formula: C32H32ClN3O4, MWT: 558.06718, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Darbufelone (mesylate), Alternative-names: CI-1004 mesylate, CAS# 139340-56-0, Formula: C19H28N2O5S2, MWT: 428.56602, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;GPCR/G Protein, Target: Leukotriene Receptor;Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ELN 318463 (racemate), Alternative-names: , CAS# 851599-82-1, Formula: C19H20BrClN2O3S, MWT: 471.7957, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Neuronal Signaling, Target: γ-secretase;γ-secretase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| WAY127093B (racemate), Alternative-names: , CAS# 145743-63-1, Formula: C23H28N4O4, MWT: 424.49282, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Rentiapril (racemate), Alternative-names: , CAS# 72679-47-1, Formula: C13H15NO4S2, MWT: 313.3925, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Napsagatran (hydrate), Alternative-names: Ro 46-6240 hydrate;Ro 46-6240/010 hydrate, CAS# 159668-20-9, Formula: C26H36N6O7S, MWT: 576.66504, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ambutonium (bromide), Alternative-names: BL700, CAS# 115-51-5, Formula: C20H27BrN2O, MWT: 391.34518, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Amantanium (bromide), Alternative-names: , CAS# 58158-77-3, Formula: C25H46BrNO2, MWT: 472.54224, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| RAPACURONIUM BROMIDE, Alternative-names: Org 9487; Raplon, CAS# 156137-99-4, Formula: C37H61BrN2O4, MWT: 677.79524, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Nosantine (racemate), Alternative-names: NPT-15392 racemate, CAS# 75166-67-5, Formula: C14H22N4O2, MWT: 278.35008, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Interleukin Related, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Nexopamil (racemate), Alternative-names: , CAS# 116759-35-4, Formula: C24H40N2O3, MWT: 404.586, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling;GPCR/G Protein, Target: Calcium Channel;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Sch-42495 (racemate), Alternative-names: , CAS# 145841-10-7, Formula: C20H29NO4S2, MWT: 411.57856, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Quinotolast (sodium), Alternative-names: FR71021, CAS# 101193-62-8, Formula: C17H12N6NaO3+, MWT: 371.3048007, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor;Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tibenelast (sodium), Alternative-names: LY 186655, CAS# 105102-18-9, Formula: C13H13NaO4S, MWT: 288.29468928, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ENS-163 (phosphate), Alternative-names: ENS 213-163; Sandoz ENS 163 phosphate; Thiopilocarpine phosphate, CAS# 117707-51-4, Formula: C11H19N2O5PS, MWT: 322.317722, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| KUL 7211 (racemate), Alternative-names: KUL-7211 racemate, CAS# 911196-40-2, Formula: C19H23NO5, MWT: 345.38962, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| (E)-Crotylbarbital, Alternative-names: , CAS# 28360-89-6, Formula: C10H14N2O3, MWT: 210.22976, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Varespladib methyl, Alternative-names: A-002;LY333013;S-3013, CAS# 172733-08-3, Formula: C22H22N2O5, MWT: 394.4205, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Nitroflurbiprofen, Alternative-names: HCT 1206; NO-flurbiprofen;Nitroxybutyl flurbiprofen, CAS# 158836-71-6, Formula: C19H20FNO5, MWT: 361.3642032, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SPD-473 (citrate), Alternative-names: , CAS# 161190-26-7, Formula: C23H31Cl2NO8S, MWT: 552.46514, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Neuronal Signaling, Target: Dopamine Transporter;Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Chlorthenoxazine, Alternative-names: Chlorethylbenzmethoxazone, CAS# 132-89-8, Formula: C10H10ClNO2, MWT: 211.6449, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ethyl dirazepate, Alternative-names: , CAS# 23980-14-5, Formula: C18H14Cl2N2O3, MWT: 377.22136, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NO-prednisolone, Alternative-names: NCX-1015, CAS# 327610-87-7, Formula: C29H33NO9, MWT: 539.57362, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Interleukin Related, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| S-methyl-KE-298, Alternative-names: M-2, CAS# 143584-75-2, Formula: C13H16O3S, MWT: 252.32934, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| (E)-Alprenoxime, Alternative-names: , CAS# 125720-84-5, Formula: C15H22N2O2, MWT: 262.34738, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| (±)-Tazifylline, Alternative-names: , CAS# 79712-55-3, Formula: C23H32N6O3S, MWT: 472.60358, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Sulfaproxiline, Alternative-names: Sulfaproxylin; Sulfaproxyline, CAS# 116-42-7, Formula: C16H18N2O4S, MWT: 334.39012, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Phenglutarimid, Alternative-names: Ciba 10870;Phenglutarimide, CAS# 1156-05-4, Formula: C17H24N2O2, MWT: 288.38466, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Thiopropazate, Alternative-names: Thiopropazat;Perphenazine acetate, CAS# 84-06-0, Formula: C23H28ClN3O2S, MWT: 446.00532, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bucloxic acid, Alternative-names: 804CB; Bucloxonic acid; Esfar, CAS# 32808-51-8, Formula: C16H19ClO3, MWT: 294.77326, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Nitroxazepine, Alternative-names: CIBA 2330Go;Sintamil, CAS# 47439-36-1, Formula: C18H19N3O4, MWT: 341.36116, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| (±)-Befunolol, Alternative-names: , CAS# 39552-01-7, Formula: C16H21NO4, MWT: 291.34224, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Nifursemizone, Alternative-names: Etafurazone;NF161, CAS# 5579-89-5, Formula: C8H10N4O4, MWT: 226.1894, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Rabacfosadine, Alternative-names: GS-9219;VDC-1101, CAS# 859209-74-8, Formula: C21H35N8O6P, MWT: 526.526362, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ridinilazole, Alternative-names: SMT19969, CAS# 308362-25-6, Formula: C24H16N6, MWT: 388.424, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Sacubitrilat, Alternative-names: LBQ-657, CAS# 149709-44-4, Formula: C22H25NO5, MWT: 383.4376, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Neprilysin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Niperotidine, Alternative-names: , CAS# 84845-75-0, Formula: C20H26N4O5S, MWT: 434.5092, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Deramciclane, Alternative-names: , CAS# 120444-71-5, Formula: C20H31NO, MWT: 301.46624, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Droxicainide, Alternative-names: , CAS# 78289-26-6, Formula: C16H24N2O2, MWT: 276.37396, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Stilbamidine, Alternative-names: Ba 2652; Stilbamidin, CAS# 122-06-5, Formula: C16H16N4, MWT: 264.32504, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Rispenzepine, Alternative-names: , CAS# 96449-05-7, Formula: C19H20N4O2, MWT: 336.3877, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Indanazoline, Alternative-names: , CAS# 40507-78-6, Formula: C12H15N3, MWT: 201.2676, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Indeglitazar, Alternative-names: PPM 204, CAS# 835619-41-5, Formula: C19H19NO6S, MWT: 389.4223, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tritoqualine, Alternative-names: Inhibostamin;Hypostamine, CAS# 14504-73-5, Formula: C26H32N2O8, MWT: 500.54088, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Topilutamide, Alternative-names: BP766;Fluridil, CAS# 260980-89-0, Formula: C13H11F6N3O5, MWT: 403.2339, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Clocapramine, Alternative-names: Clocarpramine;3-Chlorocarpipramine, CAS# 47739-98-0, Formula: C28H37ClN4O, MWT: 481.0726, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Siltenzepine, Alternative-names: , CAS# 98374-54-0, Formula: C19H20ClN3O4, MWT: 389.8328, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Clothixamide, Alternative-names: Clotixamide, CAS# 4177-58-6, Formula: C24H28ClN3OS, MWT: 442.01662, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Befetupitant, Alternative-names: Ro67-5930, CAS# 290296-68-3, Formula: C29H29F6N3O2, MWT: 565.5499, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Cholic acid, Alternative-names: , CAS# 81-25-4, Formula: C24H40O5, MWT: 408.5714, Solubility: DMSO: ≥ 10 mM, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Scopolamine, Alternative-names: Hyoscine;Scopine (-)-tropate; Scopine tropate, CAS# 51-34-3, Formula: C17H21NO4, MWT: 303.3529, Solubility: DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Fibracillin, Alternative-names: , CAS# 51154-48-4, Formula: C26H28ClN3O6S, MWT: 546.03502, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Hepronicate, Alternative-names: Megrin, CAS# 7237-81-2, Formula: C28H31N3O6, MWT: 505.56224, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Terbufibrol, Alternative-names: , CAS# 56488-59-6, Formula: C20H24O5, MWT: 344.40156, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Glyhexamide, Alternative-names: SQ 15860; Serbose; Subose, CAS# 451-71-8, Formula: C16H22N2O3S, MWT: 322.42248, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Entasobulin, Alternative-names: , CAS# 501921-61-5, Formula: C26H18ClN3O2, MWT: 439.893, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Acetylazide, Alternative-names: Acetylkelfizina;Acetylsulfamethoxypyrazine;FI6073, CAS# 3590-05-4, Formula: C13H14N4O4S, MWT: 322.33966, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Atrimustine, Alternative-names: Bestrabucil;KM2210, CAS# 75219-46-4, Formula: C41H47Cl2NO6, MWT: 720.72098, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Proxibarbal, Alternative-names: Proxibarbital, CAS# 2537-29-3, Formula: C10H14N2O4, MWT: 226.22916, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Oxyfenamate, Alternative-names: Oxyphenamate; P 301, CAS# 50-19-1, Formula: C11H15NO3, MWT: 209.2417, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Gosogliptin, Alternative-names: PF-00734200;PF-734200, CAS# 869490-23-3, Formula: C17H24F2N6O, MWT: 366.4088664, Solubility: , Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pyrrolifene, Alternative-names: , CAS# 15686-97-2, Formula: C23H29NO2, MWT: 351.48186, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Abaperidone, Alternative-names: , CAS# 183849-43-6, Formula: C25H25FN2O5, MWT: 452.4748032, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Fluzinamide, Alternative-names: AHR-8559, CAS# 76263-13-3, Formula: C12H13F3N2O2, MWT: 274.2390296, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Doxefazepam, Alternative-names: SAS-643, CAS# 40762-15-0, Formula: C17H14ClFN2O3, MWT: 348.7560632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Spirendolol, Alternative-names: Li 32-468;S 32-468;Substance 32468, CAS# 81840-58-6, Formula: C21H31NO3, MWT: 345.47574, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| OSIP-486823, Alternative-names: OSIP 486823;OSIP486823;CP248, CAS# 200803-37-8, Formula: C29H28FNO4, MWT: 473.5353232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Pratosartan, Alternative-names: FW 7203; KD 3-671; KT 3671, CAS# 153804-05-8, Formula: C25H26N6O, MWT: 426.51354, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Lemildipine, Alternative-names: NB-818;NPK-1886, CAS# 94739-29-4, Formula: C20H22Cl2N2O6, MWT: 457.3045, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Modecainide, Alternative-names: BMY 40327;MJ 14030, CAS# 81329-71-7, Formula: C22H28N2O3, MWT: 368.46932, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Pexacerfont, Alternative-names: BMS-562086, CAS# 459856-18-9, Formula: C18H24N6O, MWT: 340.4228, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Picoprazole, Alternative-names: , CAS# 78090-11-6, Formula: C17H17N3O3S, MWT: 343.4002, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Dutogliptin, Alternative-names: , CAS# 852329-66-9, Formula: C10H20BN3O3, MWT: 241.0951, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Losmiprofen, Alternative-names: , CAS# 74168-08-4, Formula: C17H15ClO4, MWT: 318.7516, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Iganidipine, Alternative-names: , CAS# 119687-33-1, Formula: C28H38N4O6, MWT: 526.62452, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Deriglidole, Alternative-names: SL 86-0715, CAS# 122830-14-2, Formula: C16H21N3, MWT: 255.35804, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Brofaromine, Alternative-names: , CAS# 63638-91-5, Formula: C14H16BrNO2, MWT: 310.18634, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PNU-248686A, Alternative-names: , CAS# 341498-89-3, Formula: C22H19ClNaO5S2+, MWT: 485.9555, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Bamirastine, Alternative-names: TAK-427, CAS# 215529-47-8, Formula: C31H37N5O3, MWT: 527.65718, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Intoplicine, Alternative-names: , CAS# 125974-72-3, Formula: C21H24N4O, MWT: 348.44146, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Imiglitazar, Alternative-names: TAK-559, CAS# 250601-04-8, Formula: C28H26N2O5, MWT: 470.51644, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Panidazole, Alternative-names: , CAS# 13752-33-5, Formula: C11H12N4O2, MWT: 232.23858, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Melinamide, Alternative-names: AC 223; DL-N-(α-Methylbenzyl)linoleamide, CAS# 14417-88-0, Formula: C26H41NO, MWT: 383.60984, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Coumetarol, Alternative-names: Cumetharol; Cumethoxaethane; Dicoumoxyl; Dicumoxan; Dicumoxane; Ph 137, CAS# 4366-18-1, Formula: C21H16O7, MWT: 380.34754, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Silandrone, Alternative-names: Testosterone trimethylsilyl ether, CAS# 5055-42-5, Formula: C22H36O2Si, MWT: 360.60554, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Etersalate, Alternative-names: Eterylate; Etherylate, CAS# 62992-61-4, Formula: C19H19NO6, MWT: 357.35726, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Trestolone, Alternative-names: 7α-Methylnandrolone; MENT; NSC 142229; RU 27333, CAS# 3764-87-2, Formula: C19H28O2, MWT: 288.42442, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ipsalazide, Alternative-names: , CAS# 82101-17-5, Formula: C16H11N3Na2O6, MWT: 387.25457856, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;NF-κB, Target: Autophagy;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Citenamide, Alternative-names: AY-15613; Cytenamide, CAS# 10423-37-7, Formula: C16H13NO, MWT: 235.28052, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Imoxiterol, Alternative-names: , CAS# 88578-07-8, Formula: C20H25N3O3, MWT: 355.4308, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Alvameline, Alternative-names: Lu 25-109, CAS# 120241-31-8, Formula: C9H15N5, MWT: 193.2489, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| LY-2456302, Alternative-names: , CAS# 1174130-61-0, Formula: C26H27FN2O2, MWT: 418.5031832, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| GSK376501A, Alternative-names: , CAS# 1010412-80-2, Formula: C32H37NO6, MWT: 531.63928, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| EMIGLITATE, Alternative-names: BAY-o 1248, CAS# 80879-63-6, Formula: C17H25NO7, MWT: 355.3829, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RISARESTAT, Alternative-names: CT 112 (reductase inhibitor), CAS# 79714-31-1, Formula: C16H21NO4S, MWT: 323.4072, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Aldose Reductase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Indanidine, Alternative-names: , CAS# 85392-79-6, Formula: C11H13N5, MWT: 215.25442, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SDZ281-977, Alternative-names: SDZ-LAP 977, CAS# 150779-71-8, Formula: C18H20O5, MWT: 316.3484, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Tazanolast, Alternative-names: TO 188; Tazalest; Tazanol, CAS# 82989-25-1, Formula: C13H15N5O3, MWT: 289.2899, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| WAY-151932, Alternative-names: VNA-932;WAY-VNA 932, CAS# 220460-92-4, Formula: C23H19ClN4O, MWT: 402.8762, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Vasopressin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tulopafant, Alternative-names: RP 59227, CAS# 116289-53-3, Formula: C25H19N3O2S, MWT: 425.50226, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Temarotene, Alternative-names: Ro 15-0778, CAS# 75078-91-0, Formula: C23H28, MWT: 304.46842, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pivalopril, Alternative-names: Pivopril; RHC 3659(S), CAS# 81045-50-3, Formula: C16H27NO4S, MWT: 329.45488, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Lucanthone, Alternative-names: , CAS# 479-50-5, Formula: C20H24N2OS, MWT: 340.4824, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| WAY-204688, Alternative-names: SIM-688, CAS# 796854-35-8, Formula: C34H31F3N2O2, MWT: 556.6173496, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Aminaftone, Alternative-names: Aminaftone;Aminaphthone, CAS# 14748-94-8, Formula: C18H15NO4, MWT: 309.316, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Irindalone, Alternative-names: Lu 21-098, CAS# 96478-43-2, Formula: C24H29FN4O, MWT: 408.5116632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Ombrabulin, Alternative-names: AVE8062, CAS# 181816-48-8, Formula: C21H26N2O6, MWT: 402.4409, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ro-15-2041, Alternative-names: , CAS# 77448-87-4, Formula: C12H12BrN3O, MWT: 294.14718, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Ro 22-3245, Alternative-names: , CAS# 76988-39-1, Formula: C18H11Cl2N3, MWT: 340.20604, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PSI-352938, Alternative-names: , CAS# 1231747-17-3, Formula: C16H23FN5O6P, MWT: 431.3558852, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Lidanserin, Alternative-names: ZK-33839, CAS# 73725-85-6, Formula: C26H31FN2O4, MWT: 454.5337432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: Adrenergic Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Naminterol, Alternative-names: , CAS# 93047-40-6, Formula: C19H26N2O3, MWT: 330.42134, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Tarazepide, Alternative-names: , CAS# 141374-81-4, Formula: C28H24N4O2, MWT: 448.51576, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cholecystokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| GV-196771A, Alternative-names: , CAS# 166974-23-8, Formula: C20H13Cl2N2NaO3, MWT: 423.2246, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Brilacidin, Alternative-names: PMX 30063, CAS# 1224095-98-0, Formula: C40H50F6N14O6, MWT: 936.9056, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Setipafant, Alternative-names: BN-50727; LAU-0901, CAS# 132418-35-0, Formula: C26H23ClN6O2S, MWT: 519.01782, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Fradafiban, Alternative-names: BIBU-52, CAS# 148396-36-5, Formula: C20H21N3O4, MWT: 367.39844, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Cytoskeleton, Target: Integrin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| CRA-026440, Alternative-names: CRA026440;CRA 026440, CAS# 847460-34-8, Formula: C23H24N4O4, MWT: 420.4611, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Pancopride, Alternative-names: LAS 30451, CAS# 121650-80-4, Formula: C18H24ClN3O2, MWT: 349.8551, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ro 31-9790, Alternative-names: GI4747, CAS# 145337-55-9, Formula: C15H29N3O4, MWT: 315.40846, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ro-24-4736, Alternative-names: , CAS# 125030-71-9, Formula: C31H20ClN5OS, MWT: 546.0414, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ro-24-0238, Alternative-names: , CAS# 120555-31-9, Formula: C27H36N2O2, MWT: 420.5869, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RWJ-445167, Alternative-names: , CAS# 226566-43-4, Formula: C18H24N6O5S, MWT: 436.4854, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Metabolic Enzyme/Protease, Target: Factor Xa;Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SB-616234A, Alternative-names: , CAS# 908601-49-0, Formula: C32H36ClN5O3, MWT: 574.1129, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Sulamserod, Alternative-names: RS-100302, CAS# 219757-90-1, Formula: C19H28ClN3O5S, MWT: 445.96072, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Edotecarin, Alternative-names: J 107088; PF 804950, CAS# 174402-32-5, Formula: C29H28N4O11, MWT: 608.5528, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Bencianol, Alternative-names: ZY15051, CAS# 85443-48-7, Formula: C28H22O6, MWT: 454.47068, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Amcinafal, Alternative-names: SQ 15102, CAS# 3924-70-7, Formula: C26H35FO6, MWT: 462.5509032, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tegadifur, Alternative-names: 40497S;FD 1, CAS# 62987-05-7, Formula: C12H15FN2O4, MWT: 270.2569032, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PCI-27483, Alternative-names: , CAS# 871266-63-6, Formula: C26H24N6O9S, MWT: 596.5685, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Apyramide, Alternative-names: , CAS# 68483-33-0, Formula: C27H23ClN2O5, MWT: 490.93492, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tigloidin, Alternative-names: Tigloyl pseudotropine; Tiglylpseudotropine; Tiglyssin, CAS# 495-83-0, Formula: C13H21NO2, MWT: 223.31134, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SUN 1334H, Alternative-names: , CAS# 607736-84-5, Formula: C23H28Cl2F2N2O3, MWT: 489.3828264, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| LY 178002, Alternative-names: , CAS# 107889-32-7, Formula: C18H25NO2S, MWT: 319.4616, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Immunology/Inflammation;Metabolic Enzyme/Protease, Target: 5-Lipoxygenase;COX;Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Manitimus, Alternative-names: , CAS# 202057-76-9, Formula: C15H11F3N2O2, MWT: 308.2552496, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ketocaine, Alternative-names: Rec 7-0518, CAS# 1092-46-2, Formula: C18H29NO2, MWT: 291.42836, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Guaiapate, Alternative-names: Klamar;Mg 5454, CAS# 852-42-6, Formula: C18H29NO4, MWT: 323.42716, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Camobucol, Alternative-names: AGIX 4207, CAS# 216167-92-9, Formula: C33H50O4S2, MWT: 574.8777, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| IMIRESTAT, Alternative-names: AL 1576; Alcon 1576; HOE 843, CAS# 89391-50-4, Formula: C15H8F2N2O2, MWT: 286.233, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Aldose Reductase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Win 58237, Alternative-names: , CAS# 158001-76-4, Formula: C16H17N5O, MWT: 295.33908, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| BM-131246, Alternative-names: , CAS# 103787-97-9, Formula: C22H20N2O4S, MWT: 408.4702, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Duoperone, Alternative-names: , CAS# 62030-88-0, Formula: C28H26F4N2OS, MWT: 514.5774528, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Dazopride, Alternative-names: AHR-5531, CAS# 70181-03-2, Formula: C15H23ClN4O2, MWT: 326.82172, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Buthalial, Alternative-names: Buthalital; Buthalitone; Narkogen; Thialbutone, CAS# 468-65-5, Formula: C11H16N2O2S, MWT: 240.32194, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Namitecan, Alternative-names: ST-1968, CAS# 372105-27-6, Formula: C23H22N4O5, MWT: 434.4446, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Paliroden, Alternative-names: , CAS# 188396-77-2, Formula: C26H24F3N, MWT: 407.4706696, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MRZ 2-514, Alternative-names: , CAS# 202808-11-5, Formula: C11H6BrN3O3, MWT: 308.08764, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Recilisib, Alternative-names: ON01210;ON-01210;ON 01210, CAS# 334969-03-8, Formula: C16H13ClO4S, MWT: 336.79002, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;PI3K/Akt/mTOR, Target: PI3K;Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Senazodan, Alternative-names: , CAS# 98326-32-0, Formula: C15H14N4O, MWT: 266.29786, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| LAS-31180, Alternative-names: , CAS# 137338-43-3, Formula: C11H12N2O3S, MWT: 252.28958, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Pamatolol, Alternative-names: , CAS# 59110-35-9, Formula: C16H26N2O4, MWT: 310.38864, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| RWJ 63556, Alternative-names: , CAS# 190967-35-2, Formula: C11H10FNO3S2, MWT: 287.3304032, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Immunology/Inflammation, Target: 5-Lipoxygenase;COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RPR104632, Alternative-names: , CAS# 154106-92-0, Formula: C15H11BrCl2N2O4S, MWT: 466.13384, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| LAS101057, Alternative-names: , CAS# 925676-48-8, Formula: C18H14FN5O, MWT: 335.3351, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Utibapril, Alternative-names: FPL 63547, CAS# 109683-61-6, Formula: C22H31N3O5S, MWT: 449.56364, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| CP 316311, Alternative-names: , CAS# 175139-41-0, Formula: C21H29NO2, MWT: 327.4604, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Elisartan, Alternative-names: HN 65021, CAS# 149968-26-3, Formula: C27H29ClN6O5, MWT: 553.0093, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| CL-275838, Alternative-names: , CAS# 115931-65-2, Formula: C27H25F3N6O, MWT: 506.5222, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ZK-261991, Alternative-names: , CAS# 886563-25-3, Formula: C24H25N7O2, MWT: 443.501, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PD-159020, Alternative-names: , CAS# 177904-00-6, Formula: C32H25NO8, MWT: 551.5428, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| OPC-28326, Alternative-names: , CAS# 167626-17-7, Formula: C26H35N3O2, MWT: 421.575, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ecastolol, Alternative-names: , CAS# 77695-52-4, Formula: C26H33N3O6, MWT: 483.55672, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Rocastine, Alternative-names: , CAS# 91833-49-7, Formula: C13H19N3OS, MWT: 265.37446, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Teoprolol, Alternative-names: , CAS# 65184-10-3, Formula: C23H30N6O4, MWT: 454.5221, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Enazadrem, Alternative-names: , CAS# 107361-33-1, Formula: C18H25N3O, MWT: 299.4106, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: 5-Lipoxygenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Dobupride, Alternative-names: , CAS# 106707-51-1, Formula: C20H30ClN3O4, MWT: 411.9229, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SB-681323, Alternative-names: Dilmapimod; GW 681323, CAS# 444606-18-2, Formula: C23H19F3N4O3, MWT: 456.4172, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Sotirimod, Alternative-names: R850, CAS# 227318-75-4, Formula: C14H17N5, MWT: 255.31828, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| RWJ-51204, Alternative-names: , CAS# 205701-85-5, Formula: C21H19F2N3O3, MWT: 399.3907, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Rosabulin, Alternative-names: STA 5312, CAS# 501948-05-6, Formula: C22H16N4O2S, MWT: 400.453, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Flosulide, Alternative-names: ZK 38997;CGP 28238, CAS# 80937-31-1, Formula: C16H13F2NO4S, MWT: 353.3405264, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BMY-43748, Alternative-names: , CAS# 132195-65-4, Formula: C20H17F3N4O3, MWT: 418.3692, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| CP-409092, Alternative-names: , CAS# 194098-25-4, Formula: C17H19N3O2, MWT: 297.35166, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Alniditan, Alternative-names: Alnitidan, CAS# 152317-89-0, Formula: C17H26N4O, MWT: 302.41454, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Naluzotan, Alternative-names: PRX 00023, CAS# 740873-06-7, Formula: C23H38N4O3S, MWT: 450.6378, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein;Membrane Transporter/Ion Channel, Target: 5-HT Receptor;5-HT Receptor;Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PNU288034, Alternative-names: , CAS# 383199-88-0, Formula: C16H19F2N3O5S, MWT: 403.4009664, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ecopladib, Alternative-names: PLA 725, CAS# 381683-92-7, Formula: C39H33Cl3N2O5S, MWT: 748.11372, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Terbogrel, Alternative-names: BIBV 308SE, CAS# 149979-74-8, Formula: C23H27N5O2, MWT: 405.4928, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Org-10490, Alternative-names: , CAS# 83507-02-2, Formula: C17H19NO, MWT: 253.33886, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Inogatran, Alternative-names: , CAS# 155415-08-0, Formula: C21H38N6O4, MWT: 438.5642, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SB-423562, Alternative-names: , CAS# 351490-27-2, Formula: C26H32N2O4, MWT: 436.54328, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: CaSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AVE-3085, Alternative-names: , CAS# 450348-85-3, Formula: C17H13F2NO3, MWT: 317.2868, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NO Synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Aligeron, Alternative-names: , CAS# 70713-45-0, Formula: C20H24N2, MWT: 292.41796, Solubility: Water, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Memogain, Alternative-names: GLN-1062, CAS# 224169-27-1, Formula: C24H25NO4, MWT: 391.4596, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| RP-54745, Alternative-names: , CAS# 135330-08-4, Formula: C13H12ClNOS2, MWT: 297.82348, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Interleukin Related, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Elucaine, Alternative-names: , CAS# 25314-87-8, Formula: C19H23NO2, MWT: 297.39142, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bucolome, Alternative-names: Paramidin; Paramidine, CAS# 841-73-6, Formula: C14H22N2O3, MWT: 266.33608, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tiopinac, Alternative-names: RS 40974, CAS# 61220-69-7, Formula: C16H12O3S, MWT: 284.32968, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NRC-2694, Alternative-names: , CAS# 936446-61-6, Formula: C24H26N4O3, MWT: 418.4883, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Symetine, Alternative-names: L 16726, CAS# 15599-45-8, Formula: C30H48N2O2, MWT: 468.71432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| RPH-2823, Alternative-names: , CAS# 96558-24-6, Formula: C17H22N8O2, MWT: 370.40898, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| CGP48369, Alternative-names: , CAS# 135689-23-5, Formula: C26H30N6O, MWT: 442.556, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Wy 49051, Alternative-names: , CAS# 113418-56-7, Formula: C28H33N5O3, MWT: 487.59332, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NCX 1000, Alternative-names: , CAS# 401519-96-8, Formula: C38H55NO10, MWT: 685.844, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RP 70676, Alternative-names: , CAS# 136609-26-2, Formula: C25H28N4S, MWT: 416.58162, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| RG-12525, Alternative-names: NID 525, CAS# 120128-20-3, Formula: C25H21N5O2, MWT: 423.46654, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;GPCR/G Protein;Metabolic Enzyme/Protease;NF-κB, Target: PPAR;Leukotriene Receptor;Cytochrome P450;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| AZD-6280, Alternative-names: , CAS# 942436-93-3, Formula: C20H22N4O3, MWT: 366.4137, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| FR 58664, Alternative-names: , CAS# 117321-77-4, Formula: C24H29N3O3, MWT: 407.50536, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ENMD-119, Alternative-names: ENMD 1198; IRC 110160, CAS# 864668-87-1, Formula: C20H25NO2, MWT: 311.418, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt;Metabolic Enzyme/Protease, Target: STAT;STAT;HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| CP-28888, Alternative-names: CP 28888-27, CAS# 69938-75-6, Formula: C40H76N2, MWT: 585.04484, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SKF96067, Alternative-names: , CAS# 115607-61-9, Formula: C21H22N2O2, MWT: 334.41158, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Anipamil, Alternative-names: , CAS# 83200-10-6, Formula: C34H52N2O2, MWT: 520.78888, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SR-31747, Alternative-names: , CAS# 132173-06-9, Formula: C23H34ClN, MWT: 359.97576, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CP-66948, Alternative-names: , CAS# 101189-47-3, Formula: C13H20N6S, MWT: 292.4031, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| YM-58790, Alternative-names: , CAS# 214558-72-2, Formula: C27H32ClN3O2, MWT: 466.01488, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| LCB-2853, Alternative-names: , CAS# 141335-10-6, Formula: C21H24ClNO4S, MWT: 421.93756, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CP671305, Alternative-names: , CAS# 445295-04-5, Formula: C23H19FN2O7, MWT: 454.4045632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AVE-8134, Alternative-names: , CAS# 304025-09-0, Formula: C22H23NO5, MWT: 381.42172, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ru-32514, Alternative-names: , CAS# 90807-98-0, Formula: C18H17N3O2, MWT: 307.3465, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| U-101017, Alternative-names: PNU 101017, CAS# 170568-47-5, Formula: C23H27ClN4O3, MWT: 442.9385, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PCA50941, Alternative-names: , CAS# 136941-85-0, Formula: C30H31N3O10S, MWT: 625.64624, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CP742033, Alternative-names: Dirlotapide;Slentrol, CAS# 481658-94-0, Formula: C40H33F3N4O3, MWT: 674.7102296, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| L-159282, Alternative-names: MK 996, CAS# 157263-00-8, Formula: C30H28N4O3S, MWT: 524.6333, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| RG-12915, Alternative-names: , CAS# 136174-04-4, Formula: C20H25ClN2O2, MWT: 360.8777, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NRA-0160, Alternative-names: , CAS# 204718-47-8, Formula: C24H23F2N3OS, MWT: 439.5207264, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;Adrenergic Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| L-745337, Alternative-names: Thioflosulide, CAS# 158205-05-1, Formula: C16H13F2NO3S2, MWT: 369.4061, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SC-52012, Alternative-names: , CAS# 145643-15-8, Formula: C25H30N4O6, MWT: 482.5289, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| MGB-BP-3, Alternative-names: , CAS# 1000277-08-6, Formula: C36H37N7O4, MWT: 631.72348, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| AZD-5069, Alternative-names: , CAS# 878385-84-3, Formula: C18H22F2N4O5S2, MWT: 476.5179, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| UK51656, Alternative-names: , CAS# 88150-59-8, Formula: C22H28ClN3O6, MWT: 465.92722, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NSP-805, Alternative-names: , CAS# 125068-54-4, Formula: C17H19N3O2, MWT: 297.3517, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| AZD2098, Alternative-names: , CAS# 566203-88-1, Formula: C11H9Cl2N3O3S, MWT: 334.17846, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NEO 376, Alternative-names: , CAS# 496921-73-4, Formula: C20H24ClN3O, MWT: 357.87706, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein;Neuronal Signaling;Membrane Transporter/Ion Channel, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor;GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| ABT-072, Alternative-names: , CAS# 1132936-00-5, Formula: C24H27N3O5S, MWT: 469.55328, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ABT 894, Alternative-names: A 422894.0;Sofiniclin, CAS# 799279-80-4, Formula: C10H11Cl2N3, MWT: 244.1204, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| 2614W94, Alternative-names: , CAS# 205187-35-5, Formula: C15H11F3O4S, MWT: 344.3056496, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| NVX-207, Alternative-names: , CAS# 745020-66-0, Formula: C36H59NO6, MWT: 601.85676, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| TPA 023, Alternative-names: , CAS# 252977-51-8, Formula: C20H22FN7O, MWT: 395.4333832, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ko-3290, Alternative-names: , CAS# 79848-61-6, Formula: C19H25N3O3, MWT: 343.4201, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ER21355, Alternative-names: , CAS# 150452-18-9, Formula: C22H21ClN4O4, MWT: 440.87954, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SM-6586, Alternative-names: , CAS# 103898-38-0, Formula: C26H27N5O5, MWT: 489.5231, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Membrane Transporter/Ion Channel, Target: Na+/Ca2+ Exchanger;Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| AZ-1355, Alternative-names: , CAS# 75451-07-9, Formula: C17H17NO4, MWT: 299.32118, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| RS 8359, Alternative-names: , CAS# 105365-76-2, Formula: C14H12N4O, MWT: 252.27128, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ZD-4190, Alternative-names: , CAS# 413599-62-9, Formula: C19H16BrFN6O2, MWT: 459.2717432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: VEGFR;EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| TA-1801, Alternative-names: , CAS# 88352-44-7, Formula: C17H14ClNO4, MWT: 331.7504, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MK-0249, Alternative-names: , CAS# 862309-06-6, Formula: C23H24F3N3O2, MWT: 431.4507696, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ABT-348, Alternative-names: Ilorasertib, CAS# 1227939-82-3, Formula: C25H21FN6O2S, MWT: 488.5367, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Cell Cycle/DNA Damage;Epigenetics, Target: VEGFR;PDGFR;Aurora Kinase;Aurora Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ABT-670, Alternative-names: , CAS# 630119-43-6, Formula: C19H23N3O2, MWT: 325.4048, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| L162389, Alternative-names: , CAS# 169281-53-2, Formula: C31H38N4O4S, MWT: 562.72282, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| AMG-009, Alternative-names: , CAS# 1027847-67-1, Formula: C26H26Cl2N2O7S, MWT: 581.4648, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MHP 133, Alternative-names: , CAS# 147340-43-0, Formula: C17H20ClN5O3, MWT: 377.8254, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR;AChE;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| DMP 696, Alternative-names: , CAS# 202578-52-7, Formula: C18H21Cl2N5O2, MWT: 410.2976, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AD 0261, Alternative-names: , CAS# 145600-69-7, Formula: C27H31F2N3O, MWT: 451.5513464, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| MBX 102, Alternative-names: JNJ 39659100;Arhalofenate, CAS# 24136-23-0, Formula: C19H17ClF3NO4, MWT: 415.7908, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| F-15599, Alternative-names: , CAS# 635323-95-4, Formula: C19H21ClF2N4O, MWT: 394.846, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MK-0822, Alternative-names: , CAS# 603139-12-4, Formula: C23H26F3N3O3S, MWT: 481.5310496, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Cathepsin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| LM-1484, Alternative-names: , CAS# 197506-02-8, Formula: C28H24N4O3, MWT: 464.51516, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DuP 105, Alternative-names: , CAS# 96800-41-8, Formula: C13H16N2O4S, MWT: 296.34214, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| BGB-102, Alternative-names: JNJ-26483327, CAS# 807640-87-5, Formula: C22H25BrN4O2, MWT: 457.3635, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ZD-1611, Alternative-names: , CAS# 186497-38-1, Formula: C22H24N4O5S, MWT: 456.5148, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| AMP 397, Alternative-names: Becampanel, CAS# 188696-80-2, Formula: C10H11N4O7P, MWT: 330.190702, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| TAS-115, Alternative-names: , CAS# 1190836-34-0, Formula: C27H23FN4O4S, MWT: 518.5593, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR;VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| WQ 2743, Alternative-names: , CAS# 189280-13-5, Formula: C19H15BrF3N5O3, MWT: 498.2533096, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| KCA 757, Alternative-names: MN 001; MN 001 (pharmaceutical); Tipelukast, CAS# 125961-82-2, Formula: C29H38O7S, MWT: 530.67282, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Bz 423, Alternative-names: BZ48, CAS# 216691-95-1, Formula: C27H21ClN2O2, MWT: 440.9208, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NCX899, Alternative-names: , CAS# 690655-41-5, Formula: C23H33N3O8, MWT: 479.52342, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Imexon, Alternative-names: Amplimexon, CAS# 59643-91-3, Formula: C4H5N3O, MWT: 111.102, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CV-159, Alternative-names: , CAS# 86384-98-7, Formula: C31H34N4O7, MWT: 574.6243, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| D-3263, Alternative-names: , CAS# 947257-66-1, Formula: C21H31N3O3, MWT: 373.4891, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| S-2474, Alternative-names: , CAS# 158089-95-3, Formula: C20H31NO3S, MWT: 365.53, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Immunology/Inflammation, Target: 5-Lipoxygenase;COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TDN345, Alternative-names: , CAS# 134069-68-4, Formula: C28H34F2N2O2, MWT: 468.5785664, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| YM 872, Alternative-names: Zonampanel, CAS# 210245-80-0, Formula: C13H9N5O6, MWT: 331.2404, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Wf-516, Alternative-names: , CAS# 310392-94-0, Formula: C25H25Cl2N3O4, MWT: 502.3897, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Serotonin Transporter;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| RS-601, Alternative-names: , CAS# 207987-59-5, Formula: C22H23F6NO4S, MWT: 511.4777392, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| AM 103, Alternative-names: , CAS# 1147872-22-7, Formula: C36H40N3NaO4S, MWT: 633.7753, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: FLAP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| MTPPA, Alternative-names: , CAS# 70991-61-6, Formula: C14H14O2S, MWT: 246.32476, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Benin, Alternative-names: Butocin; Butocine, CAS# 22181-94-8, Formula: C14H19N5O3S, MWT: 337.39736, Solubility: DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| YM17E, Alternative-names: , CAS# 124900-72-7, Formula: C40H56N6O2, MWT: 652.91164, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CNDAC, Alternative-names: , CAS# 135598-68-4, Formula: C10H12N4O4, MWT: 252.22668, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| T 82, Alternative-names: , CAS# 252264-92-9, Formula: C26H29N3O2 . 1/2C4H4O4, MWT: 473.56, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: AChE;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| MHP, Alternative-names: , CAS# 1104874-94-3, Formula: C16H23NO4, MWT: 293.35812, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: SPHK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Levophacetoperane (hydrochloride), Alternative-names: , CAS# 23257-56-9, Formula: C14H20ClNO2, MWT: 269.7671, Solubility: DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: Dopamine Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| (-)-Cephaeline (dihydrochloride), Alternative-names: NSC 32944, CAS# 5853-29-2, Formula: C28H40Cl2N2O4, MWT: 539.5342, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Semotiadil (recemate fumarate), Alternative-names: , CAS# 123388-25-0, Formula: C33H36N2O10S, MWT: 652.71134, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Fumitremorgin C, Alternative-names: 12α-Fumitremorgin C, CAS# 118974-02-0, Formula: C22H25N3O3, MWT: 379.4522, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: BCRP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250ug |
| Lesopitron (dihydrochloride), Alternative-names: E4424, CAS# 132449-89-9, Formula: C15H23Cl3N6, MWT: 393.74232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Tedatioxetine (hydrobromide), Alternative-names: Lu AA 24530 hydrobromide, CAS# 960151-65-9, Formula: C18H22BrNS, MWT: 364.34298, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: Adrenergic Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Cicloprolol (hydrochloride), Alternative-names: , CAS# 63686-79-3, Formula: C18H30ClNO4, MWT: 359.8881, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| CFI-400945 (fumarate), Alternative-names: , CAS# 1616420-30-4, Formula: C37H38N4O7, MWT: 650.7202, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Polo-like Kinase (PLK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| (1R,2S)-VU0155041, Alternative-names: , CAS# 1263273-14-8, Formula: C14H15Cl2NO3, MWT: 316.1798, Solubility: DMSO: ≥ 59 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| O-Propargyl-Puromycin, Alternative-names: O-Propargylpuromycin, CAS# 1416561-90-4, Formula: C24H29N7O5, MWT: 495.5309, Solubility: DMSO: ≥ 31 mg/mL; in vivo: dissolved in DMSO and then dilluted with PBS (final DMSO concertration is 10%)., Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
Miquelianin, Alternative-names: Quercetin 3-O-glucuronide;Quercetin 3-glucuronide, CAS# 22688-79-5, Formula: C21H18O13, MWT: 478.3598, Solubility: DMSO: ≥ 30 mg/mL
, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SB290157 (trifluoroacetate), Alternative-names: , CAS# 1140525-25-2, Formula: C24H29F3N4O6, MWT: 526.5054696, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| FGF-401, Alternative-names: , CAS# 1708971-55-4, Formula: C25H30N8O4, MWT: 506.5569, Solubility: DMSO: 6 mg/mL (Need Ultrasonic), Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Veralipride, Alternative-names: (±)-Veralipride;LIR166, CAS# 66644-81-3, Formula: C17H25N3O5S, MWT: 383.4625, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Puromycin (Dihydrochloride), Alternative-names: CL13900 dihydrochloride, CAS# 58-58-2, Formula: C22H31Cl2N7O5, MWT: 544.43144, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| HTS01037, Alternative-names: , CAS# 682741-29-3, Formula: C14H11NO5S2, MWT: 337.37084, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: FABP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| STAT5-IN-1, Alternative-names: , CAS# 285986-31-4, Formula: C16H11N3O3, MWT: 293.27684, Solubility: DMSO: ≥23.0 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TD-198946, Alternative-names: , CAS# 364762-86-7, Formula: C27H22N4O3S, MWT: 482.5536, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Paprotrain, Alternative-names: , CAS# 57046-73-8, Formula: C16H11N3, MWT: 245.27864, Solubility: DMSO: ≥100 mg/mL, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: Kinesin;Kinesin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| FITM, Alternative-names: , CAS# 932737-65-0, Formula: C18H18FN5OS, MWT: 371.4318232, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| AU1235, Alternative-names: , CAS# 1338780-86-1, Formula: C17H19F3N2O, MWT: 324.3407696, Solubility: DMSO: 6 mg/mL (need ultrasonic), Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Dihexa, Alternative-names: PNB-0408;N-hexanoic-Try-Ile-(6)-amino hexanoic amide;Hexanoyl-Tyr-Ile-Ahx-NH2, CAS# 1401708-83-5, Formula: C27H44N4O5, MWT: 504.66206, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| GW4869, Alternative-names: , CAS# 6823-69-4, Formula: C30H30Cl2N6O2, MWT: 577.5042, Solubility: DMSO: 0.044 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| DM4, Alternative-names: , CAS# 796073-69-3, Formula: C38H54ClN3O10S, MWT: 780.3674, Solubility: DMSO: 10 mM, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SBC-110736, Alternative-names: , CAS# 1629166-02-4, Formula: C26H27N3O2, MWT: 413.51148, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| UAMC00039 (dihydrochloride), Alternative-names: , CAS# 697797-51-6, Formula: C16H26Cl3N3O, MWT: 382.75614, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| ML-18, Alternative-names: , CAS# 1422269-30-4, Formula: C32H35N5O5, MWT: 569.6508, Solubility: DMSO: ≥100 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Bombesin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| (±)-Equol, Alternative-names: , CAS# 94105-90-5, Formula: C15H14O3, MWT: 242.26986, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| LDC4297, Alternative-names: , CAS# 1453834-21-3, Formula: C23H28N8O, MWT: 432.5214, Solubility: DMSO: ≥60 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Veledimex (racemate), Alternative-names: RG-115932 racemate;INXN-1001 racemate, CAS# 755013-59-3, Formula: C27H38N2O3, MWT: 438.60222, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;Metabolic Enzyme/Protease, Target: Interleukin Related;Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NVP-CGM097 (sulfate), Alternative-names: CGM097 sulfate, CAS# 1313367-56-4, Formula: C38H49ClN4O8S, MWT: 757.33566, Solubility: H<sub>2</sub>O: ≥ 140 mg/mL, Clinical_Information: Phase 1, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Spectinomycin (dihydrochloride pentahydrate), Alternative-names: Spectinomycin hydrochloride hydrate, CAS# 22189-32-8, Formula: C14H36Cl2N2O12, MWT: 495.34784, Solubility: H<sub>2</sub>O: 60 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| BMS-309403, Alternative-names: , CAS# 300657-03-8, Formula: C31H26N2O3, MWT: 474.54974, Solubility: DMSO: ≥62.5 mg/mL , Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: FABP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NCGC00244536, Alternative-names: KDM4B Inhibitor B3, CAS# 2003260-55-5, Formula: C25H22N2O2, MWT: 382.45438, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| LY2510924, Alternative-names: , CAS# 1088715-84-7, Formula: C62H88N14O10, MWT: 1189.45, Solubility: DMSO: ≥125 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Canthaxanthin, Alternative-names: E 161g;all-trans-Canthaxanthin, CAS# 514-78-3, Formula: C40H52O2, MWT: 564.8397, Solubility: DMSO: 5 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| BQCA, Alternative-names: , CAS# 338747-41-4, Formula: C18H15NO4, MWT: 309.316, Solubility: , Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PTP1B-IN-2, Alternative-names: , CAS# 1919853-46-5, Formula: C34H36N2O9S2, MWT: 680.7877, Solubility: DMSO: ≥100 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Cytosporone B, Alternative-names: Csn-B;Dothiorelone G, CAS# 321661-62-5, Formula: C18H26O5, MWT: 322.396, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| KKL-10, Alternative-names: , CAS# 952849-76-2, Formula: C14H10BrN3O2S, MWT: 364.2171, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| KKL-35, Alternative-names: , CAS# 865285-29-6, Formula: C15H9ClFN3O2, MWT: 317.7022632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Morusin, Alternative-names: Mulberrochromene, CAS# 62596-29-6, Formula: C25H24O6, MWT: 420.4545, Solubility: DMSO: ≥ 125 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt;NF-κB, Target: STAT;STAT;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Kuwanon A, Alternative-names: , CAS# 62949-77-3, Formula: C25H24O6, MWT: 420.4545, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NO Synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| THK5351, Alternative-names: , CAS# 1707147-26-9, Formula: C18H18FN3O2, MWT: 327.3528232, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Avacopan, Alternative-names: CCX168, CAS# 1346623-17-3, Formula: C33H35F4N3O2, MWT: 581.6435, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Immunology/Inflammation, Target: Complement System, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AX-15836, Alternative-names: , CAS# 2035509-96-5, Formula: C32H40N8O5S, MWT: 648.7756, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| TM5275 (sodium), Alternative-names: , CAS# 1103926-82-4, Formula: C28H28ClN3NaO5+, MWT: 544.9813, Solubility: DMSO: ≥100 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: PAI-1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BAR502, Alternative-names: , CAS# 1612191-86-2, Formula: C25H44O3, MWT: 392.61506, Solubility: DMSO: 10mM, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;GPCR/G Protein, Target: FXR;GPCR19, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Senexin A, Alternative-names: , CAS# 1366002-50-7, Formula: C17H14N4, MWT: 274.3199, Solubility: DMSO: ≥100 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AM-2099, Alternative-names: , CAS# 1443373-17-8, Formula: C19H13F3N4O3S2, MWT: 466.4567, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| WAY-600, Alternative-names: , CAS# 1062159-35-6, Formula: C28H30N8O, MWT: 494.5908, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Osilodrostat, Alternative-names: LCI699, CAS# 928134-65-0, Formula: C13H10FN3, MWT: 227.237, Solubility: DMSO: ≥83.3 mg/mL , Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Mineralocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| T807, Alternative-names: , CAS# 1415379-56-4, Formula: C16H10FN3, MWT: 263.2691032, Solubility: DMSO: ≥16.6 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GSK2982772, Alternative-names: , CAS# 1622848-92-3, Formula: C20H19N5O3, MWT: 377.39656, Solubility: DMSO: ≥100 mg/mL, Clinical_Information: Phase 2, Pathway: Apoptosis, Target: RIP kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| HI-TOPK-032, Alternative-names: , CAS# 487020-03-1, Formula: C20H11N5OS, MWT: 369.39924, Solubility: DMSO: ≥7.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| KIRA6, Alternative-names: , CAS# 1589527-65-0, Formula: C28H25F3N6O, MWT: 518.5329, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: IRE1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Fmoc-Thr[GalNAc(Ac)3-α-D]-OH, Alternative-names: Fmoc-Thr(Ac₃AcNH-α-Gal)-OH, CAS# 116783-35-8, Formula: C33H38N2O13, MWT: 670.66042, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| PIM inhibitor 1 (phosphate), Alternative-names: , CAS# 2088852-47-3, Formula: C26H29F3N5O7P, MWT: 611.5067316, Solubility: DMSO: 5 mg/mL , Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Imidacloprid, Alternative-names: , CAS# 138261-41-3, Formula: C9H10ClN5O2, MWT: 255.661, Solubility: DMSO: ≥300 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Cholesteryl behenate, Alternative-names: Cholesteryl docosanoate;Cholesterol behenate, CAS# 61510-09-6, Formula: C49H88O2, MWT: 709.22182, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| GSK9311, Alternative-names: , CAS# 1923851-49-3, Formula: C24H31N5O3, MWT: 437.5346, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| FPH2, Alternative-names: BRD-9424, CAS# 957485-64-2, Formula: C14H16ClN5O2S, MWT: 353.8271, Solubility: DMSO: ≥125 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| TM5441, Alternative-names: , CAS# 1190221-43-2, Formula: C21H17ClN2O6, MWT: 428.82248, Solubility: DMSO: ≥300 mg/mL , Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: PAI-1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| BMT-145027, Alternative-names: , CAS# 2018282-44-3, Formula: C23H14ClF3N4, MWT: 438.8322696, Solubility: DMSO: ≥2.4 mg/mL (need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MSC2530818, Alternative-names: , CAS# 1883423-59-3, Formula: C18H17ClN4O, MWT: 340.80678, Solubility: DMSO: ≥125 mg/mL , Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SMI-16a, Alternative-names: PIM1/2 Kinase Inhibitor VI, CAS# 587852-28-6, Formula: C13H13NO3S, MWT: 263.31222, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Naltrindole (hydrochloride), Alternative-names: , CAS# 111469-81-9, Formula: C26H27ClN2O3, MWT: 450.95718, Solubility: DMSO: ≥188 mg/mL , Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Heparan Sulfate, Alternative-names: , CAS# 9050-30-0, Formula: C12H19NO20S3 (monomer), MWT: 1000, Solubility: H<sub>2</sub>O: 47.1 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Protein Tyrosine Kinase/RTK, Target: Wnt;FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NVS-PAK1-1, Alternative-names: , CAS# 1783816-74-9, Formula: C23H25ClF3N5O, MWT: 479.9257, Solubility: DMSO: ≥125 mg/mL , Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Protein Tyrosine Kinase/RTK, Target: PKA;PKA, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Clenbuterol (hydrochloride), Alternative-names: , CAS# 21898-19-1, Formula: C12H19Cl3N2O, MWT: 313.6511, Solubility: DMSO: ≥ 125 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| PSB-12062, Alternative-names: , CAS# 55476-47-6, Formula: C19H15NO3S, MWT: 337.3923, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: P2X Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bafilomycin A1, Alternative-names: (-)-Bafilomycin A1, CAS# 88899-55-2, Formula: C35H58O9, MWT: 622.8296, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100ug |
| SU1498, Alternative-names: AG 1498;Tyrphostin SU 1498, CAS# 168835-82-3, Formula: C25H30N2O2, MWT: 390.5179, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ASP-9521, Alternative-names: , CAS# 1126084-37-4, Formula: C19H26N2O3, MWT: 330.4213, Solubility: DMSO: ≥ 300 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Protein degrader 1 (hydrochloride), Alternative-names: , CAS# 1448189-80-7, Formula: C22H31ClN4O3S, MWT: 467.02454, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PROTAC, Target: PROTAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| GC376, Alternative-names: , CAS# 1416992-39-6, Formula: C21H30N3NaO8S, MWT: 507.53, Solubility: DMSO; In Vivo: GC376 is dissolved in 10% ethanol and 90% PEG-400., Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Phosphoramidon (Disodium), Alternative-names: , CAS# 164204-38-0, Formula: C23H32N3Na2O10P, MWT: 587.46758056, Solubility: H<sub>2</sub>O: ≥ 140 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE);Neprilysin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| INF39, Alternative-names: , CAS# 866028-26-4, Formula: C12H13ClO2, MWT: 224.68342, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NOD-like Receptor (NLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| AD80, Alternative-names: , CAS# 1384071-99-1, Formula: C22H19F4N7O, MWT: 473.4261728, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;MAPK/ERK Pathway;MAPK/ERK Pathway, Target: Src;Raf;Ribosomal S6 Kinase (RSK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ravuconazole, Alternative-names: BMS-207147;ER-30346, CAS# 182760-06-1, Formula: C22H17F2N5OS, MWT: 437.4650864, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Capromorelin (Tartrate), Alternative-names: CP 424391-18, CAS# 193273-69-7, Formula: C32H41N5O10, MWT: 655.69544, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GHSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Veledimex (S enantiomer), Alternative-names: INXN-1001 S enantiome;RG-115932 S enantiome, CAS# 1093131-03-3, Formula: C27H38N2O3, MWT: 438.60222, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;Metabolic Enzyme/Protease, Target: Interleukin Related;Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Mebeverine (hydrochloride), Alternative-names: , CAS# 2753-45-9, Formula: C25H36ClNO5, MWT: 466.01, Solubility: DMSO: ≥ 155 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Prostaglandin E2, Alternative-names: PGE2, CAS# 363-24-6, Formula: C20H32O5, MWT: 352.46508, Solubility: DMSO: ≥ 10 mM, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| ML213, Alternative-names: , CAS# 489402-47-3, Formula: C17H23NO, MWT: 257.37062, Solubility: DMSO: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Complanatoside A, Alternative-names: , CAS# 146501-37-3, Formula: C27H30O18, MWT: 642.5163, Solubility: DMSO≥ 35.7 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Azobenzene, Alternative-names: , CAS# 103-33-3, Formula: C12H10N2, MWT: 182.2212, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| SK1-IN-1, Alternative-names: , CAS# 1218816-71-7, Formula: C22H30N4O3, MWT: 398.4986, Solubility: DMSO：10 mM, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: SPHK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Z-IETD-FMK, Alternative-names: , CAS# 210344-98-2, Formula: C30H43FN4O11, MWT: 654.6810232, Solubility: DMSO: ≥125 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Caspase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Rucaparib (Camsylate), Alternative-names: , CAS# 1859053-21-6, Formula: C29H34FN3O5S, MWT: 555.6607632, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: Phase 3, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| A2A receptor antagonist 1, Alternative-names: , CAS# 443103-97-7, Formula: C16H12FN5O, MWT: 309.2978, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| BW 245C, Alternative-names: , CAS# 72814-32-5, Formula: C19H32N2O5, MWT: 368.46778, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Magnolin, Alternative-names: , CAS# 31008-18-1, Formula: C23H28O7, MWT: 416.4642, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Belizatinib, Alternative-names: TSR-011, CAS# 1357920-84-3, Formula: C33H44FN5O3, MWT: 577.7325, Solubility: DMSO: ≥ 300 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: Trk Receptor;ALK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| GSK2837808A, Alternative-names: , CAS# 1445879-21-9, Formula: C31H25F2N5O7S, MWT: 649.6213, Solubility: DMSO: ≥100 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Lactate Dehydrogenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Cambinol, Alternative-names: , CAS# 14513-15-6, Formula: C21H16N2O2S, MWT: 360.429, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: Sirtuin;Sirtuin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Complanatuside, Alternative-names: , CAS# 116183-66-5, Formula: C28H32O16, MWT: 624.5441, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| UNC-926, Alternative-names: , CAS# 1184136-10-4, Formula: C16H21BrN2O, MWT: 337.2547, Solubility: DMSO: ≥155 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| A-1165442, Alternative-names: , CAS# 1221443-94-2, Formula: C22H20ClF2N3O2, MWT: 431.8629, Solubility: DMSO：10 mM, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 27-Hydroxycholesterol, Alternative-names: , CAS# 20380-11-4, Formula: C27H46O2, MWT: 402.65294, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others;Metabolic Enzyme/Protease, Target: Estrogen Receptor/ERR;LXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Levcromakalim, Alternative-names: (-)-Cromakalim;BRL 38227, CAS# 94535-50-9, Formula: C16H18N2O3, MWT: 286.32572, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Dexamethasone 9,11-epoxide, Alternative-names: , CAS# 24916-90-3, Formula: C22H28O5, MWT: 372.4547, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| Avitinib (maleate), Alternative-names: , CAS# 1557268-88-8, Formula: C30H30FN7O6, MWT: 603.6009032, Solubility: DMSO: ≥300 mg/mL , Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RN-18, Alternative-names: , CAS# 431980-38-0, Formula: C20H16N2O4S, MWT: 380.41704, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CB-7921220, Alternative-names: , CAS# 115453-99-1, Formula: C14H12N2O2, MWT: 240.25728, Solubility: DMSO: ≥100 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Belotecan (hydrochloride), Alternative-names: CKD-602, CAS# 213819-48-8, Formula: C25H28ClN3O4, MWT: 469.96052, Solubility: DMSO: ≥50 mg/mL , Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CCT251236, Alternative-names: , CAS# 1693731-40-6, Formula: C32H32N4O5, MWT: 552.62028, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| O-desmethyl Mebeverine alcohol (hydrochloride), Alternative-names: , CAS# 856620-39-8, Formula: C15H26ClNO2, MWT: 287.82544, Solubility: H<sub>2</sub>O: ≥ 75 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NSC781406, Alternative-names: , CAS# 1676893-24-5, Formula: C29H27F2N5O5S2, MWT: 627.682, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;PI3K/Akt/mTOR, Target: PI3K;mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Acriflavine, Alternative-names: , CAS# 8048-52-0, Formula: C14H14ClN3, MWT: 259.73, Solubility: DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| SB756050, Alternative-names: , CAS# 447410-57-3, Formula: C21H28N2O8S2, MWT: 500.58562, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: Phase 1, Pathway: GPCR/G Protein, Target: GPCR19, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ADX88178, Alternative-names: , CAS# 1235318-89-4, Formula: C12H12N6S, MWT: 272.3289, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 6-Biopterin, Alternative-names: L-Biopterin, CAS# 22150-76-1, Formula: C9H11N5O3, MWT: 237.21534, Solubility: DMSO: 6 mg/mL (Need Ultrasonic) , Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NO Synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Glycerol, Alternative-names: Glycerin, CAS# 56-81-5, Formula: C3H8O3, MWT: 92.09382, Solubility: DMSO: ≥300 mg/mL , Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Citric acid, Alternative-names: , CAS# 77-92-9, Formula: C6H8O7, MWT: 192.1235, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: Launched, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| DHBP (dibromide), Alternative-names: Diheptylviologen dibromide, CAS# 6159-05-3, Formula: C24H38Br2N2, MWT: 514.37992, Solubility: DMSO: ≥30 mg/mL , Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Isoguvacine (hydrochloride), Alternative-names: , CAS# 68547-97-7, Formula: C6H10ClNO2, MWT: 163.6021, Solubility: DMSO: ≥30 mg/mL , Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Cariporide, Alternative-names: HOE-642, CAS# 159138-80-4, Formula: C12H17N3O3S, MWT: 283.3467, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 24-Hydroxycholesterol, Alternative-names: , CAS# 30271-38-6, Formula: C27H46O2, MWT: 402.65294, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Membrane Transporter/Ion Channel;Neuronal Signaling, Target: LXR;iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| CNQX, Alternative-names: FG9065, CAS# 115066-14-3, Formula: C9H4N4O4, MWT: 232.15246, Solubility: DMSO: ≥30 mg/mL , Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CYR-101, Alternative-names: MIN-101;MT-210, CAS# 359625-79-9, Formula: C22H23FN2O2, MWT: 366.4286, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor;Sigma Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Cadazolid, Alternative-names: ACT-179811, CAS# 1025097-10-2, Formula: C29H29F2N3O8, MWT: 585.5527, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PI3Kδ-IN-2, Alternative-names: , CAS# 1702816-75-8, Formula: C28H37FN6O5S, MWT: 588.6939832, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LY3214996, Alternative-names: , CAS# 1951483-29-6, Formula: C22H27N7O2S, MWT: 453.56048, Solubility: DMSO: 15 mg/mL, Clinical_Information: Phase 1, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Pirenzepine (dihydrochloride), Alternative-names: LS519, CAS# 29868-97-1, Formula: C19H23Cl2N5O2, MWT: 424.3242, Solubility: DMSO: 10 mM, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| RG3039, Alternative-names: PF-06687859, CAS# 1005504-62-0, Formula: C21H23Cl2N5O, MWT: 432.34622, Solubility: DMSO: 6 mg/mL (Need Ultrasonic and Warming) , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Liquiritigenin, Alternative-names: 4',7-Dihydroxyflavanone, CAS# 578-86-9, Formula: C15H12O4, MWT: 256.2534, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| (2-Hydroxypropyl)-β-cyclodextrin, Alternative-names: Hydroxypropyl betadex;Hydroxypropyl-β-cyclodextrin;HP-β-CD, CAS# 128446-35-5, Formula: N/A, MWT: 1000, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: No Development Reported, Pathway: Apoptosis;Autophagy, Target: Apoptosis;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| LTX-315, Alternative-names: K-K-W-W-K-K-W-Dip-K-NH2, CAS# 1345407-05-7, Formula: C78H106N18O9, MWT: 1439.79144, Solubility: , Clinical_Information: Phase 1, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Oxamflatin, Alternative-names: Metacept-3, CAS# 151720-43-3, Formula: C17H14N2O4S, MWT: 342.36906, Solubility: DMSO: ≥125 mg/mL , Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Vericiguat, Alternative-names: BAY1021189, CAS# 1350653-20-1, Formula: C19H16F2N8O2, MWT: 426.3795, Solubility: DMSO: ≥150 mg/mL , Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: Guanylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Omtriptolide, Alternative-names: , CAS# 195883-06-8, Formula: C24H28O9, MWT: 460.47372, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 1400W (Dihydrochloride), Alternative-names: , CAS# 214358-33-5, Formula: C10H17Cl2N3, MWT: 250.1681, Solubility: DMSO: ≥100 mg/mL , Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NO Synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Rauwolscine (hydrochloride), Alternative-names: α-Yohimbine hydrochloride;Corynanthidine hydrochloride;Isoyohimbine hydrochloride, CAS# 6211-32-1, Formula: C21H27ClN2O3, MWT: 390.90368, Solubility: DMSO: 6 mg/mL (Need Altrasonic), Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Hypotaurine, Alternative-names: 2-Aminoethanesulfinic acid, CAS# 300-84-5, Formula: C2H7NO2S, MWT: 109.1475, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Banoxantrone (dihydrochloride), Alternative-names: AQ4N dihydrochloride, CAS# 252979-56-9, Formula: C22H30Cl2N4O6, MWT: 517.4028, Solubility: H<sub>2</sub>O: 25 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NCT-503, Alternative-names: , CAS# 1916571-90-8, Formula: C20H23F3N4S, MWT: 408.4836296, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TAK-659 (hydrochloride), Alternative-names: , CAS# 1952251-28-3, Formula: C17H22ClFN6O, MWT: 380.8475832, Solubility: DMSO: 10 mM (Need Ultrasonic and Warming), Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Syk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| QS11, Alternative-names: , CAS# 944328-88-5, Formula: C36H33N5O2, MWT: 567.6795, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DAPI (dihydrochloride), Alternative-names: 4',6-Diamidino-2-phenylindole dihydrochloride, CAS# 28718-90-3, Formula: C16H17Cl2N5, MWT: 350.24568, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Diphenyl Blue, Alternative-names: Direct Blue 14, CAS# 72-57-1, Formula: C34H24N6Na4O14S4, MWT: 960.80523712, Solubility: H<sub>2</sub>O: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| Cerulenin, Alternative-names: , CAS# 17397-89-6, Formula: C12H17NO3, MWT: 223.2683, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Fatty Acid Synthase (FAS), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ac-Gly-BoroPro, Alternative-names: , CAS# 886992-99-0, Formula: C8H15BN2O4, MWT: 214.0267, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Talabostat, Alternative-names: PT100, CAS# 149682-77-9, Formula: C9H19BN2O3, MWT: 214.0698, Solubility: DMSO: ≥40 mg/mL , Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Banoxantrone (D12 dihydrochloride), Alternative-names: AQ4N D12 dihydrochloride, CAS# 1562066-98-1, Formula: C22H18D12Cl2N4O6, MWT: 529.476741336, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Banoxantrone (D12), Alternative-names: AQ4N D12, CAS# 1562067-05-3, Formula: C22H16D12N4O6, MWT: 456.554861336, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| β-Apo-13-carotenone, Alternative-names: D'Orenone, CAS# 17974-57-1, Formula: C18H26O, MWT: 258.39844, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| TMP195, Alternative-names: , CAS# 1314891-22-9, Formula: C23H19F3N4O3, MWT: 456.4172, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Procion Blue HB, Alternative-names: Reactive Blue 2, CAS# 12236-82-7, Formula: C29H20ClN7O11S3, MWT: 774.16, Solubility: DMSO: ≥110 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NucPE1, Alternative-names: Nuclear Peroxy Emerald 1, CAS# 1404091-23-1, Formula: C29H30BNO5, MWT: 483.3632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| IRL-1620, Alternative-names: DEEAVYFAHLDIIW, CAS# 142569-99-1, Formula: C86H117N17O27, MWT: 1820.94688, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| HA Peptide, Alternative-names: Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala;YPYDVPDYA, CAS# 92000-76-5, Formula: C53H67N9O17, MWT: 1102.14918, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Sfllrnpndkyepf, Alternative-names: Ser-Phe-Leu-Leu-Arg-Asn-Pro-Asn-Asp-Lys-Tyr-Glu-Pro-Phe;SFLLRNPNDKYEPF, CAS# 137339-65-2, Formula: C81H118N20O23, MWT: 1739.92382, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Astressin, Alternative-names: d-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-NLE-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Glu-Ala-His-Lys-Asn-Arg-Lys-Leu-NLE-Glu-Ile-Ile-NH2;{d-PHE}HLLREVLEARAEQLAQEAHKNRKLEII-NH2, CAS# 170809-51-5, Formula: C161H269N49O42, MWT: 3563.16166, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Mas7, Alternative-names: Ile-Asn-Leu-Lys-Ala-Leu-Ala-Ala-Leu-Ala-Lys-Ala-Leu-Leu-NH2;INLKALAALAKALL-NH2, CAS# 145854-59-7, Formula: C67H124N18O15, MWT: 1421.81306, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Xenin, Alternative-names: Met-Leu-Thr-Lys-Phe-Glu-Thr-Lys-Ser-Ala-Arg-Val-Lys-Gly-Leu-Ser-Phe-His-Pro-Lys-Arg-Pro-Trp-Ile-Leu;MLTKFETKSARVKGLSFHPKRPWIL, CAS# 144092-28-4, Formula: C139H224N38O32S, MWT: 2971.56626, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 1, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| p2Ca, Alternative-names: Leu-Ser-Pro-Phe-Pro-Phe-Asp-Leu;LSPFPFDL, CAS# 142606-55-1, Formula: C47H66N8O12, MWT: 935.07334, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Indolicidin, Alternative-names: Ile-Leu-Pro-Trp-Lys-Trp-Pro-Trp-Trp-Pro-Trp-Arg-Arg-NH2;ILPWKWPWWPWRR-NH2, CAS# 140896-21-5, Formula: C100H132N26O13, MWT: 1906.28448, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| Galantide, Alternative-names: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met;GWTLNSAGYLLGPQQFFGLM-NH2, CAS# 138579-66-5, Formula: C104H151N25O26S, MWT: 2199.52864, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Neuropeptide Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| Dermaseptin, Alternative-names: Ala-Leu-Trp-Lys-Thr-Met-Leu-Lys Lys-Leu-Gly-Thr-Met-Ala-Leu-His Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala Ala-Ala-Asp-Thr-Ile-Ser-Gln-Gly Thr-Gln;ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ, CAS# 136212-91-4, Formula: C152H257N43O44S2, MWT: 3455.1, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Anti-infection;Anti-infection, Target: Fungal;Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| Exendin (9-39), Alternative-names: Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2;DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, CAS# 133514-43-9, Formula: C149H234N40O47S, MWT: 3369.75706, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 4, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| β-Amyloid (1-40), Alternative-names: Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val;DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, CAS# 131438-79-4, Formula: C194H295N53O58S, MWT: 4329.82, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| N-Acetyl-Ser-Asp-Lys-Pro, Alternative-names: Ser-Asp-Lys-Pro;SDKP, CAS# 127103-11-1, Formula: C20H33N5O9, MWT: 487.50412, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Melanotan (MT)-II, Alternative-names: Ac-NLE-Asp-His-D-Phe-Arg-Trp-Lys-NH2;Ac-{NLE}DH{D-PHE}RWK-NH2, CAS# 121062-08-6, Formula: C50H69N15O9, MWT: 1024.17796, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Myomodulin, Alternative-names: Pro-Met-Ser-Met-Leu-Arg-Leu;PMSMLRL, CAS# 110570-93-9, Formula: C36H67N11O8S2, MWT: 846.11608, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Membrane Transporter/Ion Channel;Membrane Transporter/Ion Channel, Target: Calcium Channel;Potassium Channel;Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Magainin 1, Alternative-names: Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Gly-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Lys-Ser;GIGKFLHSAGKFGKAFVGEIMKS, CAS# 108433-99-4, Formula: C112H177N29O28S, MWT: 2409.84628, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Anti-infection;Anti-infection, Target: Fungal;Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| Magainin 2, Alternative-names: Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Lys-Lys-Phe-Gly-Lys Ala-Phe-Val-Gly-Glu-Ile-Met-Asn-Ser;GIGKFLHSAKKFGKAFVGEIMNS, CAS# 108433-95-0, Formula: C114H180N30O29S, MWT: 2466.8976, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Anti-infection;Anti-infection, Target: Fungal;Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| Syntide 2, Alternative-names: Pro-Leu-Ala-Arg-Thr-Leu-Ser-Val-Ala-Gly-Leu-Pro-Gly-Lys-Lys;PLARTLSVAGLPGKK, CAS# 108334-68-5, Formula: C68H122N20O18, MWT: 1507.81948, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: CaMK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Peptide T, Alternative-names: D-Ala-Ser-Thr-Thr-Thr-Asn-Tyr-Thr;{D-ALA}STTTNY, CAS# 106362-32-7, Formula: C35H55N9O16, MWT: 857.8619, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein;Anti-infection, Target: Bradykinin Receptor;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Histatin 5, Alternative-names: Asp-Ser-His-Ala-Lys-Arg-His-His-Gly-Tyr-Lys-Arg-Lys-Phe-His-Glu-Lys-His-His-Ser-His-Arg-Gly-Tyr;DSHAKRHHGYKRKFHEKHHSHRGY, CAS# 104339-66-4, Formula: C133H195N51O33, MWT: 3036.2933, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| PGLa, Alternative-names: Gly-Met-Ala-Ser-Lys-Ala-Gly-Ala-Ile-Ala-Gly-Lys-Ile Ala-Lys-Val-Ala-Leu-Lys-Ala-Leu-NH2;GMASKAGAIAGKIAKVALKAL-NH2, CAS# 102068-15-5, Formula: C88H162N26O22S, MWT: 1968.45388, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| Proctolin, Alternative-names: Arg-Tyr-Leu-Pro-Thr;RYLPT, CAS# 100930-02-7, Formula: C30H48N8O8, MWT: 648.75092, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Gastric Inhibitory Peptide (GIP), human, Alternative-names: Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, CAS# 100040-31-1, Formula: C226H338N60O66S, MWT: 4983.6, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| RGD, Alternative-names: Gly-Cys-Gly-Tyr-Gly-Arg-Gly-Asp-Ser-Pro-Gly;GCGYGRGDSPG, CAS# 99896-85-2, Formula: C12H22N6O6, MWT: 346.33968, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 2, Pathway: TGF-beta/Smad, Target: TGF-β Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| [Leu5]-Enkephalin, Alternative-names: Tyr-Gly-Gly-Phe-Leu;YGGFL;ICI-114740;Leu-enkephalin;Leucine enkephalin;Leucyl-enkephalin, CAS# 58822-25-6, Formula: C28H37N5O7, MWT: 555.62268, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| LSKL, Inhibitor of Thrombospondin (TSP-1), Alternative-names: Leu-Ser-Lys-Leu;LSKL, CAS# 283609-79-0, Formula: C21H42N6O5, MWT: 458.59538, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad, Target: TGF-β Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| c-Myc Peptide, Alternative-names: Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu;EQKLISEEDL, CAS# 145646-22-6, Formula: C51H86N12O21, MWT: 1203.29634, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Crosstide, Alternative-names: Gly-Arg-Pro-Arg-Thr-Ser-Ser-Phe-Ala-Glu-Gly;GRPRTSSFAEG, CAS# 171783-05-4, Formula: C48H77N17O17, MWT: 1164.22868, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Hemorphin-7, Alternative-names: Tyr-Pro-Trp-Thr-Gln-Arg-Phe;YPWTQRF, CAS# 152685-85-3, Formula: C49H64N12O11, MWT: 997.10626, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;Metabolic Enzyme/Protease, Target: Opioid Receptor;Opioid Receptor;Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Parasin I, Alternative-names: Lys-Gly-Arg-Gly-Lys-Gln-Gly-Gly-Lys-Val-Arg-Ala-Lys-Ala-Lys-Thr-Arg-Ser-Ser;KGRGKQGGKVRAKAKTRSS, CAS# 219552-69-9, Formula: C82H154N34O24, MWT: 2000.31356, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Peptide 401, Alternative-names: Ile-Lys-Cys-Asn-Cys-Lys-Arg-His-Val-Ile-Lys-Pro-His-Ile-Cys-Arg-Lys-Ile-Cys-Gly-Lys-Asn-NH2;IKCNCKRHVIKPHICRKICGKN-NH2, CAS# 32908-73-9, Formula: C110H192N40O24S4, MWT: 2587.215, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Protirelin, Alternative-names: Synthetic thyrotropin-releasing factor; Synthetic thyrotropin-releasing hormone; TRF; TRH; TSH-RF;pGlu-His-Pro-NH2;{pGLU}HP-NH2, CAS# 24305-27-9, Formula: C16H22N6O4, MWT: 362.3837, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Enfuvirtide, Alternative-names: Ac-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-Trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe-NH2;Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2, CAS# 159519-65-0, Formula: C204H301N51O64, MWT: 4491.88, Solubility: DMSO, Clinical_Information: Phase 4, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Examorelin, Alternative-names: Hexarelin;His-D-2-ME-Trp-Ala-Trp-d-Phe-Lys-NH2;H{D-2-ME-TRP}AW{d-PHE}K-NH2, CAS# 140703-51-1, Formula: C47H58N12O6, MWT: 887.0402, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GHSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Katacalcin, Alternative-names: PDN 21;Asp-Met-Ser-Ser-Asp-Leu-Glu-Arg-Asp-His-Arg-Pro-His-Val-Ser-Met-Pro-Gln-Asn-Ala-Asn;DMSSDLERDHRPHVSMPQNAN, CAS# 85916-47-8, Formula: C97H154N34O36S2, MWT: 2436.597, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Amyloid beta-peptide(25-35), Alternative-names: Aβ25-35;β-Amyloid peptide(25-35);Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met;GSNKGAIIGLM, CAS# 131602-53-4, Formula: C45H81N13O14S, MWT: 1060.268, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Amyloid-β, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SAMS, Alternative-names: His-Met-Arg-Ser-Ala-Met-Ser-Gly-Leu-His-Leu-Val-Lys-Arg-Arg-NH2;HMRSAMSGLHLVKRR-NH2, CAS# 125911-68-4, Formula: C74H131N29O18S2, MWT: 1779.145, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Epigenetics;PI3K/Akt/mTOR, Target: AMPK;AMPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Endomorphin 1, Alternative-names: Tyr-Pro-Trp-Phe-NH2;YPWF-NH2, CAS# 189388-22-5, Formula: C34H38N6O5, MWT: 610.70272, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Substance P, Alternative-names: Neurokinin P;Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2;RPKPQQFFGLM-NH2, CAS# 33507-63-0, Formula: C63H98N18O13S, MWT: 1347.63002, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Endothelin 1 (swine, human), Alternative-names: Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp;CSCSSLMDKECVYFCHLDIIW, CAS# 117399-94-7, Formula: C109H159N25O32S5, MWT: 2491.90206, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Endomorphin 2, Alternative-names: Tyr-Pro-Phe-Phe-NH2;YPFF-NH2, CAS# 141801-26-5, Formula: C32H37N5O5, MWT: 571.66668, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| A 779, Alternative-names: Asp-Arg-Val-Tyr-Ile-His-d-Ala;DRVYIH{d-ALA}, CAS# 159432-28-7, Formula: C39H60N12O11, MWT: 872.9675, Solubility: DMSO: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Melittin, Alternative-names: Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-Trp-Ile-Lys-Arg-Lys-Arg-Gln-Gln-NH2;GIGAVLKVLTTGLPALISWIKRKRQQ-NH2, CAS# 20449-79-0, Formula: C131H229N39O31, MWT: 2846.46266, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Neurotensin, Alternative-names: PYR-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu;Pyr-LYENKPRRPYIL, CAS# 39379-15-2, Formula: C78H121N21O20, MWT: 1672.92, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Neurotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Neurokinin A(4-10), Alternative-names: Asp-Ser-Phe-Val-Gly-Leu-Met-NH2;DSFVGLM-NH2, CAS# 97559-35-8, Formula: C34H54N8O10S, MWT: 766.90516, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Kallikrein Inhibitor, Alternative-names: AC-Pro-Phe-Arg-Ser-Val-Gln-NH2;Ac-PFRSVQ-NH2, CAS# 97145-43-2, Formula: C35H55N11O9, MWT: 773.8795, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Apamin, Alternative-names: Cys-Asn-Cys-Lys-Ala-Pro-Glu-Thr-Ala-Leu-Cys-Ala-Arg-Arg-Cys-Gln-Gln-His-NH2;CNCKAPETALCARRCQQH-NH2, CAS# 24345-16-2, Formula: C79H131N31O24S4, MWT: 2027.33874, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Kassinin, Alternative-names: Asp-Val-Pro-Lys-Ser-Asp-Gln-Phe-Val-Gly-Leu-Met-NH2;DVPKSDQFVGLM-NH2, CAS# 63968-82-1, Formula: C59H95N15O18S, MWT: 1334.5403, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Gastrin-Releasing Peptide, human, Alternative-names: Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2;VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2, CAS# 93755-85-2, Formula: C130H204N38O31S2, MWT: 2859.37676, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Neurokinin B, Alternative-names: Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2;DMHDFFVGLM-NH2, CAS# 86933-75-7, Formula: C55H79N13O14S2, MWT: 1210.42446, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tuftsin, Alternative-names: Thr-Lys-Pro-Arg;TKPR, CAS# 9063-57-4, Formula: C21H40N8O6, MWT: 500.5923, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Neuromedin B, Alternative-names: Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2;GNLWATGHFM-NH2, CAS# 87096-84-2, Formula: C52H73N15O12S, MWT: 1132.29432, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Luteinizing Hormone Releasing Hormone (LH-RH), salmon, Alternative-names: pGlu-His-Trp-Ser-Tyr-Gly-Trp-Leu-Pro-Gly;{pGLU}HWSYGWLPG, CAS# 86073-88-3, Formula: C60H73N15O13, MWT: 1212.31432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Dermorphin, Alternative-names: Tyr-d-Ala-Phe-Gly-Tyr-Pro-Ser-NH2;Y{d-ALA}FGYPS-NH2, CAS# 77614-16-5, Formula: C40H50N8O10, MWT: 802.8726, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Speract, Alternative-names: Gly-Phe-Asp-Leu-Asn-Gly-Gly-Gly-Val-Gly;GFDLNGGGVG, CAS# 76901-59-2, Formula: C38H57N11O14, MWT: 891.92448, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Mastoparan, Alternative-names: Ile-Asn-Leu-Lys-Ala-Leu-Ala-Ala-Leu-Ala-Lys-Lys-Ile-Leu;INLKALAALAKKIL, CAS# 72093-21-1, Formula: C70H131N19O15, MWT: 1478.90744, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Kisspeptin-10, Alternative-names: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2;YNWNSFGLRF-NH2, CAS# 374675-21-5, Formula: C63H83N17O14, MWT: 1302.43862, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Xenopsin, Alternative-names: pGlu-Gly-Lys-Arg-Pro-Trp-Ile-Leu;{pGLU}GKRPWIL, CAS# 51827-01-1, Formula: C47H73N13O10, MWT: 980.16362, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Kemptide, Alternative-names: Leu-Arg-Arg-Ala-Ser-Leu-Gly;LRRASLG, CAS# 65189-71-1, Formula: C32H61N13O9, MWT: 771.90844, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Protein Tyrosine Kinase/RTK, Target: PKA;PKA, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Neurotensin(8-13), Alternative-names: Arg-Arg-Pro-Tyr-Ile-Leu;RRPYIL, CAS# 60482-95-3, Formula: C38H64N12O8, MWT: 816.99036, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Phe-Met-Arg-Phe, amide, Alternative-names: Phe-Met-Arg-Phe-NH2;FMRF-NH2, CAS# 64190-70-1, Formula: C29H42N8O4S, MWT: 598.75998, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Physalaemin, Alternative-names: GLP-Ala-Asp-Pro-Asn-Lys-Phe-Tyr-Gly-Leu-Met-NH2;{pGLU}ADPNKFYGLM-NH2, CAS# 2507-24-6, Formula: C58H84N14O16S, MWT: 1265.43676, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| α-Melanocyte-Stimulating Hormone (MSH), amide, Alternative-names: Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2;Ac-SYSMEHFRWGKPV-NH2, CAS# 581-05-5, Formula: C77H109N21O19S, MWT: 1664.88366, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Veledimex, Alternative-names: INXN-1001;RG-115932, CAS# 1093130-72-3, Formula: C27H38N2O3, MWT: 438.6022, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation;Metabolic Enzyme/Protease, Target: Interleukin Related;Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Fosphenytoin (disodium), Alternative-names: , CAS# 92134-98-0, Formula: C16H13N2Na2O6P, MWT: 406.23752056, Solubility: H<sub>2</sub>O: ≥100 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 1H-Isoindole-1,3(2H)-dione, 2-[2-[4-(6-fluoro-1,2-benzisoxazol-3-yl)-1-piperidinyl]ethyl]-, Alternative-names: , CAS# 131999-28-5, Formula: C22H20FN3O3, MWT: 393.4109032, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| N-(2-Chloro-6-methylphenyl)-N'-4-pyridinylurea, Alternative-names: , CAS# 97627-24-2, Formula: C13H12ClN3O, MWT: 261.70688, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Darodipine, Alternative-names: PY 108-068; PY-108068, CAS# 72803-02-2, Formula: C19H21N3O5, MWT: 371.38714, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tosylchloramide (sodium trihydrate), Alternative-names: , CAS# 7080-50-4, Formula: C7H13ClNNaO5S, MWT: 281.68958928, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 3β,7β,17β-Trihydroxyandrost-5-ene, Alternative-names: , CAS# 2697-85-0, Formula: C19H30O3, MWT: 306.4397, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Hydrocortisone cypionate, Alternative-names: , CAS# 508-99-6, Formula: C29H42O6, MWT: 486.64018, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| N-Methylmoranoline, Alternative-names: MOR 14; N-Methyl-1-deoxynojirimycin; N-Methylmoranolin, CAS# 69567-10-8, Formula: C7H15NO4, MWT: 177.1983, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Gestonorone Capronate, Alternative-names: , CAS# 1253-28-7, Formula: C26H38O4, MWT: 414.57752, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Progesterone Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| (5R)-BW-4030W92, Alternative-names: , CAS# 189013-61-4, Formula: C11H9Cl2FN4, MWT: 287.1203632, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| BAY-Y 3118, Alternative-names: , CAS# 151213-16-0, Formula: C20H21ClFN3O3, MWT: 405.8504432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ERA63, Alternative-names: , CAS# 343248-86-2, Formula: C22H30O, MWT: 310.473, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| INO5042, Alternative-names: , CAS# 14782-19-5, Formula: C15H7NO3S, MWT: 281.28598, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Flucloxacillin (sodium), Alternative-names: , CAS# 1847-24-1, Formula: C19H16ClFN3NaO5S, MWT: 475.85361248, Solubility: DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Hepsulfam, Alternative-names: NCI 329680;ZINC01574758, CAS# 96892-57-8, Formula: C7H18N2O6S2, MWT: 290.35762, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ansofaxine (hydrochloride), Alternative-names: LY03005; LPM570065, CAS# 916918-84-8, Formula: C24H32ClNO3, MWT: 417.96878, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| L-4-Oxalysine (hydrochloride), Alternative-names: , CAS# 118021-35-5, Formula: C5H13ClN2O3, MWT: 184.62132, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Prednisolone Tebutate, Alternative-names: , CAS# 7681-14-3, Formula: C27H38O6, MWT: 458.58702, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Testosterone tridecanoate, Alternative-names: , CAS# 488836-58-4, Formula: C32H52O3, MWT: 484.75348, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Parcetasal, Alternative-names: MR-897, CAS# 87549-36-8, Formula: C17H15NO5, MWT: 313.3047, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Octazamide, Alternative-names: ICI-US 457, CAS# 56391-55-0, Formula: C13H15NO2, MWT: 217.2637, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Suclofenide, Alternative-names: Neosulfalepsine;PB385, CAS# 30279-49-3, Formula: C16H13ClN2O4S, MWT: 364.80342, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Triamcinolone hexacetonide, Alternative-names: , CAS# 5611-51-8, Formula: C30H41FO7, MWT: 532.6407432, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| YM-46303, Alternative-names: , CAS# 171722-81-9, Formula: C20H23ClN2O2, MWT: 358.86182, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Oxitropium (Bromide), Alternative-names: , CAS# 30286-75-0, Formula: C19H26BrNO4, MWT: 412.31804, Solubility: DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Cimetropium (Bromide), Alternative-names: , CAS# 51598-60-8, Formula: C21H28BrNO4, MWT: 438.35532, Solubility: DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Norboletone, Alternative-names: α-Norbolethone, CAS# 797-58-0, Formula: C21H32O2, MWT: 316.47758, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PGS-IN-1, Alternative-names: , CAS# 102271-49-8, Formula: C19H26O3, MWT: 302.40794, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Immunology/Inflammation, Target: 5-Lipoxygenase;PGE synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Piridocaine (hydrochloride), Alternative-names: Lucaine hydrochloride, CAS# 6099-95-2, Formula: C14H21ClN2O2, MWT: 284.78174, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| MG 1, Alternative-names: , CAS# 148274-76-4, Formula: C17H25N3O2, MWT: 303.3993, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Timobesone, Alternative-names: , CAS# 87116-72-1, Formula: C22H29FO4S, MWT: 408.5266632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Estradiol 3-sulfamate, Alternative-names: BLE 00084; E2MATE; ES-J 995, CAS# 172377-52-5, Formula: C18H25NO4S, MWT: 351.4604, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Bunaftide, Alternative-names: Bunaftine; Bunaphtide; Meregon, CAS# 32421-46-8, Formula: C21H30N2O, MWT: 326.4757, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ZSET-845, Alternative-names: , CAS# 324077-62-5, Formula: C21H18N2O, MWT: 314.38042, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GP531, Alternative-names: , CAS# 142344-87-4, Formula: C16H21N5O4, MWT: 347.36904, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Lusaperidone, Alternative-names: R107474, CAS# 214548-46-6, Formula: C22H21N3O2, MWT: 359.42104, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| EF-5, Alternative-names: , CAS# 152721-37-4, Formula: C8H7F5N4O3, MWT: 302.158196, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Nuvenzepine, Alternative-names: , CAS# 96487-37-5, Formula: C19H20N4O2, MWT: 336.3877, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Picloxydine, Alternative-names: , CAS# 5636-92-0, Formula: C20H24Cl2N10, MWT: 475.37756, Solubility: DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Lintopride, Alternative-names: , CAS# 107429-63-0, Formula: C14H19ClN4O2, MWT: 310.77926, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 3-[[2-[[2-(3,4-Dimethoxyphenyl)ethyl]amino]-2-oxoethyl]amino]benzamide, Alternative-names: , CAS# 76001-09-7, Formula: C19H23N3O4, MWT: 357.40362, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Guanoxabenz, Alternative-names: Hydroxyguanabenz, CAS# 24047-25-4, Formula: C8H8Cl2N4O, MWT: 247.08132, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Tromantadine, Alternative-names: , CAS# 53783-83-8, Formula: C16H28N2O2, MWT: 280.40572, Solubility: DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: HSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CGP-53153, Alternative-names: , CAS# 149281-19-6, Formula: C23H33N3O2, MWT: 383.52702, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: 5 alpha Reductase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 5HT6-ligand-1, Alternative-names: , CAS# 1038988-11-2, Formula: C20H22BrN3O2S, MWT: 448.37658, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Pyridazinediones-derivative-1, Alternative-names: , CAS# 147493-44-5, Formula: C11H6ClN3O3, MWT: 263.63664, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PPA-904, Alternative-names: , CAS# 30189-85-6, Formula: C28H42BrN3S, MWT: 532.62218, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SC57666, Alternative-names: , CAS# 158959-32-1, Formula: C18H17FO2S, MWT: 316.3897832, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 1-Acetyl-3-o-toluyl-5-fluorouracil, Alternative-names: A-OT-Fu, CAS# 71861-76-2, Formula: C14H11FN2O4, MWT: 290.2465432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Sulfabrom, Alternative-names: N 3517;Sulfabromomethazine, CAS# 116-45-0, Formula: C12H13BrN4O2S, MWT: 357.22622, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Embramine, Alternative-names: , CAS# 3565-72-8, Formula: C18H22BrNO, MWT: 348.27738, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| HSR6071, Alternative-names: , CAS# 111374-21-1, Formula: C10H12N8O, MWT: 260.25528, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Benzcyclane, Alternative-names: Bencyclane; Benzcyclan, CAS# 2179-37-5, Formula: C19H31NO, MWT: 289.45554, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Calcium channel-modulator-1, Alternative-names: , CAS# 136941-70-3, Formula: C26H24Cl2N2O7S, MWT: 579.44896, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Win-62005, Alternative-names: , CAS# 152633-54-0, Formula: C12H10N4O, MWT: 226.234, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| YS-201, Alternative-names: , CAS# 108852-42-2, Formula: C24H31N3O6, MWT: 457.51944, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Androstenediol 17-acetate, Alternative-names: , CAS# 5937-72-4, Formula: C21H32O3, MWT: 332.47698, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Cyclodrine (hydrochloride), Alternative-names: , CAS# 78853-39-1, Formula: C19H30ClNO3, MWT: 355.8994, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| α-Hydroxylinoleic acid, Alternative-names: , CAS# 57818-44-7, Formula: C18H32O3, MWT: 296.44488, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| A-802715, Alternative-names: , CAS# 107767-58-8, Formula: C16H26N4O3, MWT: 322.40264, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Betamethasone-17-butyrate-21-propionate, Alternative-names: , CAS# 5534-02-1, Formula: C29H39FO7, MWT: 518.6141, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| N-0861 racemate, Alternative-names: , CAS# 121241-87-0, Formula: C13H17N5, MWT: 243.30758, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MAO-IN-1, Alternative-names: , CAS# 124991-40-8, Formula: C17H19ClO4, MWT: 322.78336, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Phosphonic acid, [(3E)-1-[(2E)-3,7-dimethyl-2,6-octadienyl]-4,8-dimethyl-3,7-nonadienylidene]bis-, tetrasodium salt, Alternative-names: , CAS# 878143-03-4, Formula: C21H34Na4O6P2, MWT: 536.39766112, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| FR-188582, Alternative-names: , CAS# 189699-82-9, Formula: C16H13ClN2O2S, MWT: 332.80462, Solubility: , Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Nicotinoyl cyclandelate, Alternative-names: RV 12128, CAS# 39537-99-0, Formula: C23H27NO4, MWT: 381.46478, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| KY-556, Alternative-names: N556, CAS# 110816-78-9, Formula: C33H38Cl2N2O12, MWT: 725.56702, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Drobuline (hydrochloride), Alternative-names: , CAS# 68162-52-7, Formula: C19H26ClNO, MWT: 319.86884, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Dopropidil, Alternative-names: , CAS# 79700-61-1, Formula: C20H35NO2, MWT: 321.4974, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Aminochlorthenoxazin, Alternative-names: ICI 350, CAS# 3567-76-8, Formula: C10H11ClN2O2, MWT: 226.65954, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Dixyrazine, Alternative-names: , CAS# 2470-73-7, Formula: C24H33N3O2S, MWT: 427.60272, Solubility: , Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| 2-γ-Linolenoyl-1,3-dilinoleoyl-sn-glycerol, Alternative-names: , CAS# 174473-88-2, Formula: C57H96O6, MWT: 877.36854, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 3-CPs, Alternative-names: 3-Carbethoxypsoralen; 3-Ethoxycarbonylpsoralen, CAS# 20073-24-9, Formula: C14H10O5, MWT: 258.2262, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| SKF81367, Alternative-names: Cefuracetime, CAS# 39685-31-9, Formula: C17H17N3O8S, MWT: 423.39718, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NCI172112, Alternative-names: NSC172112;NSC268497, CAS# 56605-16-4, Formula: C14H23Cl2N3O2, MWT: 336.25732, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RS4317, Alternative-names: Lonapalene, CAS# 91431-42-4, Formula: C16H15ClO6, MWT: 338.7397, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: 5-Lipoxygenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Thiazinamium chloride, Alternative-names: Multergan chloride, CAS# 4320-13-2, Formula: C18H23ClN2S, MWT: 334.90662, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Fenmetozole (Tosylate), Alternative-names: , CAS# 83474-08-2, Formula: C17H18Cl2N2O4S, MWT: 417.30682, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Cefetrizole, Alternative-names: , CAS# 65307-12-2, Formula: C16H15N5O4S3, MWT: 437.5164, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Cipropride (S enantiomer), Alternative-names: , CAS# 66183-70-8, Formula: C17H25N3O4S, MWT: 367.4631, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Phenol, 4-[[(4,5-dihydro-1H-imidazol-2-yl)methyl](4-methylphenyl)amino]-, Alternative-names: , CAS# 47142-51-8, Formula: C17H19N3O, MWT: 281.35226, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NSC297623, Alternative-names: W2395;Meseclazone, CAS# 29053-27-8, Formula: C11H10ClNO3, MWT: 239.655, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Telomerase-IN-1, Alternative-names: , CAS# 666859-49-0, Formula: C21H23FN2O4, MWT: 386.4167232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Telomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Cyclobutanecarboxamide, 3-fluoro-3-[3-fluoro-4-(1-pyrrolidinylmethyl)phenyl]-N-(2-methylpropyl)-, cis-, Alternative-names: , CAS# 935840-13-4, Formula: C20H28F2N2O, MWT: 350.4459264, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| [1,1'-Biphenyl]-2-carboxamide, N-[1,2,3,4-tetrahydro-2-(1H-imidazol-2-ylmethyl)-6-isoquinolinyl]-4'-(trifluoromethyl)-, Alternative-names: , CAS# 186390-35-2, Formula: C27H23F3N4O, MWT: 476.4929296, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pareptide monohydrochloride, Alternative-names: , CAS# 63236-23-7, Formula: C14H27ClN4O3, MWT: 334.84218, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tenatoprazole sodium, Alternative-names: Tenatoprazole sodium salt, CAS# 335299-59-7, Formula: C16H18N4NaO3S, MWT: 369.39388928, Solubility: , Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Androst-4-ene-3,17-diol, dipropanoate, (3β,17β)-, Alternative-names: Androst-4-ene-3β,17β-diol, dipropionate, CAS# 56699-31-1, Formula: C25H38O4, MWT: 402.56682, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Anti-inflammatory agent 1, Alternative-names: , CAS# 1096621-42-9, Formula: C17H16O3S, MWT: 300.37214, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ropitoin, Alternative-names: , CAS# 56079-81-3, Formula: C30H33N3O3, MWT: 483.60132, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| McN3716, Alternative-names: Methyl palmoxirate; NSC359682, CAS# 69207-52-9, Formula: C18H34O3, MWT: 298.46076, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SP187, Alternative-names: MON-DNJ;UV4, CAS# 615253-61-7, Formula: C16H33NO5, MWT: 319.43692, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Influenza Virus, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| COX-2-IN-1, Alternative-names: , CAS# 787623-48-7, Formula: C18H14ClF3N4O2S, MWT: 442.8425696, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Betamethasone 17-benzoate, Alternative-names: , CAS# 22298-29-9, Formula: C29H33FO6, MWT: 496.5671232, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SZ1676, Alternative-names: , CAS# 159325-23-2, Formula: C37H59BrN2O6, MWT: 707.77816, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 8-Azoniabicyclo[3.2.1]octane, 8-(2-fluoroethyl)-3-[(2-hydroxy-2,2-diphenylacetyl)oxy]-8-methyl-, bromide (1:1), (3-endo,8-anti)-, Alternative-names: , CAS# 63516-10-9, Formula: C24H29BrFNO3, MWT: 478.3943632, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DG5128, Alternative-names: (±)-DG5128;Midaglizole hydrochloride, CAS# 79689-25-1, Formula: C16H19Cl2N3, MWT: 324.24816, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| CAM-IN-1, Alternative-names: , CAS# 251994-14-6, Formula: C15H11BrN2O2S, MWT: 363.22904, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| KP136, Alternative-names: AL136, CAS# 76239-32-2, Formula: C16H18N4O3, MWT: 314.33912, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Benzenesulfonamide, 5-[[5-fluoro-4-[[4-(2-propyn-1-yloxy)phenyl]amino]-2-pyrimidinyl]amino]-2-methyl-, Alternative-names: , CAS# 916741-98-5, Formula: C20H18FN5O3S, MWT: 427.4520232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Deloxolone, Alternative-names: (3β,20β)-3-(3-Carboxy-1-oxopropoxy)olean-9(11)-en-29-oic acid, CAS# 68635-50-7, Formula: C34H52O6, MWT: 556.77308, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Nitracrine, Alternative-names: , CAS# 4533-39-5, Formula: C18H20N4O2, MWT: 324.377, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PNF21, Alternative-names: Prednisolone Farnesylate, CAS# 118244-44-3, Formula: C36H50O6, MWT: 578.7786, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| (Z)-MDL 105519, Alternative-names: , CAS# 179105-67-0, Formula: C18H11Cl2NO4, MWT: 376.19024, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| U66858, Alternative-names: Bunaprolast, CAS# 99107-52-5, Formula: C17H20O3, MWT: 272.3389, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Metabolic Enzyme/Protease;GPCR/G Protein, Target: Leukotriene Receptor;5-Lipoxygenase;Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Carbamic acid, N-[2,4-dimethyl-6-(4-morpholinyl)-3-pyridinyl]-, phenylmethyl ester, Alternative-names: , CAS# 908608-06-0, Formula: C19H23N3O3, MWT: 341.40422, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SQ28603, Alternative-names: SQ28,603;Squibb 28603, CAS# 100845-83-8, Formula: C13H17NO3S, MWT: 267.34398, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Neprilysin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| C80-1324, Alternative-names: 2-oxide;Ipramidil, CAS# 83656-38-6, Formula: C10H16N4O4, MWT: 256.25844, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| U89232, Alternative-names: , CAS# 134017-78-0, Formula: C19H25N5O2, MWT: 355.4341, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Tuftsin (diacetate), Alternative-names: , CAS# 72103-53-8, Formula: C25H48N8O10, MWT: 620.69622, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| KB3022, Alternative-names: KBT3022; Pamicogrel, CAS# 101001-34-7, Formula: C25H24N2O4S, MWT: 448.53406, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Org30958, Alternative-names: , CAS# 99957-90-1, Formula: C21H30O2S2, MWT: 378.5917, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Aromatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| S16961, Alternative-names: S169611, CAS# 153874-14-7, Formula: C41H71NO6, MWT: 674.00554, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| GDP366, Alternative-names: , CAS# 501698-03-9, Formula: C20H17N5OS, MWT: 375.44688, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Survivin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Phosphinic acid, P-[1-(5-chlorobenzo[b]thien-3-yl)-2-[[(1E)-2-(3,4-difluorophenyl)ethenyl]amino]-2-oxoethyl]-P-methyl-, Alternative-names: P-[1-(5-Chlorobenzo[b]thien-3-yl)-2-[[(1E)-2-(3,4-difluorophenyl)ethenyl]amino]-2-oxoethyl]-P-methylphosphinic acid, CAS# 936366-22-2, Formula: C19H15ClF2NO3PS, MWT: 441.8158684, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Falintolol, (Z)-, Alternative-names: , CAS# 106401-52-9, Formula: C12H24N2O2, MWT: 228.33116, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Watanipidine monohydrochloride, Alternative-names: , CAS# 116308-56-6, Formula: C41H43ClN4O6, MWT: 723.25632, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CB7432, Alternative-names: SB223030;Idoxifene, CAS# 116057-75-1, Formula: C28H30INO, MWT: 523.44837, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Taurox SB, Alternative-names: Tauroxicum, CAS# 648922-41-2, Formula: C13H18N2O6S1/2Zn, MWT: 362.32182, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CDC801, Alternative-names: , CAS# 192819-27-5, Formula: C23H24N2O5, MWT: 408.44706, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Apoptosis, Target: Phosphodiesterase (PDE);TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Benzeneacetic acid, α-methyl-4-(2-methylpropyl)-, 3-[2-[(dimethylamino)methyl]-1-hydroxycyclohexyl]phenyl ester, Alternative-names: , CAS# 269079-66-5, Formula: C28H39NO3, MWT: 437.61416, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 1,5-Benzothiazepin-4(5H)-one, 2,3-dihydro-3-[(4-methyl-1-piperazinyl)methyl]-2-phenyl-, (2R,3S)-rel-, Alternative-names: , CAS# 72293-17-5, Formula: C21H25N3OS, MWT: 367.5077, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Benzamide, 4-amino-N-[2-(4-benzoyl-1-piperidinyl)ethyl]-N-3-pyridinyl-, Alternative-names: , CAS# 204643-75-4, Formula: C26H28N4O2, MWT: 428.52612, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Imidazo[1,2-a]pyridine-2-carboxamide, 6-chloro-N-[6-(phenylmethoxy)-1H-benzimidazol-2-yl]-, Alternative-names: , CAS# 1254166-60-3, Formula: C22H16ClN5O2, MWT: 417.84774, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Beta-secretase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| KF21213, Alternative-names: , CAS# 155271-17-3, Formula: C19H22N4O3, MWT: 354.40298, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Benzoic acid, 4-(3-cyano-5,6-difluoro-1H-indol-1-yl)-2-hydroxy-, Alternative-names: 4-(3-Cyano-5,6-difluoroindol-1-yl)-2-hydroxybenzoic acid, CAS# 1071970-13-2, Formula: C16H8F2N2O3, MWT: 314.2431264, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| (2R)-N-[[5-[3-(2,5-Difluorophenyl)-2-(1,3-dihydro-2H-benzimidazol-2-ylidene)-1,3-dioxopropyl]-2-fluorophenyl]sulfonyl]-2-hydroxypropanimidamide, Alternative-names: , CAS# 912587-25-8, Formula: C25H19F3N4O5S, MWT: 544.5023696, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NSC351149, Alternative-names: R23633;Fludazonium chloride, CAS# 53597-28-7, Formula: C26H20Cl5FN2O2, MWT: 588.7126032, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| DU717, Alternative-names: , CAS# 59943-31-6, Formula: C12H15ClN4O2S, MWT: 314.7911, Solubility: , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| ICI141292, Alternative-names: Epanolol;Visacor, CAS# 86880-51-5, Formula: C20H23N3O4, MWT: 369.41432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| A-437203, Alternative-names: Lu201640;A37203, CAS# 220519-06-2, Formula: C20H27F3N6OS, MWT: 456.5281896, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| R-(+)-Mono-desmethylsibutramine, Alternative-names: , CAS# 229639-54-7, Formula: C16H24ClN, MWT: 265.82146, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 2-Benzofurancarboxamide, N-[1-(4-pyridinylmethyl)-4-piperidinyl]-5-[[1-[4-(trifluoromethyl)phenyl]-4-piperidinyl]oxy]-, Alternative-names: , CAS# 1152423-98-7, Formula: C32H33F3N4O3, MWT: 578.6246296, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| SA504, Alternative-names: SA50Y; Sesden; Timepidium bromide, CAS# 35035-05-3, Formula: C17H22BrNOS2, MWT: 400.39668, Solubility: DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| ZK-90055 (hydrochloride), Alternative-names: , CAS# 84638-81-3, Formula: C16H23ClN2O4, MWT: 342.81782, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Cyclopentanepropanoic acid, 1-[[[3-(4-chlorophenyl)propyl]amino]carbonyl]-α-(2-methoxyethyl)-, Alternative-names: , CAS# 465527-94-0, Formula: C21H30ClNO4, MWT: 395.9202, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Melarsonyl, Alternative-names: Melarsonic acid, CAS# 37526-80-0, Formula: C13H13AsN6O4S2, MWT: 456.33172, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Amebucort, Alternative-names: , CAS# 83625-35-8, Formula: C28H40O7, MWT: 488.613, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Androst-4-en-3-one, 4,17-dihydroxy-17-methyl-, (17α)-, Alternative-names: , CAS# 145841-84-5, Formula: C20H30O3, MWT: 318.4504, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| EP1-antanoist-1, Alternative-names: , CAS# 851204-35-8, Formula: C19H15BrCl2N2O3, MWT: 470.144, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| N-[(1R)-4-[(Aminoiminomethyl)amino]-1-[[[(1R)-1-(4-hydroxyphenyl)ethyl]amino]carbonyl]butyl]-α-phenylbenzeneacetamide, Alternative-names: , CAS# 221697-09-2, Formula: C28H33N5O3, MWT: 487.59332, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Benzonitrile, 4-[[3-[7-(3,3-dimethyl-2-oxobutyl)-9-oxa-3,7-diazabicyclo[3.3.1]non-3-yl]propyl]amino]-, Alternative-names: , CAS# 335619-12-0, Formula: C22H32N4O2, MWT: 384.51508, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Isoxsuprine-monoester-1, Alternative-names: , CAS# 67160-74-1, Formula: C23H31NO4, MWT: 385.49654, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Carbamic acid, (diphenylmethyl)-, 1-[(3-aminophenyl)methyl]-4-piperidinyl ester, Alternative-names: , CAS# 168830-01-1, Formula: C26H29N3O2, MWT: 415.52736, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| AU-224, Alternative-names: , CAS# 287399-47-7, Formula: C19H28ClN3O4, MWT: 397.89632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Desethyl KBT-3022, Alternative-names: , CAS# 101001-72-3, Formula: C23H20N2O4S, MWT: 420.4809, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Anti-inflammatory agent 2, Alternative-names: , CAS# 133012-00-7, Formula: C26H30N2O4S, MWT: 466.5924, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Benzonitrile, 4-[2-(4,4-dimethyl-2-oxo-3-oxazolidinyl)-4-thiazolyl]-, Alternative-names: , CAS# 1007581-62-5, Formula: C15H13N3O2S, MWT: 299.34762, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| K134, Alternative-names: OPC33509, CAS# 189362-06-9, Formula: C22H29N3O4, MWT: 399.48336, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NCX1022, Alternative-names: , CAS# 571186-50-0, Formula: C29H35NO9, MWT: 541.5895, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| A81988, Alternative-names: Abbott81988, CAS# 141887-34-5, Formula: C23H22N6O2, MWT: 414.45978, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Sch412348, Alternative-names: , CAS# 377727-26-9, Formula: C22H21F2N9O, MWT: 465.4586464, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| RD20000, Alternative-names: Deprodone propionate, CAS# 20424-00-4, Formula: C24H32O5, MWT: 400.50788, Solubility: DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Benzonitrile, 4-[2-(4,4-dimethyl-2-oxo-3-oxazolidinyl)-4-thiazolyl]-Methanesulfonamide, N-[4-[1-hydroxy-2-[[(1,2,3,4-tetrahydro-1-oxo-2-naphthalenyl)methyl]amino]ethyl]phenyl]-, hydrochloride, Alternative-names: , CAS# 129280-22-4, Formula: C20H25ClN2O4S, MWT: 424.9415, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| GP2-114, Alternative-names: , CAS# 130783-39-0, Formula: C19H24N2O4, MWT: 344.40486, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| M3 receptor antagonist 1, Alternative-names: , CAS# 1004312-94-0, Formula: C27H25BrF4N2O3S, MWT: 613.4616128, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CGP11952, Alternative-names: , CAS# 64078-09-7, Formula: C21H21Cl2N5O2, MWT: 446.32974, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Trecadrine, Alternative-names: Trecadrinum, CAS# 90845-56-0, Formula: C27H29NO, MWT: 383.52526, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Methanone, (5-chloro-2-fluorophenyl)[(3S)-3-[[4-(3-cyclopropyl-3-fluoro-1-azetidinyl)-6-[(5-methyl-1H-pyrazol-3-yl)amino]-2-pyrimidinyl]oxy]-1-pyrrolidinyl]-, Alternative-names: , CAS# 937276-52-3, Formula: C25H26ClF2N7O2, MWT: 529.9694464, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Cicloxilic acid, Alternative-names: Cycloxilic acid, CAS# 57808-63-6, Formula: C13H16O3, MWT: 220.26434, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ro18-5362, Alternative-names: , CAS# 101387-97-7, Formula: C22H25N3O2S, MWT: 395.5178, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| DM8966, Alternative-names: Flumenique; OPC19A; OPC7241; Vebufloxacin, CAS# 79644-90-9, Formula: C19H22FN3O3, MWT: 359.3946832, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Piperylone, Alternative-names: PR66, CAS# 2531-04-6, Formula: C17H23N3O, MWT: 285.38402, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Spiro[1-azabicyclo[2.2.2]octane-3,5'(4'H)-oxazole], 2'-(1-methyl-1H-indol-3-yl)-, Alternative-names: , CAS# 128199-93-9, Formula: C18H21N3O, MWT: 295.37884, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Denufosol tetrasodium, Alternative-names: INS37217, CAS# 318250-11-2, Formula: C18H23N5Na4O21P4, MWT: 861.25024512, Solubility: H<sub>2</sub>O, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: P2Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| JTE522, Alternative-names: JTP19605; RWJ57504; Tilmacoxib, CAS# 180200-68-4, Formula: C16H19FN2O3S, MWT: 338.3970632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Cocaethylene, Alternative-names: Benzoylethylecgonin;Cocaethylin; Cocaethyline; Ecgonine ethyl ester benzoate (ester); Ethyl benzoylecgonine; Ethylcocaine; Homocaine; Homococaine; , CAS# 529-38-4, Formula: C18H23NO4, MWT: 317.37952, Solubility: , Clinical_Information: Phase 1, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Topterone, Alternative-names: Win 17665, CAS# 60607-35-4, Formula: C22H34O2, MWT: 330.50416, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Carabersat, Alternative-names: , CAS# 184653-84-7, Formula: C20H20FNO4, MWT: 357.3755032, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 4-Imidazolidinone, 1-ethyl-3-[4-[4-(4-hydroxyphenyl)-1-piperazinyl]phenyl]-5,5-dimethyl-2-thioxo-, Alternative-names: , CAS# 125235-15-6, Formula: C23H28N4O2S, MWT: 424.55902, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Norzopiclone, Alternative-names: N-Desmethyl zopiclone; RP 32273, CAS# 59878-63-6, Formula: C16H15ClN6O3, MWT: 374.7817, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| YM758, Alternative-names: , CAS# 312752-85-5, Formula: C26H32FN3O4, MWT: 469.5483832, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| 2H-Imidazo[4,5-b]pyridin-2-one, 6-chloro-1-(1-ethylpropyl)-1,3-dihydro-7-(2H-tetrazol-5-yl)-, Alternative-names: , CAS# 1178978-20-5, Formula: C12H14ClN7O, MWT: 307.73886, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| SC26304, Alternative-names: Dicirenone, CAS# 41020-79-5, Formula: C26H36O5, MWT: 428.56104, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Mineralocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Aliconazole, Alternative-names: , CAS# 63824-12-4, Formula: C18H13Cl3N2, MWT: 363.66822, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 4H-Pyrano[3,2-c]quinoline-2-carboxylic acid, 5,6-dihydro-9-methyl-4,5-dioxo-, Alternative-names: , CAS# 63768-49-0, Formula: C14H9NO5, MWT: 271.22496, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Carbamic acid, N-[6-[2,3-dihydro-1-hydroxy-3-oxo-2-(phenylmethyl)-1H-isoindol-1-yl]-1H-benzimidazol-2-yl]-, methyl ester, Alternative-names: , CAS# 870600-45-6, Formula: C24H20N4O4, MWT: 428.44, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| KRN4884, Alternative-names: , CAS# 152802-84-1, Formula: C15H14ClN5, MWT: 299.75816, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LY285434, Alternative-names: , CAS# 159748-08-0, Formula: C23H25N5O2, MWT: 403.4769, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Tropodifene, Alternative-names: Tropaphen, CAS# 15790-02-0, Formula: C25H29NO4, MWT: 407.50206, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CDDD3602, Alternative-names: HGP6, CAS# 113932-41-5, Formula: C21H31NO8S, MWT: 457.53774, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| W1015, Alternative-names: Nisobamate, CAS# 25269-04-9, Formula: C13H26N2O4, MWT: 274.35654, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 3-Pyridinecarboximidoyl chloride, N-[2-hydroxy-3-(1-piperidinyl)propoxy]-, 1-oxide, Alternative-names: , CAS# 289893-23-8, Formula: C14H20ClN3O3, MWT: 313.7799, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Dopexamine hydrochloride, Alternative-names: FPL60278AR, CAS# 86484-91-5, Formula: C22H34Cl2N2O2, MWT: 429.42356, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Gidazepam, Alternative-names: Gidasepam;Hidazepam; Hydazepam, CAS# 129186-29-4, Formula: C17H15BrN4O2, MWT: 387.2306, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Vinconate, Alternative-names: Chanodesethylapovincamine, CAS# 70704-03-9, Formula: C18H20N2O2, MWT: 296.3636, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| D2343, Alternative-names: , CAS# 72734-63-5, Formula: C20H27NO3, MWT: 329.43328, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Sigma-LIGAND-1, Alternative-names: , CAS# 139652-01-0, Formula: C27H33NO4, MWT: 435.55522, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Sigma Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| QF0301B, Alternative-names: , CAS# 149247-12-1, Formula: C23H28N2O2, MWT: 364.48062, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Benzamide, 4-[(5S)-5-[(acetylamino)methyl]-2-oxo-3-oxazolidinyl]-2-fluoro-N-methyl-, Alternative-names: , CAS# 232951-56-3, Formula: C14H16FN3O4, MWT: 309.2929432, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PAF-AN-1, Alternative-names: , CAS# 115621-84-6, Formula: C28H28N2O3, MWT: 440.53352, Solubility: , Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LDL-IN-3, Alternative-names: , CAS# 180908-67-2, Formula: C24H36O3Si, MWT: 400.62634, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Propanamide, N-[[5-[[5-fluoro-4-[[4-(2-propyn-1-yloxy)phenyl]amino]-2-pyrimidinyl]amino]-2-methylphenyl]sulfonyl]-, Alternative-names: , CAS# 916742-11-5, Formula: C23H22FN5O4S, MWT: 483.5152832, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Lipid peroxidation inhibitor 1, Alternative-names: , CAS# 142873-41-4, Formula: C24H32N2O, MWT: 364.52368, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Piperidine-MO-1, Alternative-names: , CAS# 871351-61-0, Formula: C14H21ClFNO2S, MWT: 321.8384432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MEN11467, Alternative-names: , CAS# 214487-46-4, Formula: C38H40N4O3, MWT: 600.7492, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 1H-Indole-3-carboxamide, N-[(1R,2S)-2-[[(2R)-2-[methyl[2-(4-methylphenyl)acetyl]amino]-3-(2-naphthalenyl)-1-oxopropyl]amino]cyclohexyl]-, Alternative-names: , CAS# 214487-45-3, Formula: C38H40N4O3, MWT: 600.7492, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| A2B receptor antagonist 1, Alternative-names: , CAS# 531506-36-2, Formula: C21H24N6O2, MWT: 392.45426, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Imidazol-1-yl compound 1, Alternative-names: , CAS# 120635-47-4, Formula: C20H21N3O, MWT: 319.40024, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| RGW2938, Alternative-names: Prinoxodan, CAS# 111786-07-3, Formula: C13H13N4O2, MWT: 257.26792, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Benzofurodil, Alternative-names: Benfurodil;CB4091;Eudilat, CAS# 3447-95-8, Formula: C19H18O7, MWT: 358.34202, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Carbazole derivative 1, Alternative-names: 2-Fluoro-7-[(3-pyridinyl)methyl]-9H-carbazole, CAS# 164914-28-7, Formula: C18H13FN2, MWT: 276.3076232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| p38 MAPK-IN-2, Alternative-names: , CAS# 635725-16-5, Formula: C20H19ClFN5O2, MWT: 415.8485632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 11β-HSD1-IN-1, Alternative-names: , CAS# 1203956-47-1, Formula: C18H14ClF4N3O, MWT: 399.7698728, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| D18024, Alternative-names: , CAS# 110406-33-2, Formula: C29H31ClFN3O, MWT: 492.0273432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| CS476, Alternative-names: NSC302998, CAS# 41177-35-9, Formula: C24H29N3O5S, MWT: 471.56916, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Rafigrelide, Alternative-names: 3,3-Dimethylanagrelide, CAS# 1029711-88-3, Formula: C12H11Cl2N3O, MWT: 284.14124, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PI3Kα/mTOR-IN-1, Alternative-names: , CAS# 1013098-90-2, Formula: C16H18N6O, MWT: 310.35372, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;PI3K/Akt/mTOR, Target: PI3K;mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| MPC1304, Alternative-names: Sapresta;Aranidipine, CAS# 86780-90-7, Formula: C19H20N2O7, MWT: 388.3713, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Benzeneacetamide, α-cyclopentyl-3-[(2,4-dimethyl-9H-pyrido[2,3-b]indol-9-yl)methyl]-N-(2-hydroxy-1-phenylethyl)-, Alternative-names: , CAS# 177277-99-5, Formula: C35H37N3O2, MWT: 531.68718, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| R803, Alternative-names: , CAS# 67700-30-5, Formula: C17H14O3, MWT: 266.29126, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| R835, Alternative-names: S25930, CAS# 91618-36-9, Formula: C15H14FNO3, MWT: 275.2749632, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Prenyl-IN-1, Alternative-names: , CAS# 360561-53-1, Formula: C28H24ClN5O2, MWT: 497.97546, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Farnesyl Transferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| TRPV antagonist 1, Alternative-names: , CAS# 1192871-27-4, Formula: C26H21F3N2O4S, MWT: 514.5161496, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ro 41-3290, Alternative-names: , CAS# 143943-72-0, Formula: C24H21ClN2O3, MWT: 420.88814, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| NNC45-0781, Alternative-names: , CAS# 207277-66-5, Formula: C27H29NO3, MWT: 415.52406, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CCR3 antagonist 1, Alternative-names: , CAS# 879399-82-3, Formula: C19H21Cl2N3O4S2, MWT: 490.42374, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AZD 4407, Alternative-names: ZD 4407, CAS# 166882-70-8, Formula: C19H21NO3S2, MWT: 375.50494, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| 2-Pyridinamine, 5-[(2R,5S)-5-methyl-4-propyl-2-morpholinyl]-, Alternative-names: , CAS# 710655-15-5, Formula: C13H21N3O, MWT: 235.32534, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Hydrocarbon chain derivative 1, Alternative-names: 6,6'-Oxybis[2,2-dimethyl-1-hexanol], CAS# 300762-25-8, Formula: C16H34O3, MWT: 274.43936, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ACAT-IN-1 cis isomer, Alternative-names: , CAS# 145961-79-1, Formula: C29H25NO2, MWT: 419.5143, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| COX2-IN-1, Alternative-names: , CAS# 134729-13-8, Formula: C17H12FN3O2S, MWT: 341.3594832, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pyrrole-derivative1, Alternative-names: , CAS# 474006-30-9, Formula: C23H21NO4, MWT: 375.41714, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 1-Pyrrolidinecarboxylic acid, 3-acetyl-4-[3-(cyclopentyloxy)-4-methoxyphenyl]-3-methyl-, methyl ester, (3S,4S)-, Alternative-names: , CAS# 347850-26-4, Formula: C21H29NO5, MWT: 375.45866, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| 2H-Pyran-4-propanamide, α-[4-(cyclopropylsulfonyl)phenyl]-N-(5-fluoro-2-thiazolyl)tetrahydro-, (αR)-, Alternative-names: , CAS# 745051-61-0, Formula: C20H23FN2O4S2, MWT: 438.5360232, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| McN5691, Alternative-names: RWJ26240, CAS# 99254-95-2, Formula: C30H35NO3, MWT: 457.6038, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| α1 adrenoceptor-MO-1, Alternative-names: , CAS# 161905-64-2, Formula: C20H24ClN5O, MWT: 385.89046, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Benzenesulfonamide, 4-[[(6-hydroxy-4,5,7-trimethyl-2-benzothiazolyl)amino]methyl]-, Alternative-names: , CAS# 120165-51-7, Formula: C17H19N3O3S2, MWT: 377.48106, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| LH secretion antagonist 1, Alternative-names: , CAS# 88531-67-3, Formula: C18H24ClNO2, MWT: 321.84166, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| FR252384, Alternative-names: , CAS# 447405-11-0, Formula: C18H17N3, MWT: 275.34768, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Neuropeptide Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| KAT681, Alternative-names: T0681, CAS# 373641-87-3, Formula: C24H22FNNaO6, MWT: 462.42275248, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Win49375, Alternative-names: Amifloxacin, CAS# 86393-37-5, Formula: C16H19FN4O3, MWT: 334.3454632, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| S3337, Alternative-names: , CAS# 108499-48-5, Formula: C18H21N3O3S, MWT: 359.44264, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| L-Methionine, N-[2-(mercaptomethyl)-3-(2-methylphenyl)-1-oxopropyl]-, Alternative-names: , CAS# 145775-14-0, Formula: C16H23NO3S2, MWT: 341.48872, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Datelliptium chloride, Alternative-names: , CAS# 105118-14-7, Formula: C23H28ClN3O, MWT: 397.94092, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| WD2000-012547, Alternative-names: , CAS# 283172-68-9, Formula: C17H14N2O, MWT: 262.30586, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Verilopam, Alternative-names: 3H-3-Benzazepine, benzenamine deriv., CAS# 68318-20-7, Formula: C20H26N2O2, MWT: 326.43264, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| BRL44385, Alternative-names: , CAS# 114778-60-8, Formula: C8H11N5O3, MWT: 225.20464, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| A7132, Alternative-names: , CAS# 100490-21-9, Formula: C19H16F2N4O3, MWT: 386.3521464, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| H3 receptor-MO-1, Alternative-names: , CAS# 1240914-03-7, Formula: C20H27N3O2, MWT: 341.44728, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PPAR agonist 1, Alternative-names: , CAS# 539813-69-9, Formula: C20H25NO6S, MWT: 407.4806, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ST4206, Alternative-names: , CAS# 1246018-36-9, Formula: C12H14N8O, MWT: 286.29256, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tetrahydrocannabivarin, Alternative-names: O4394;THC-V, CAS# 31262-37-0, Formula: C19H26O2, MWT: 286.40854, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MAO-B-IN-1, Alternative-names: , CAS# 1124198-17-9, Formula: C16H14F3N3O2S, MWT: 369.3614696, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| Theodrenaline, Alternative-names: (±)-Theodrenaline, CAS# 13460-98-5, Formula: C17H21N5O5, MWT: 375.37914, Solubility: DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| UP202-56, Alternative-names: , CAS# 163838-04-8, Formula: C34H38N6O4, MWT: 594.70332, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CHK-IN-1, Alternative-names: , CAS# 1278405-51-8, Formula: C18H19ClFN5OS, MWT: 407.8927632, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Checkpoint Kinase (Chk), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| DPP-IV-IN-1, Alternative-names: , CAS# 625110-37-4, Formula: C11H18FN3O2, MWT: 243.2779232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Ser/Thr Protease, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| U91356, Alternative-names: , CAS# 152886-85-6, Formula: C13H17N3O, MWT: 231.29358, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 450191S, Alternative-names: , CAS# 85815-37-8, Formula: C21H21Cl3N6O3, MWT: 511.78884, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| COX/5-LO-IN-1, Alternative-names: , CAS# 154355-75-6, Formula: C16H15FN2O2S, MWT: 318.3659032, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Immunology/Inflammation, Target: 5-Lipoxygenase;COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BX341, Alternative-names: Bifluranol, CAS# 34633-34-6, Formula: C17H18F2O2, MWT: 292.3204264, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| 1-Pyrrolidineacetamide, 4-(2,2-difluoroethenyl)-α-ethyl-2-oxo-, Alternative-names: 4-(2,2-Difluoroethenyl)-α-ethyl-2-oxo-1-pyrrolidineacetamide, CAS# 357336-17-5, Formula: C10H14F2N2O2, MWT: 232.2271664, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| CDD0102, Alternative-names: CDD0102A, CAS# 146422-58-4, Formula: C8H12N4O, MWT: 180.20708, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| KF 13218, Alternative-names: , CAS# 127654-03-9, Formula: C20H20N2O3, MWT: 336.3844, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| SC40230, Alternative-names: , CAS# 116078-65-0, Formula: C22H34ClN3O2, MWT: 407.97726, Solubility: , Clinical_Information: No Development Reported, Pathway: , Target: , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Benzo[b]thiophene-2-carboximidamide, 4-fluoro-N-hydroxy-5,6-dimethoxy-, Alternative-names: , CAS# 142648-47-3, Formula: C11H11FN2O3S, MWT: 270.2800432, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PPARα-MO-1 , Alternative-names: , CAS# 810677-36-2, Formula: C27H37NO5, MWT: 455.58638, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| FG8119, Alternative-names: NNC13-8119, CAS# 106447-61-4, Formula: C17H15N5O2, MWT: 321.3333, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Zatosetron (maleate), Alternative-names: LY 277359 maleate, CAS# 123482-23-5, Formula: C23H29ClN2O6, MWT: 464.93916, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| CCR1 antagonist 1, Alternative-names: , CAS# 1010073-75-2, Formula: C22H22ClN7O2, MWT: 451.90878, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ROCK-IN-1, Alternative-names: , CAS# 934387-35-6, Formula: C20H18FN3O, MWT: 335.3748232, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SR121566A, Alternative-names: , CAS# 180144-61-0, Formula: C20H25N5O4S, MWT: 431.5086, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cytoskeleton, Target: Integrin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| PDE IV-IN-1, Alternative-names: , CAS# 225100-12-9, Formula: C20H23ClN4O2, MWT: 386.87522, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PD0176078, Alternative-names: , CAS# 248922-46-5, Formula: C23H30F2N2O, MWT: 388.4939064, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 20mg |
| L-771688, Alternative-names: , CAS# 200050-59-5, Formula: C28H33F2N5O5, MWT: 557.5889264, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MCHr1 antagonist 1, Alternative-names: , CAS# 391610-37-0, Formula: C28H33F2N5O5, MWT: 557.5889264, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
