| TCS-PIM-1-4a, CAS:327033-36-3, Molecular Weight: 273.231, C11H6F3NO2S, Purity:98, SMILES: O=C(NC/1=O)SC1=C\C2=CC=CC(C(F)(F)F)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-Trifluoromethoxy-Phenyl-Thiazole-4-Carboxylic Acid, CAS:886368-65-6, Molecular Weight: 289.23, C11H6F3NO3S, Purity:95, SMILES: OC(=O)C1=CSC(=N1)C1=CC=C(OC(F)(F)F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,5-DIAZAFLUOREN-9-ONE, CAS:50890-67-0, Molecular Weight: 182.1781, C11H6N2O, Purity:95, SMILES: O=C1C2=C(N=CC=C2)C2=C1C=CC=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5H-cyclopenta[1,2-b:5,4-b']dipyridin-5-one, CAS:50890-67-0, Molecular Weight: 182.1781, C11H6N2O, Purity:95, SMILES: O=C1c2cccnc2-c2ncccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DFO, CAS:54078-29-4, Molecular Weight: 182.1781, C11H6N2O, Purity:98, SMILES: O=C1C2=NC=CC=C2C3=CC=CN=C31, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenepentacarboxylic Acid, CAS:1585-40-6, Molecular Weight: 298.1593, C11H6O10, Purity:98, SMILES: O=C(C1=CC(C(O)=O)=C(C(O)=O)C(C(O)=O)=C1C(O)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Angelicin, CAS:523-50-2, Molecular Weight: 186.1635, C11H6O3, Purity:98, SMILES: O=C1C=CC2=CC=C(OC=C3)C3=C2O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Psoralen, CAS:66-97-7, Molecular Weight: 186.1635, C11H6O3, Purity:98, SMILES: O=C1C=CC2=CC3=C(OC=C3)C=C2O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bergaptol, CAS:486-60-2, Molecular Weight: 202.1629, C11H6O4, Purity:98, SMILES: O=C1C=CC(C(O1)=C2)=C(O)C3=C2OC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Benzyl-2,3-Dibromomaleimide, CAS:91026-00-5, Molecular Weight: 344.987, C11H7Br2NO2, Purity:95, SMILES: BrC1=C(Br)C(=O)N(CC2=CC=CC=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 6-bromo-4-chloroquinoline-2-carboxylate, CAS:887587-50-0, Molecular Weight: 300.536, C11H7BrClNO2, Purity:95, SMILES: COC(=O)c1cc(Cl)c2c(n1)ccc(c2)Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-BROMO-5H-PYRIDO[4,3-B]INDOLE, CAS:1015460-59-9, Molecular Weight: 247.091, C11H7BrN2, Purity:95, SMILES: BrC1=CC2=C(C=C1)C1=CN=CC=C1N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-[2-(4-Bromophenyl-2-Oxoethyl]Propanedinitrile, CAS:26454-82-0, Molecular Weight: 263.09, C11H7BrN2O, Purity:95, SMILES: BrC1=CC=C(C=C1)C(=O)CC(C#N)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-BROMO-2-NAPHTHALDEHYDE, CAS:3378-82-3, Molecular Weight: 235.077, C11H7BrO, Purity:95, SMILES: BrC1=C(C=O)C=CC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Bromo-2-naphthaldehyde, CAS:3378-82-3, Molecular Weight: 235.077, C11H7BrO, Purity:95, SMILES: Brc1c(C=O)ccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Bromo-1-naphthaldehyde, CAS:50672-84-9, Molecular Weight: 235.077, C11H7BrO, Purity:98, SMILES: Brc1ccc(C=O)c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Bromo-1-naphthoic acid, CAS:16650-55-8, Molecular Weight: 251.076, C11H7BrO2, Purity:97, SMILES: OC(=O)c1ccc(c2c1cccc2)Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Bromo-1-naphthoic acid, CAS:16726-67-3, Molecular Weight: 251.076, C11H7BrO2, Purity:97, SMILES: OC(=O)c1cccc2c(Br)cccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Bromo-2-naphthoic acid, CAS:5773-80-8, Molecular Weight: 251.076, C11H7BrO2, Purity:95, SMILES: OC(=O)C1=CC=C2C=C(Br)C=CC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Bromo-2-naphthoic acid, CAS:5773-80-8, Molecular Weight: 251.076, C11H7BrO2, Purity:98, SMILES: OC(=O)c1ccc2cc(Br)ccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Pyrazole-3-carboxylic acid, 4-[(2,6-dichlorobenzoyl)amino]-, CAS:825619-04-3, Molecular Weight: 300.098, C11H7Cl2N3O3, Purity:99, SMILES: O=C(c1c(Cl)cccc1Cl)Nc1c[nH]nc1C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9H-Purin-6-amine, 2-chloro-N-(3-chlorophenyl)-, CAS:190654-76-3, Molecular Weight: 280.113, C11H7Cl2N5, Purity:90, SMILES: Clc1cccc(c1)Nc1nc(Cl)nc2c1nc[nH]2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| UPF-648 (sodium salt), CAS:1465017-87-1, Molecular Weight: 281.0673, C11H7Cl2NaO3, Purity:98, SMILES: ClC1=C(Cl)C=CC(C([C@@]2([H])C[C@]2([H])C([O-])=O)=O)=C1.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenamine, 4-[(2-chloro-4-pyridinyl)oxy]-2,5-difluoro-, CAS:1225278-65-8, Molecular Weight: 256.636, C11H7ClF2N2O, Purity:95, SMILES: Clc1nccc(c1)Oc1cc(F)c(cc1F)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-Chloro-5-Phenyl-1H-Pyrrole-3-Carbonitrile, CAS:158692-52-5, Molecular Weight: 202.64, C11H7ClN2, Purity:95, SMILES: ClC1=C(C=C(N1)C1=CC=CC=C1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g.
|
| 3-CYANO-4-CHLORO-7-METHOXYQUINOLINE, CAS:73387-74-3, Molecular Weight: 218.639, C11H7ClN2O, Purity:95, SMILES: COc1ccc2c(c1)ncc(c2Cl)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-chloropyrimidin-4-yl)-1H-benzo[d]imidazole, CAS:710328-94-2, Molecular Weight: 230.653, C11H7ClN4, Purity:95, SMILES: ClC1=NC(N2C3=CC=CC=C3N=C2)=CC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(5-chlorothiophen-2-yl)benzoic acid, CAS:290326-23-7, Molecular Weight: 238.69, C11H7ClO2S, Purity:95, SMILES: OC(=O)c1ccc(cc1)-c1ccc(Cl)s1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2,4-DIFLUOROPHENYL)PYRIDINE, CAS:391604-55-0, Molecular Weight: 191.1768, C11H7F2N, Purity:95, SMILES: FC1=CC(F)=C(C=C1)C1=CC=CC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2,4-difluorophenyl)pyridine, CAS:391604-55-0, Molecular Weight: 191.1768, C11H7F2N, Purity:95, SMILES: Fc1ccc(c(F)c1)-c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2,2-Difluorobenzo[d][1,3]dioxol-5-yl)cyclopropanecarbonitrile, CAS:862574-87-6, Molecular Weight: 223.1756, C11H7F2NO2, Purity:95, SMILES: N#CC1(CC1)c1ccc2c(c1)OC(O2)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,2,2-TRIFLUORO-N-(QUINOLIN-3-YL)ACETAMIDE, CAS:352637-16-2, Molecular Weight: 240.1813, C11H7F3N2O, Purity:95, SMILES: FC(F)(F)C(=O)Nc1cnc2ccccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(2-(trifluoromethylphenyl-1H-pyrazole-3-carboxylic acid, CAS:1038770-76-1, Molecular Weight: 256.1807, C11H7F3N2O2, Purity:95, SMILES: OC(=O)C1=NNC(=C1)C1=CC=CC=C1C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(3-(trifluoromethylphenyl-1H-pyrazole-3-carboxylic acid, CAS:93618-30-5, Molecular Weight: 256.1807, C11H7F3N2O2, Purity:95, SMILES: OC(=O)C1=NNC(=C1)C1=CC(=CC=C1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(4-(trifluoromethylphenyl-1H-pyrazole-3-carboxylic acid, CAS:1038398-68-3, Molecular Weight: 256.1807, C11H7F3N2O2, Purity:95, SMILES: OC(=O)C1=NNC(=C1)C1=CC=C(C=C1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CRAC intermediate 2, CAS:123066-64-8, Molecular Weight: 295.1838, C11H7F6N3, Purity:98, SMILES: NC1=CC=C(N2N=C(C(F)(F)F)C=C2C(F)(F)F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-3-(6-fluoro-1H-indol-3-ylacrylonitrile, CAS:1316695-32-5, Molecular Weight: 186.1851, C11H7FN2, Purity:95, SMILES: FC1=CC2=C(C=C1)C(\C=C\C#N)=CN2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(3-Fluoro-4-NitrophenylPyridine, CAS:1214342-03-6, Molecular Weight: 218.1839, C11H7FN2O2, Purity:95, SMILES: [O-][N+](=O)C1=C(F)C=C(C=C1)C1=CN=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-Fluorophenyl-6-Oxo-1,6-Dihydropyrimidine-4-Carboxylic Acid, CAS:1267461-58-4, Molecular Weight: 234.1833, C11H7FN2O3, Purity:95, SMILES: OC(=O)C1=CC(=O)N=C(N1)C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| D-Luciferin potassium salt, CAS:115144-35-9, Molecular Weight: 318.41318, C11H7KN2O3S2, Purity:98, SMILES: O=C([C@@H]1N=C(C2=NC3=CC=C(O)C=C3S2)SC1)[O-].[K+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Naphthonitrile, CAS:86-53-3, Molecular Weight: 153.18, C11H7N, Purity:95, SMILES: N#Cc1cccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-ethynylisoquinoline, CAS:1415559-62-4, Molecular Weight: 153.18, C11H7N, Purity:99, SMILES: C#Cc1cccc2ccncc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| D-Luciferin (sodium salt), CAS:103404-75-7, Molecular Weight: 302.3047, C11H7N2NaO3S2, Purity:98, SMILES: O=C([C@@H]1N=C(C2=NC3=CC=C(O)C=C3S2)SC1)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1H-Indazol-1-YlThiazole-4-Carboxylic Acid, CAS:1023299-41-3, Molecular Weight: 245.257, C11H7N3O2S, Purity:95, SMILES: OC(=O)C1=CSC(=N1)N1N=CC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KDM4D-IN-1, CAS:2098902-68-0, Molecular Weight: 225.20618, C11H7N5O, Purity:98, SMILES: OC1=NC2=C(C#N)C(C)=NN2C3=C1C=CC=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Cyano-2-naphthol, CAS:52927-22-7, Molecular Weight: 169.1794, C11H7NO, Purity:95, SMILES: OC1=CC=C2C=C(C=CC2=C1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Hydroxy-2-naphthonitrile, CAS:52927-22-7, Molecular Weight: 169.1794, C11H7NO, Purity:95, SMILES: N#Cc1ccc2c(c1)ccc(c2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-NITRO-2-NAPHTHOIC ACID, CAS:103987-83-3, Molecular Weight: 217.1776, C11H7NO4, Purity:95, SMILES: OC(=O)C1=C(C2=CC=CC=C2C=C1)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
6-Quinoxalinecarboxylic acid, 2,3-bis(bromomethyl)-, CAS:32602-11-2, Molecular Weight: 360.0014, C11H8Br2N2O2, Purity:98, SMILES: O=C(C1=CC=C2N=C(CBr)C(CBr)=NC2=C1)O
, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LFM-A13, CAS:244240-24-2, Molecular Weight: 360.0014, C11H8Br2N2O2, Purity:98, SMILES: BrC1=C(NC(/C(C#N)=C(C)\O)=O)C=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,5-Dibromo-6,7-dihydro-1H-indeno[5,4-b]furan-8(2H)-one, CAS:196597-77-0, Molecular Weight: 331.988, C11H8Br2O2, Purity:98, SMILES: Brc1c(Br)c2OCCc2c2c1CCC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-Bromophenyl)pyridine, CAS:63996-36-1, Molecular Weight: 234.092, C11H8BrN, Purity:97, SMILES: Brc1ccc(cc1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Bromophenyl)pyridine, CAS:39795-60-3, Molecular Weight: 234.092, C11H8BrN, Purity:98, SMILES: Brc1ccc(cc1)-c1ccncc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Pyrrolo[2,3-b]pyridine, 5-bromo-3-(2-methyl-4-thiazolyl)-, CAS:1046793-78-5, Molecular Weight: 294.17, C11H8BrN3S, Purity:95, SMILES: Brc1cnc2c(c1)c(c[nH]2)c1csc(n1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Quinolinecarboxylic acid, 7-bromo-, methyl ester, CAS:220844-76-8, Molecular Weight: 266.091, C11H8BrNO2, Purity:96, SMILES: COC(=O)c1ccnc2cc(Br)ccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Bromo-2-Methylquinoline-4-Carboxylic Acid, CAS:37509-21-0, Molecular Weight: 266.091, C11H8BrNO2, Purity:95, SMILES: CC1=CC(C(O)=O)=C2C=C(Br)C=CC2=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Bromo-2-Methylquinoline-8-Carboxylic Acid, CAS:1334304-98-1, Molecular Weight: 266.091, C11H8BrNO2, Purity:95, SMILES: CC1=NC2=C(C=C(Br)C=C2C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 4-bromoisoquinoline-1-carboxylate, CAS:1512077-05-2, Molecular Weight: 266.091, C11H8BrNO2, Purity:95, SMILES: O=C(C1=NC=C(Br)C2=C1C=CC=C2)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(4-Bromo-phenyl)-3-methyl-isoxazole-4-carboxylic acid, CAS:91182-60-4, Molecular Weight: 282.09, C11H8BrNO3, Purity:95, SMILES: Brc1ccc(cc1)c1onc(c1C(=O)O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(4-Bromo-Phenyl-3-Methyl-Isoxazole-4-Carboxylic Acid, CAS:91182-60-4, Molecular Weight: 282.09, C11H8BrNO3, Purity:95, SMILES: CC1=NOC(=C1C(O)=O)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| UPF-648, CAS:213400-34-1, Molecular Weight: 259.0854, C11H8Cl2O3, Purity:98, SMILES: O=C([C@@H]1[C@@H](C(C2=CC=C(Cl)C(Cl)=C2)=O)C1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Chloro-6-trifluoromethyl-imidazo[1,2-a]pyridine-2-carboxylic acid ethyl ester, CAS:353258-31-8, Molecular Weight: 292.642, C11H8ClF3N2O2, Purity:95, SMILES: CCOC(=O)C1=CN2C=C(C=C(Cl)C2=N1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrimidine, 2-[4-(chloromethyl)phenyl]-5-fluoro-, CAS:1139432-30-6, Molecular Weight: 222.646, C11H8ClFN2, Purity:90, SMILES: ClCc1ccc(cc1)c1ncc(cn1)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(benzyloxy)-2-chloro-5-fluoropyrimidine, CAS:, Molecular Weight: 238.645, C11H8ClFN2O, Purity:95, SMILES: Clc1ncc(c(n1)OCc1ccccc1)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-QUINAZOLINECARBOXYLIC ACID, 6-CHLORO-5-FLUORO-3,4-DIHYDRO-4-OXO-, ETHYL ESTER, CAS:869297-83-6, Molecular Weight: 270.644, C11H8ClFN2O3, Purity:95, SMILES: CCOC(=O)c1nc2ccc(Cl)c(F)c2c(=O)[nH]1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Chloro-4-(o-carboxyphenylamino)pyrimidine, CAS:31185-80-5, Molecular Weight: 249.653, C11H8ClN3O2, Purity:95, SMILES: OC(=O)c1ccccc1Nc1ccnc(Cl)n1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-chlorophenyl)-1H-pyrrole-2-carbaldehyde, CAS:124695-22-3, Molecular Weight: 205.64, C11H8ClNO, Purity:95, SMILES: Clc1ccccc1-n1cccc1C=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(2-ChlorophenylPyridin-2(1H-One, CAS:76053-47-9, Molecular Weight: 205.64, C11H8ClNO, Purity:95, SMILES: OC1=NC=C(C=C1)C1=CC=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cycloguanil D6, CAS:, Molecular Weight: 257.7523, C11H8D6ClN5, Purity:98, SMILES: ClC1=CC=C(N2C(N)=NC(N)=NC2(C([2H])([2H])[2H])C([2H])([2H])[2H])C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E)-methyl 3-(3,5-difluoro-4-formylphenyl)acrylate, CAS:1639042-39-9, Molecular Weight: 226.1762, C11H8F2O3, Purity:95, SMILES: COC(=O)\C=C\C1=CC(F)=C(C=O)C(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cyclopropanecarboxylic acid, 1-(2,2-difluoro-1,3-benzodioxol-5-yl)-, CAS:862574-88-7, Molecular Weight: 242.1756, C11H8F2O4, Purity:95, SMILES: OC(=O)C1(CC1)c1ccc2OC(F)(F)Oc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Methyl-6-Trifluoromethyl-Quinoline, CAS:40716-16-3, Molecular Weight: 211.1831, C11H8F3N, Purity:95, SMILES: CC1=C2C=C(C=CC2=NC=C1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Hydroxy-6-Methoxy-2-(TrifluoromethylQuinoline, CAS:1701-21-9, Molecular Weight: 243.1819, C11H8F3NO2, Purity:95, SMILES: COC1=CC=C2NC(=CC(=O)C2=C1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-(Trifluoromethoxy)ethyl)isoindoline-1,3-dione, CAS:329710-82-9, Molecular Weight: 259.1813, C11H8F3NO3, Purity:95, SMILES: FC(OCCN1C(=O)c2c(C1=O)cccc2)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,5-Bis(2,2,2-trifluoroethoxy)benzoic acid, CAS:35480-52-5, Molecular Weight: 318.1692, C11H8F6O4, Purity:95, SMILES: OC(=O)c1cc(ccc1OCC(F)(F)F)OCC(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E)-3-(2-(1H-TETRAZOL-5-YL)VINYL)-6-FLUORO-1H-INDOLE, CAS:1316695-35-8, Molecular Weight: 229.2131, C11H8FN5, Purity:95, SMILES: Fc1ccc2c(\C=C\c3nnn[nH]3)c[nH]c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(2-fluorophenyl)-1H-pyrrole-3-carbaldehyde, CAS:881674-56-2, Molecular Weight: 189.1857, C11H8FNO, Purity:95, SMILES: O=Cc1c[nH]c(c1)c1ccccc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(2-fluorophenyl)-2-methylthiazole-4-carboxylic acid, CAS:522646-43-1, Molecular Weight: 237.25, C11H8FNO2S, Purity:99, SMILES: Cc1nc(C(O)=O)c(s1)-c1ccccc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD 151746, CAS:179461-52-0, Molecular Weight: 237.2501, C11H8FNO2S, Purity:98, SMILES: O=C(O)/C(S)=C/C1=CNC2=C1C=C(F)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-Oxo-2-PhenylethylMalononitrile, CAS:14476-72-3, Molecular Weight: 184.194, C11H8N2O, Purity:95, SMILES: O=C(CC(C#N)C#N)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-methoxyquinoline-7-carbonitrile, CAS:, Molecular Weight: 184.194, C11H8N2O, Purity:95, SMILES: N#CC1=CC(OC)=C2C=CC=NC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Di(pyridin-2-yl)methanone, CAS:19437-26-4, Molecular Weight: 184.194, C11H8N2O, Purity:97, SMILES: O=C(c1ccccn1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Di(pyridin-3-yl)methanone, CAS:357913-53-2, Molecular Weight: 184.194, C11H8N2O, Purity:95, SMILES: O=C(c1cccnc1)c1cccnc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tyrphostin A1, CAS:2826-26-8, Molecular Weight: 184.194, C11H8N2O, Purity:98, SMILES: , HPLC, NMR, LCMS is ok, stock more than 10g. |
| [2,2'-bipyridine]-4-carboxylic acid, CAS:1748-89-6, Molecular Weight: 200.1934, C11H8N2O2, Purity:95, SMILES: OC(=O)c1ccnc(c1)-c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [2,2'-Bipyridine]-6-carboxylic acid, CAS:4392-87-4, Molecular Weight: 200.1934, C11H8N2O2, Purity:95, SMILES: OC(=O)c1cccc(n1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(pyridin-2-yl)pyridine-3-carboxylic acid, CAS:1970-80-5, Molecular Weight: 200.1934, C11H8N2O2, Purity:95, SMILES: OC(=O)c1ccc(nc1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-oxopyridine-1-carbothioyl)pyridin-2-one, CAS:102368-13-8, Molecular Weight: 232.258, C11H8N2O2S, Purity:95, SMILES: O=C1C=CC=CN1C(=S)N1C=CC=CC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,1'-thiocarbonylbis(pyridin-2(1H)-one), CAS:102368-13-8, Molecular Weight: 232.258, C11H8N2O2S, Purity:95, SMILES: O=c1ccccn1C(=S)n1ccccc1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Hydroxy-2-Phenyl-Pyrimidine-4-Carboxylic Acid, CAS:84659-98-3, Molecular Weight: 216.1928, C11H8N2O3, Purity:95, SMILES: OC(=O)C1=CC(=O)N=C(N1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| D-Luciferin, CAS:2591-17-5, Molecular Weight: 280.3228, C11H8N2O3S2, Purity:98, SMILES: O=C([C@@H]1N=C(C2=NC3=CC=C(O)C=C3S2)SC1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Phenyl-1H-Pyrazolo[3,4-D]Pyrimidin-4-Ol, CAS:21314-17-0, Molecular Weight: 212.2074, C11H8N4O, Purity:95, SMILES: OC1=NC=NC2=C1C=NN2C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Naphthaldehyde, CAS:66-77-3, Molecular Weight: 156.1806, C11H8O, Purity:97, SMILES: O=Cc1cccc2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Naphthaldehyde, CAS:66-99-9, Molecular Weight: 156.1806, C11H8O, Purity:98, SMILES: O=Cc1ccc2c(c1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Naphthoic acid, CAS:86-55-5, Molecular Weight: 172.18, C11H8O2, Purity:98, SMILES: OC(=O)c1cccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-naphthoic acid, CAS:93-09-4, Molecular Weight: 172.18, C11H8O2, Purity:95, SMILES: OC(=O)c1ccc2ccccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Hydroxy-2-naphthaldehyde, CAS:78119-82-1, Molecular Weight: 172.18, C11H8O2, Purity:95, SMILES: OC1=CC=C2C=C(C=O)C=CC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Hydroxy-2-naphthaldehyde, CAS:78119-82-1, Molecular Weight: 172.18, C11H8O2, Purity:97, SMILES: O=Cc1ccc2c(c1)ccc(c2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Menadione, CAS:58-27-5, Molecular Weight: 172.18, C11H8O2, Purity:98, SMILES: O=C1C(C)=CC(C2=C1C=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Phenylthiophene-2-carboxylic acid, CAS:19163-24-7, Molecular Weight: 204.245, C11H8O2S, Purity:97, SMILES: OC(=O)c1ccc(s1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Hydroxy-2-naphthoic acid, CAS:86-48-6, Molecular Weight: 188.1794, C11H8O3, Purity:98, SMILES: OC(=O)c1ccc2ccccc2c1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-hydroxynaphthalene-2-carboxylic acid, CAS:1573-91-7, Molecular Weight: 188.1794, C11H8O3, Purity:99, SMILES: OC(=O)c1cc(O)c2c(c1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Hydroxy-2-naphthoic acid, CAS:16712-64-4, Molecular Weight: 188.1794, C11H8O3, Purity:95, SMILES: OC(=O)c1ccc2cc(O)ccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4μ8C, CAS:14003-96-4, Molecular Weight: 204.1788, C11H8O4, Purity:98, SMILES: O=CC1=C(O)C=CC2=C1OC(C=C2C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(bromomethyl)naphthalene, CAS:939-26-4, Molecular Weight: 221.093, C11H9Br, Purity:95, SMILES: BrCc1ccc2ccccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(6-BROMO-3,4-DIHYDRO-2(1H)-ISOQUINOLINYL)-2,2,2-TRIFLUORO-ETHANONE, CAS:252331-63-8, Molecular Weight: 308.094, C11H9BrF3NO, Purity:95, SMILES: FC(F)(F)C(=O)N1CCc2cc(Br)ccc2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(7-Bromo-3,4-Dihydro-1H-Isoquinolin-2-Yl-2,2,2-Trifluoro-Ethanone, CAS:181514-35-2, Molecular Weight: 308.094, C11H9BrF3NO, Purity:95, SMILES: FC(F)(F)C(=O)N1CCC2=CC=C(Br)C=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| METHYL 3-BROMOQUINOLIN-6-YLCARBAMATE, CAS:1799434-46-0, Molecular Weight: 281.105, C11H9BrN2O2, Purity:95, SMILES: COC(=O)Nc1ccc2ncc(Br)cc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-bromo-N-(2-methylpyridin-4-ylthiophene-2-carboxamide, CAS:1468774-80-2, Molecular Weight: 297.171, C11H9BrN2OS, Purity:95, SMILES: CC1=CC(C=CN1)=NC(=O)C1=CC=C(Br)S1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Bromo-6-methoxynaphthalene, CAS:5111-65-9, Molecular Weight: 237.093, C11H9BrO, Purity:99, SMILES: COc1ccc2cc(Br)ccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-4-(4-bromophenyl-3-methyl-4-oxobut-2-enoic acid, CAS:35504-94-0, Molecular Weight: 269.091, C11H9BrO3, Purity:95, SMILES: C\C(=C/C(O)=O)C(=O)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(chloromethyl)naphthalene, CAS:86-52-2, Molecular Weight: 176.642, C11H9Cl, Purity:95, SMILES: ClCc1cccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (5R)-BW-4030W92, CAS:189013-61-4, Molecular Weight: 287.1203632, C11H9Cl2FN4, Purity:98, SMILES: NC1=NC(CF)=[C@]([C@]2=CC=CC(Cl)=C2Cl)C(N)=N1.[R], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(3,4-dichlorophenylcyclobutanecarbonitrile, CAS:84467-19-6, Molecular Weight: 226.102, C11H9Cl2N, Purity:95, SMILES: ClC1=C(Cl)C=C(C=C1)C1(CCC1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,4-dichloro-3,6-dimethylquinoline, CAS:1936054-65-7, Molecular Weight: 226.102, C11H9Cl2N, Purity:99, SMILES: Cc1ccc2nc(Cl)c(C)c(Cl)c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD2098, CAS:566203-88-1, Molecular Weight: 334.17846, C11H9Cl2N3O3S, Purity:98, SMILES: O=S(C1=CC=CC(Cl)=C1Cl)(NC2=NC=CN=C2OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 5-chloro-7-fluoro-1H-indole-2-carboxylate, CAS:1204501-37-0, Molecular Weight: 241.646, C11H9ClFNO2, Purity:99, SMILES: CCOC(=O)c1cc2cc(Cl)cc(F)c2[nH]1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Chlorophenyl-2-Methylpyrimidine, CAS:0, Molecular Weight: 204.656, C11H9ClN2, Purity:95, SMILES: CC1=NC(=CC=N1)C1=CC=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-chloro-6-methoxy-2-phenylpyrimidine, CAS:4319-72-6, Molecular Weight: 220.655, C11H9ClN2O, Purity:95, SMILES: COC1=NC(=NC(Cl)=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4-CHLOROPHENYL)-1-METHYL-1H-PYRAZOLE-5-CARBOXYLIC ACID, CAS:1015868-48-0, Molecular Weight: 236.654, C11H9ClN2O2, Purity:95, SMILES: CN1N=C(C=C1C(O)=O)C1=CC=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 3-chloroquinoxaline-2-carboxylate, CAS:49679-45-0, Molecular Weight: 236.654, C11H9ClN2O2, Purity:97, SMILES: CCOC(=O)c1nc2ccccc2nc1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ETHYL 4-CHLOROQUINAZOLINE-6-CARBOXYLATE, CAS:155960-94-4, Molecular Weight: 236.654, C11H9ClN2O2, Purity:95, SMILES: CCOC(=O)c1ccc2ncnc(Cl)c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MTEP (hydrochloride), CAS:1186195-60-7, Molecular Weight: 236.7206, C11H9ClN2S, Purity:98, SMILES: CC1=NC(C#CC2=CC=CN=C2)=CS1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cycloguanil (D6 Nitrate), CAS:, Molecular Weight: 320.7652, C11H9D6ClN6O3, Purity:98, SMILES: #104Jzwe8SeB1mzcQlDuQl2ob4XWPfyoPfXcQj6o14TdPf2o14TdPf2oXiVo15Ll
h5zd15Llh5zdJY6n8hxo15Llh5zd15Llh5zdJY6n8hxoPfXW
, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(TRIFLUOROMETHYL)-3,4-DIHYDRO-2H-NAPHTHALEN-1-ONE, CAS:62620-71-7, Molecular Weight: 214.1838, C11H9F3O, Purity:95, SMILES: O=C1CCCc2c1ccc(c2)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-Methyl 3-(3-(TrifluoromethylPhenylAcrylate, CAS:104201-66-3, Molecular Weight: 230.1832, C11H9F3O2, Purity:95, SMILES: COC(=O)\C=C\C1=CC(=CC=C1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,4-Trifluoro-1-(3-methoxy-phenyl)-butane-1,3-dione, CAS:57965-21-6, Molecular Weight: 246.1826, C11H9F3O3, Purity:95, SMILES: COc1cccc(c1)C(=O)CC(=O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(3-FluorophenylPyridin-2-Amine, CAS:1159815-31-2, Molecular Weight: 188.201, C11H9FN2, Purity:95, SMILES: NC1=CC(=CC=N1)C1=CC(F)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-fluoro-4-(4-methyl-1H-imidazol-1-yl)benzaldehyde, CAS:937400-07-2, Molecular Weight: 204.2004, C11H9FN2O, Purity:99, SMILES: Cc1cn(cn1)-c1ccc(C=O)cc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-fluoro-4-(4-methyl-1H-imidazol-1-yl)benzoic acid, CAS:1243205-04-0, Molecular Weight: 220.1998, C11H9FN2O2, Purity:98, SMILES: Cc1cn(cn1)-c1ccc(cc1F)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 3-(2-Fluorophenyl-1H-Pyrazole-5-Carboxylate, CAS:1239717-20-4, Molecular Weight: 220.1998, C11H9FN2O2, Purity:95, SMILES: COC(=O)C1=CC(=NN1)C1=C(F)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-[3-(4-Fluorophenyl-1,2,4-Oxadiazol-5-Yl]Propanoic Acid, CAS:500025-07-0, Molecular Weight: 236.1992, C11H9FN2O3, Purity:95, SMILES: OC(=O)CCC1=NC(=NO1)C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CGP 57380, CAS:522629-08-9, Molecular Weight: 244.2278, C11H9FN6, Purity:98, SMILES: NC1=NC=NC2=C1C(NC3=CC=C(F)C=C3)N=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diatrizoic acid, CAS:117-96-4, Molecular Weight: 613.9136, C11H9I3N2O4, Purity:98, SMILES: O=C(O)C1=C(I)C(NC(C)=O)=C(I)C(NC(C)=O)=C1I, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Iotalamic acid, CAS:2276-90-6, Molecular Weight: 613.9136, C11H9I3N2O4, Purity:98, SMILES: O=C(O)C1=C(I)C(C(NC)=O)=C(I)C(NC(C)=O)=C1I, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Benzyl-5-Iodopyridazin-3(2H-One, CAS:825633-93-0, Molecular Weight: 312.1064, C11H9IN2O, Purity:95, SMILES: IC1=CC(=O)N(CC2=CC=CC=C2)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Phenylpyridine, CAS:1008-89-5, Molecular Weight: 155.1959, C11H9N, Purity:95, SMILES: c1ccc(cc1)-c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Phenylpyridine, CAS:939-23-1, Molecular Weight: 155.1959, C11H9N, Purity:95, SMILES: C1=CC=C(C=C1)C1=CC=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-1H-pyrazole-4-carbonitrile, CAS:121358-86-9, Molecular Weight: 183.2093, C11H9N3, Purity:95, SMILES: N#CC1=CN(CC2=CC=CC=C2)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methylpyrazolo[1,5-A]Quinazolin-5(4H-One, CAS:25468-50-2, Molecular Weight: 199.2087, C11H9N3O, Purity:95, SMILES: CC1=NN2C(NC(=O)C3=CC=CC=C23)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(PYRIDIN-4-YL)-2,3-DIAZABICYCLO[4.2.0]OCTA-1,5-DIEN-4-ONE, CAS:1447607-59-1, Molecular Weight: 199.2087, C11H9N3O, Purity:95, SMILES: O=c1[nH]nc2CCc2c1-c1ccncc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-amino-6-phenylpyrazine-2-carboxylic acid, CAS:84066-21-7, Molecular Weight: 215.2081, C11H9N3O2, Purity:95, SMILES: Nc1ncc(nc1C(O)=O)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(2-Oxo-1,2-dihydropyrimidin-4-yl)benzamide, CAS:26661-13-2, Molecular Weight: 215.2081, C11H9N3O2, Purity:95, SMILES: O=C(Nc1cc[nH]c(=O)n1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HIV-1 integrase inhibitor, CAS:544467-07-4, Molecular Weight: 247.2069, C11H9N3O4, Purity:98, SMILES: OC(/C(O)=C/C(C1=CC=CC(CN=[N+]=[N-])=C1)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6,6-Dioxo-5,6-Dihydro-4H-6L6-Thia-2,5,10B-Triaza-Benzo[E]Azulene-3-Carboxylic Acid, CAS:1251000-52-8, Molecular Weight: 279.272, C11H9N3O4S, Purity:95, SMILES: OC(=O)C1=C2CNS(=O)(=O)C3=CC=CC=C3N2C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Menadione bisulfite (sodium), CAS:130-37-0, Molecular Weight: 276.24, C11H9NaO5S, Purity:98, SMILES: O=S(C(CC(C1=C2C=CC=C1)=O)(C)C2=O)([O-])=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Isoquinolin-6-YlEthanone, CAS:1015070-54-8, Molecular Weight: 171.1953, C11H9NO, Purity:95, SMILES: CC(=O)C1=CC2=CC=NC=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Pyridin-2-yl)phenol, CAS:33421-36-2, Molecular Weight: 171.1953, C11H9NO, Purity:97, SMILES: Oc1ccccc1-c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methylquinoline-6-carboxaldehyde, CAS:108166-03-6, Molecular Weight: 171.1953, C11H9NO, Purity:95, SMILES: O=Cc1ccc2c(c1)ccc(n2)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Methyl-2-Quinolinecarboxaldehyde, CAS:38462-78-1, Molecular Weight: 171.1953, C11H9NO, Purity:95, SMILES: CC1=CC=C2N=C(C=O)C=CC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,2-Dihydro-7-Methyl-2-Oxo-3-Quinolinecarboxaldehyde, CAS:80231-41-0, Molecular Weight: 187.1947, C11H9NO2, Purity:95, SMILES: CC1=CC2=C(C=C1)C=C(C=O)C(=O)N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Amino-2-naphthoic acid, CAS:4919-43-1, Molecular Weight: 187.1947, C11H9NO2, Purity:95, SMILES: OC(=O)c1ccc2c(c1N)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzylpyrrole-2,5-dione, CAS:1631-26-1, Molecular Weight: 187.1947, C11H9NO2, Purity:95, SMILES: O=C1C=CC(=O)N1Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Quinolin-6-yl)acetic acid, CAS:5622-34-4, Molecular Weight: 187.1947, C11H9NO2, Purity:98, SMILES: OC(=O)Cc1ccc2ncccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methylquinoline-6-carboxylic acid, CAS:635-80-3, Molecular Weight: 187.1947, C11H9NO2, Purity:97, SMILES: Cc1ccc2c(n1)ccc(c2)C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Methylquinoline-2-Carboxylic Acid, CAS:15733-84-3, Molecular Weight: 187.1947, C11H9NO2, Purity:95, SMILES: CC1=CC=C2N=C(C=CC2=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-methoxy-3-oxo-2,3-dihydro-1H-indene-4-carbonitrile, CAS:1260009-78-6, Molecular Weight: 187.1947, C11H9NO2, Purity:90, SMILES: O=C(CC1)C2=C1C(OC)=CC=C2C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Methyl-2-Oxo-1,2-Dihydro-Quinoline-3-Carbaldehyde, CAS:101382-54-1, Molecular Weight: 187.1947, C11H9NO2, Purity:95, SMILES: CC1=CC=CC2=C1NC(=O)C(C=O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl Isoquinoline-6-Carboxylate, CAS:173089-82-2, Molecular Weight: 187.1947, C11H9NO2, Purity:95, SMILES: COC(=O)C1=CC2=CC=NC=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl quinoline-6-carboxylate, CAS:38896-30-9, Molecular Weight: 187.1947, C11H9NO2, Purity:95, SMILES: COC(=O)C1=CC=C2N=CC=CC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl quinoline-6-carboxylate, CAS:38896-30-9, Molecular Weight: 187.1947, C11H9NO2, Purity:97, SMILES: COC(=O)c1ccc2c(c1)cccn2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl Quinoline-7-Carboxylate, CAS:51552-68-2, Molecular Weight: 187.1947, C11H9NO2, Purity:95, SMILES: COC(=O)C1=CC2=C(C=CC=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl quinoline-7-carboxylate, CAS:51552-68-2, Molecular Weight: 187.1947, C11H9NO2, Purity:95, SMILES: COC(=O)c1ccc2c(c1)nccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(2-Methyl-1,3-Thiazol-4-YlBenzoic Acid, CAS:294620-60-3, Molecular Weight: 219.26, C11H9NO2S, Purity:95, SMILES: CC1=NC(=CS1)C1=CC=C(C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bethoxazin, CAS:163269-30-5, Molecular Weight: 251.3247, C11H9NO2S2, Purity:98, SMILES: O=S1C(C2=CC3=CC=CC=C3S2)=NOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| kb NB 142-70, CAS:1233533-04-4, Molecular Weight: 251.3247, C11H9NO2S2, Purity:98, SMILES: O=C1NCCSC2=C1SC3=CC=C(O)C=C32, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-(+)-N-(2,3-Epoxypropyl)phthalimide, CAS:161596-47-0, Molecular Weight: 203.1941, C11H9NO3, Purity:97, SMILES: O=C1N(C[C@@H]2OC2)C(=O)c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Indole-2-carboxylic acid, 1-acetyl-, CAS:10441-26-6, Molecular Weight: 203.1941, C11H9NO3, Purity:95, SMILES: OC(=O)c1cc2c(n1C(=O)C)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Methyl-4-Oxo-1,4-Dihydroquinoline-3-Carboxylic Acid, CAS:18471-99-3, Molecular Weight: 203.1941, C11H9NO3, Purity:95, SMILES: CN1C=C(C(O)=O)C(=O)C2=C1C=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-PHENYL-3-ISOXAZOLECARBOXYLIC ACID METHYL ESTER, CAS:51677-09-9, Molecular Weight: 203.1941, C11H9NO3, Purity:95, SMILES: COC(=O)c1cc(on1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Methoxyquinoline-2-Carboxylic Acid, CAS:75433-99-7, Molecular Weight: 203.1941, C11H9NO3, Purity:95, SMILES: COC1=CC2=CC=C(N=C2C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 2-(1H-indol-3-yl)-2-oxoacetate, CAS:18372-22-0, Molecular Weight: 203.1941, C11H9NO3, Purity:95, SMILES: COC(=O)C(=O)c1c[nH]c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 2-oxo-1,2-dihydroquinoline-4-carboxylate, CAS:39497-01-3, Molecular Weight: 203.1941, C11H9NO3, Purity:95, SMILES: COC(=O)C1=CC(O)=NC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 3-formyl-1H-indole-4-carboxylate, CAS:53462-88-7, Molecular Weight: 203.1941, C11H9NO3, Purity:95, SMILES: COC(=O)C1=C2C(C=O)=CNC2=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 4-hydroxyquinoline-2-carboxylate, CAS:5965-59-3, Molecular Weight: 203.1941, C11H9NO3, Purity:97, SMILES: COC(=O)c1cc(O)c2c(n1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1R,2R-2'-Oxospiro[Cyclopropane-1,3'-Indoline]-2-Carboxylic Acid, CAS:926667-78-9, Molecular Weight: 203.1941, C11H9NO3, Purity:95, SMILES: OC(=O)[C@@H]1C[C@@]11C(=O)NC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1R,2S-2'-Oxospiro[Cyclopropane-1,3'-Indoline]-2-Carboxylic Acid, CAS:1341035-02-6, Molecular Weight: 203.1941, C11H9NO3, Purity:95, SMILES: OC(=O)[C@H]1C[C@@]11C(=O)NC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Methyl-3-(Pyridine-2-Sulfonyl-Thiophene-2-Carbaldehyde, CAS:1258283-07-6, Molecular Weight: 267.324, C11H9NO3S2, Purity:95, SMILES: CC1=CSC(C=O)=C1S(=O)(=O)C1=CC=CC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(7-Amino-2-oxo-2H-chromen-4-yl)acetic acid, CAS:85157-21-7, Molecular Weight: 219.1935, C11H9NO4, Purity:96, SMILES: Nc1ccc2c(CC(O)=O)cc(=O)oc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(1,3-dioxoisoindolin-2-ylpropanoic acid, CAS:3339-73-9, Molecular Weight: 219.1935, C11H9NO4, Purity:95, SMILES: OC(=O)CCN1C(=O)C2=CC=CC=C2C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 5-nitrobenzo[b]furan-2-carboxylate, CAS:69604-00-8, Molecular Weight: 235.1929, C11H9NO5, Purity:95, SMILES: CCOC(=O)c1cc2c(o1)ccc(c2)[N+](=O)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3X FLAG peptide, CAS:, Molecular Weight: 2861.87, C120H169N31O49S, Purity:98, SMILES: [MDYKDHDGDYKDHDIDYKDDDDK], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Neuropeptide W-23(human), CAS:383415-79-0, Molecular Weight: 2583.02096, C120H184N34O28S, Purity:98, SMILES: OC(C=C1)=CC=C1C[C@@H](C(N[C@@H](CCCCN)C(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](C)C(N[C@@H](CO)C(N2[C@@H](CCC2)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@H](C(N[C@@H]([C@H](O)C)C(N[C@@H](C(C)C)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](C)C(NCC(N[C@@H](CC(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](CCSC)C(NCC(N[C@H](C(O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CN=CN3)=O)CC4=CC=C(O)C=C4)=O)=O)=O)=O)=O)=O)CC5=CC=CN5)=O)=O)NC([C@@H](N)CC6=CNC7=CC=CC=C67)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Motilin(human, porcine), CAS:52906-92-0, Molecular Weight: 2699.07, C120H188N34O35S, Purity:98, SMILES: [FVPIFTYGELQRMQEKERNKGQ], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dihydroergotoxine (mesylate), CAS:8067-24-1, Molecular Weight: 2314.74, C123H156N20O23S, Purity:98, SMILES: CN1C[C@H](C(N[C@@]2(C)C(N([C@@H](CC(C)C)C(N3[C@@]4([H])CCC3)=O)[C@@]4(O)O2)=O)=O)CC([C@@]1([H])C5)C6=CC=CC7=C6C5=CN7.CN8C[C@H](C(N[C@@]9(C)C(N([C@@H](C(C)C)C(N%10[C@@]%11([H])CCC%10)=O)[C@@]%11(O)O9)=O)=O)CC([C@@]8([H])C%12)C%13=CC=CC%14=C%13C%12=CN%14.CN%15C[C@H](C(N[C@@]%16(C)C(N([C@@H]([C@H](CC)C)C(N%17[C@@]%18([H])CCC%17)=O)[C@@]%18(O)O%16)=O)=O)CC([C@@]%15([H])C%19)C%20=CC=CC%21=C%20C%19=CN%21.CN%22C[C@H](C(N[C@@]%23(C)C(N([C@@H](CC%24=CC=CC=C%24)C(N%25[C@@]%26([H])CCC%25)=O)[C@@]%26(O)O%23)=O)=O)CC([C@@]%22([H])C%27)C%28=CC=CC%29=C%28C%27=CN%29.CS(O)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GLP-2(1-33)(human), CAS:223460-79-5, Molecular Weight: 2816.28428, C126H207N37O34S, Purity:98, SMILES: [HADGSFSDEMNTILDNLAARDFINWLIQTKITD], HPLC, NMR, LCMS is ok, stock more than 10g. |
| VIP(6-28)(human, rat, porcine, bovine), CAS:69698-54-0, Molecular Weight: 2816.28428, C126H207N37O34S, Purity:98, SMILES: O=C(N[C@@H](CC(C)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(C)C)C(N[C@H](C(N)=O)CC(N)=O)=O)=O)=O)=O)=O)[C@@H](NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](CCSC)NC([C@H](CCC(N)=O)NC([C@H](CCCCN)NC([C@H](CCCNC(N)=N)NC([C@H](CC(C)C)NC([C@H](CCCNC(N)=N)NC([C@@]([C@H](O)C)([H])NC([C@@H](NC([C@H](CC(N)=O)NC([C@H](CC(O)=O)NC([C@@]([C@H](O)C)([H])NC([C@@H](N)CC1=CC=CC=C1)=O)=O)=O)=O)CC2=CC=C(O)C=C2)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CC=C(O)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thymalfasin, CAS:62304-98-7, Molecular Weight: 3108.275, C129H215N33O55, Purity:98, SMILES: O=C(N[C@@H](CCC(O)=O)C(N[C@@H](C(C)C)C(N[C@@H](C(C)C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(N[C@H](C(O)=O)CC(N)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CCCCN)NC([C@H](CCCCN)NC([C@H](CCC(O)=O)NC([C@H](CCCCN)NC([C@H](CC(C)C)NC([C@H](CC(O)=O)NC([C@H](CCCCN)NC([C@H]([C@H](O)C)NC([C@H]([C@H](O)C)NC([C@H]([C@@H](C)CC)NC([C@H](CCC(O)=O)NC([C@H](CO)NC([C@H](CO)NC([C@H]([C@H](O)C)NC([C@H](CC(O)=O)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](C)NC([C@H](CC(O)=O)NC([C@H](CO)NC(C)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SN50, CAS:213546-53-3, Molecular Weight: 2781.495, C129H230N36O29S, Purity:98, SMILES: O=C(N(CCC1)[C@@H]1C(N[C@@H](C)C(N[C@@H](C(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](CC(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N(CCC2)[C@@H]2C(N[C@@H](C(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CCSC)C(N(CCC3)[C@@H]3C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC(C)C)NC([C@H](CC(C)C)NC([C@H](C)NC([C@H](C(C)C)NC([C@H](C)NC([C@@H](N)C)=O)=O)=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4'-Bromo-4-biphenylboronic acid, CAS:480996-05-2, Molecular Weight: 276.922, C12H10BBrO2, Purity:95, SMILES: Brc1ccc(cc1)c1ccc(cc1)B(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4'-Chloro-[1,1'-biphenyl]-4-yl)boronic acid, CAS:364044-44-0, Molecular Weight: 232.471, C12H10BClO2, Purity:95, SMILES: Clc1ccc(cc1)c1ccc(cc1)B(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4'-Fluorobiphenyl-4-boronic acid, CAS:140369-67-1, Molecular Weight: 216.016, C12H10BFO2, Purity:95, SMILES: Fc1ccc(cc1)c1ccc(cc1)B(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-methyl 3-(3,5-dibromo-4-hydroxyphenyl-2-(2,2,2-trifluoroacetamidopropanoate, CAS:0, Molecular Weight: 449.015, C12H10Br2F3NO4, Purity:95, SMILES: COC(=O)[C@H](CC1=CC(Br)=C(O)C(Br)=C1)NC(=O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(benzyloxy)-5-bromopyridine, CAS:83664-33-9, Molecular Weight: 264.118, C12H10BrNO, Purity:95, SMILES: Brc1ccc(OCc2ccccc2)nc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(Benzyloxy)-5-bromopyridine, CAS:130722-95-1, Molecular Weight: 264.118, C12H10BrNO, Purity:97, SMILES: Brc1cncc(c1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Bromo-N-methyl-2-naphthamide, CAS:426219-35-4, Molecular Weight: 264.118, C12H10BrNO, Purity:95, SMILES: CNC(=O)c1ccc2c(c1)ccc(c2)Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| METHYL 2-(3-BROMOQUINOLIN-6-YL)ACETATE, CAS:1393353-34-8, Molecular Weight: 280.117, C12H10BrNO2, Purity:95, SMILES: COC(=O)Cc1ccc2ncc(Br)cc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ETHYL 5-BROMO-3-FORMYL-1H-INDOLE-2-CARBOXYLATE, CAS:100123-25-9, Molecular Weight: 296.117, C12H10BrNO3, Purity:95, SMILES: CCOC(=O)C1=C(C=O)C2=C(N1)C=CC(Br)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 6-bromo-4-hydroxyquinoline-3-carboxylate, CAS:122794-99-4, Molecular Weight: 296.117, C12H10BrNO3, Purity:90, SMILES: CCOC(=O)c1cnc2c(c1O)cc(cc2)Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 6-bromo-4-oxo-1,4-dihydroquinoline-3-carboxylate, CAS:79607-23-1, Molecular Weight: 296.117, C12H10BrNO3, Purity:95, SMILES: O=C(C1=CNC2=C(C=C(Br)C=C2)C1=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 7-bromo-4-hydroxyquinoline-3-carboxylate, CAS:179943-57-8, Molecular Weight: 296.117, C12H10BrNO3, Purity:95, SMILES: CCOC(=O)c1cnc2c(c1O)ccc(c2)Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 5-(4-bromophenyl)-3-methylisoxazole-4-carboxylate, CAS:1228689-61-9, Molecular Weight: 296.117, C12H10BrNO3, Purity:99, SMILES: COC(=O)c1c(C)noc1-c1ccc(Br)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-bromo-2-(chroman-8-yl)thiazole, CAS:1415564-44-1, Molecular Weight: 296.183, C12H10BrNOS, Purity:95, SMILES: Brc1csc(n1)-c1cccc2CCCOc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,5-Bis(chloromethyl)naphthalene, CAS:1733-76-2, Molecular Weight: 225.114, C12H10Cl2, Purity:95, SMILES: ClCc1cccc2c1cccc2CCl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2,5-Dichloropyrimidin-4-ylamino)-N-methylbenzamide, CAS:761440-08-8, Molecular Weight: 297.14, C12H10Cl2N4O, Purity:95, SMILES: CNC(=O)c1ccccc1Nc1nc(Cl)ncc1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(3,4-DICHLOROPHENYL)CYCLOHEXANE-1,3-DIONE, CAS:27463-42-9, Molecular Weight: 257.113, C12H10Cl2O2, Purity:95, SMILES: Clc1ccc(cc1Cl)C1CC(=O)CC(=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(2-CHLORO-6-FLUOROPHENYL)CYCLOHEXANE-1,3-DIONE, CAS:175136-88-6, Molecular Weight: 240.658, C12H10ClFO2, Purity:95, SMILES: Fc1cccc(Cl)c1C1CC(=O)CC(=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Chlorodiphenylamine, CAS:1205-71-6, Molecular Weight: 203.668, C12H10ClN, Purity:95, SMILES: ClC1=CC=C(NC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Furosemide (sodium), CAS:41733-55-5, Molecular Weight: 352.726, C12H10ClN2NaO5S, Purity:98, SMILES: O=C([O-])C1=CC(S(=O)(N)=O)=C(Cl)C=C1NCC2=CC=CO2.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Chloro-1,8-dimethyl-imidazo[1,2-a]quinoxaline, CAS:445430-62-6, Molecular Weight: 231.681, C12H10ClN3, Purity:95, SMILES: Cc1ccc2c(c1)n1c(C)cnc1c(n2)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Forchlorfenuron, CAS:68157-60-8, Molecular Weight: 247.6803, C12H10ClN3O, Purity:98, SMILES: O=C(NC1=CC=CC=C1)NC2=CC(Cl)=NC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Benzyl-2-chloro-9H-purin-6-amine, CAS:39639-47-9, Molecular Weight: 259.694, C12H10ClN5, Purity:95, SMILES: Clc1nc(NCc2ccccc2)c2c(n1)[nH]cn2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(2-CHLORO-5-METHOXYPYRIMIDIN-4-YL)-1H-INDAZOL-6-AMINE, CAS:1447607-39-7, Molecular Weight: 275.694, C12H10ClN5O, Purity:95, SMILES: COc1cnc(Cl)nc1Nc1ccc2cn[nH]c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-chlorophenyl)(pyridin-2-yl)methanol, CAS:27652-89-7, Molecular Weight: 219.667, C12H10ClNO, Purity:99, SMILES: OC(c1ccc(Cl)cc1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(Benzyloxy-2-Chloropyridine, CAS:84611-43-8, Molecular Weight: 219.667, C12H10ClNO, Purity:95, SMILES: ClC1=NC=C(OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 4-(2-chlorophenyl)thiazole-2-carboxylate, CAS:1050507-06-6, Molecular Weight: 267.731, C12H10ClNO2S, Purity:95, SMILES: CCOC(=O)c1scc(n1)c1ccccc1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-[(BenzoylaminoMethyl]Thiophene-2-Sulfonyl Chloride, CAS:138872-44-3, Molecular Weight: 315.796, C12H10ClNO3S2, Purity:95, SMILES: ClS(=O)(=O)C1=CC=C(CNC(=O)C2=CC=CC=C2)S1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Indole-6-carboxylic acid, 1-(2-chloroacetyl)-2,3-dihydro-2-oxo-, methyl ester, CAS:1160293-25-3, Molecular Weight: 267.665, C12H10ClNO4, Purity:94, SMILES: ClCC(=O)N1C(=O)Cc2c1cc(cc2)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Quinolinecarboxylic acid, 5-chloro-1,2-dihydro-4-hydroxy-1-methyl-2-oxo-, methyl ester, CAS:637027-41-9, Molecular Weight: 267.665, C12H10ClNO4, Purity:95, SMILES: COC(=O)c1c(O)c2c(Cl)cccc2n(c1=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| METHYL 5-CHLORO-4-HYDROXY-1-METHYL-2-OXO-1,2-DIHYDROQUINOLINE-3-CARBOXYLATE, CAS:637027-41-9, Molecular Weight: 267.665, C12H10ClNO4, Purity:95, SMILES: COC(=O)C1=C(O)C2=C(Cl)C=CC=C2N(C)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Zardaverine, CAS:101975-10-4, Molecular Weight: 268.2162, C12H10F2N2O3, Purity:98, SMILES: O=C1C=CC(C2=CC=C(OC(F)F)C(OC)=C2)=NN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethanone, 2,2,2-trifluoro-1-(1,2,3,4-tetrahydronaphthalen-1,4-imin-9-yl)-, CAS:942491-77-2, Molecular Weight: 241.2091, C12H10F3NO, Purity:90, SMILES: O=C(C(F)(F)F)N1C2CCC1c1c2cccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(TrifluoromethylIndolizine-1-Carboxylic Acid Ethyl Ester, CAS:1284226-15-8, Molecular Weight: 257.2085, C12H10F3NO2, Purity:95, SMILES: CCOC(=O)C1=C2C=CC=CN2C=C1C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(TRIFLUOROMETHYL)INDOLE-2-CARBOXYLIC ACID ETHYLESTER, CAS:201929-84-2, Molecular Weight: 257.2085, C12H10F3NO2, Purity:95, SMILES: CCOC(=O)C1=CC2=CC(=CC=C2N1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2',5'-Bis(2,2,2-trifluoroethoxy)acetophenone, tech grade, CAS:76784-40-2, Molecular Weight: 316.1964, C12H10F6O3, Purity:92, SMILES: CC(=O)c1cc(ccc1OCC(F)(F)F)OCC(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethynylferrocene, CAS:1271-47-2, Molecular Weight: 210.053, C12H10Fe, Purity:95, SMILES: [Fe++].c1cc[cH-]c1.C#Cc1ccc[cH-]1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-Fluorophenyl-6,7-Dihydropyrazolo[1,5-A]Pyrazin-4(5H-One, CAS:1553968-38-9, Molecular Weight: 231.2257, C12H10FN3O, Purity:95, SMILES: FC1=CC=C(C=C1)C1=NN2CCNC(=O)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TPCA-1, CAS:507475-17-4, Molecular Weight: 279.2901, C12H10FN3O2S, Purity:98, SMILES: FC1=CC=C(C=C1)C2=CC(C(N)=O)=C(S2)NC(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-(5-Fluoropyridin-2-YlPhenylMethanol, CAS:1257426-54-2, Molecular Weight: 203.2123, C12H10FNO, Purity:95, SMILES: OCC1=CC=C(C=C1)C1=NC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(Benzyloxy-2-Fluoropyridine, CAS:1204483-95-3, Molecular Weight: 203.2123, C12H10FNO, Purity:95, SMILES: FC1=NC=C(OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Fluorobenzenesulfonimide, CAS:133745-75-2, Molecular Weight: 315.341, C12H10FNO4S2, Purity:95, SMILES: FN(S(=O)(=O)C1=CC=CC=C1)S(=O)(=O)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Fluorobenzenesulfonimide, CAS:133745-75-2, Molecular Weight: 315.341, C12H10FNO4S2, Purity:97, SMILES: FN(S(=O)(=O)c1ccccc1)S(=O)(=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(3-iodo-1H-pyrrolo[3,2-b]pyridin-6-yl)-3,5-dimethylisoxazole, CAS:1627926-81-1, Molecular Weight: 339.1318, C12H10IN3O, Purity:95, SMILES: IC1=CNC2=CC(C3=C(C)ON=C3C)=CN=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4-Vinylenedipyridine, CAS:13362-78-2, Molecular Weight: 182.2212, C12H10N2, Purity:95, SMILES: C1=CC(=CC=N1)\C=C\C1=CC=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Azobenzene, CAS:103-33-3, Molecular Weight: 182.2212, C12H10N2, Purity:98, SMILES: C1(/N=N/C2=CC=CC=C2)=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (Z-phenyl(pyridin-4-ylmethanone oxime, CAS:2147-26-4, Molecular Weight: 198.2206, C12H10N2O, Purity:95, SMILES: O\N=C(\C1=CC=CC=C1)C1=CC=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-Oxo-2-P-TolylethylMalononitrile, CAS:26454-80-8, Molecular Weight: 198.2206, C12H10N2O, Purity:95, SMILES: CC1=CC=C(C=C1)C(=O)CC(C#N)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Phenylisonicotinamide, CAS:3034-31-9, Molecular Weight: 198.2206, C12H10N2O, Purity:95, SMILES: O=C(NC1=CC=CC=C1)C1=CC=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-phenylpicolinamide, CAS:10354-53-7, Molecular Weight: 198.2206, C12H10N2O, Purity:95, SMILES: O=C(NC1=CC=CC=C1)C1=CC=CC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E)-4,4'-(diazene-1,2-diyl)diphenol, CAS:2050-16-0, Molecular Weight: 214.22, C12H10N2O2, Purity:95, SMILES: Oc1ccc(cc1)\N=N\c1ccc(O)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-Oxo-2-(4-MethoxyphenylEthylMalononitrile, CAS:26454-79-5, Molecular Weight: 214.22, C12H10N2O2, Purity:95, SMILES: COC1=CC=C(C=C1)C(=O)CC(C#N)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Methyl-2-(pyrimidin-2-yl)benzoicacid, CAS:1088994-22-2, Molecular Weight: 214.22, C12H10N2O2, Purity:95, SMILES: Cc1ccc(c(c1)C(=O)O)c1ncccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Methyl-2-(Pyrimidin-2-YlBenzoic Acid, CAS:1088994-22-2, Molecular Weight: 214.22, C12H10N2O2, Purity:95, SMILES: CC1=CC(C(O)=O)=C(C=C1)C1=NC=CC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-ethoxy-4-hydroxyquinoline-3-carbonitrile, CAS:214476-07-0, Molecular Weight: 214.22, C12H10N2O2, Purity:90, SMILES: CCOc1ccc2c(c1)ncc(c2O)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phenyl Pyridin-3-Ylcarbamate, CAS:17738-06-6, Molecular Weight: 214.22, C12H10N2O2, Purity:95, SMILES: O=C(NC1=CN=CC=C1)OC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Quinolinecarbonitrile,4-hydroxy-6-methoxy-2-(methylthio)-, CAS:131170-51-9, Molecular Weight: 246.285, C12H10N2O2S, Purity:95, SMILES: COc1ccc2[nH]c(SC)c(C#N)c(=O)c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methyl-3-Nitro-6-Phenoxypyridine, CAS:28232-35-1, Molecular Weight: 230.2194, C12H10N2O3, Purity:95, SMILES: CC1=NC(OC2=CC=CC=C2)=CC=C1[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-methoxy-2-nitro-5-phenylpyridine, CAS:152684-17-8, Molecular Weight: 230.2194, C12H10N2O3, Purity:95, SMILES: COc1cc(cnc1[N+]([O-])=O)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-ethyl 3-(4-cyano-2-nitrophenylacrylate, CAS:652997-67-6, Molecular Weight: 246.2188, C12H10N2O4, Purity:95, SMILES: CCOC(=O)\C=C\C1=C(C=C(C=C1)C#N)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cinoxacin, CAS:28657-80-9, Molecular Weight: 262.2182, C12H10N2O5, Purity:98, SMILES: O=C(C1=NN(CC)C2=C(C=C3C(OCO3)=C2)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 8-nitro-4-oxo-3,4-dihydroquinoline-3-carboxylate, CAS:94110-86-8, Molecular Weight: 262.2182, C12H10N2O5, Purity:90, SMILES: [O-][N+](=O)c1cccc2c1N=CC(C2=O)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Olanzapine EP Impurity B, CAS:221176-49-4, Molecular Weight: 230.286, C12H10N2OS, Purity:95, SMILES: Cc1sc2c(c1)c(=O)[nH]c1c([nH]2)cccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Amino-5-Benzylthiophene-3-Carbonitrile, CAS:364596-21-4, Molecular Weight: 214.286, C12H10N2S, Purity:95, SMILES: NC1=C(C=C(CC2=CC=CC=C2)S1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Azidodiphenoxyoxophosphorane, CAS:26386-88-9, Molecular Weight: 275.1999, C12H10N3O3P, Purity:97, SMILES: [N-]=[N+]=NP(=O)(Oc1ccccc1)Oc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,4-di(1H-pyrazol-4-yl)benzene, CAS:1036248-62-0, Molecular Weight: 210.2346, C12H10N4, Purity:95, SMILES: c1n[nH]cc1-c1ccc(cc1)-c1cn[nH]c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5,6-Diamino-1,10-phenanthroline, CAS:168646-54-6, Molecular Weight: 210.2346, C12H10N4, Purity:95, SMILES: Nc1c(N)c2cccnc2c2c1cccn2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-1H-Pyrazolo[3,4-D]Pyrimidin-4-Ol, CAS:35877-37-3, Molecular Weight: 226.234, C12H10N4O, Purity:95, SMILES: OC1=NC=NC2=C1C=NN2CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Win-62005, CAS:152633-54-0, Molecular Weight: 226.234, C12H10N4O, Purity:98, SMILES: O=C1NC2=NC(C)=C(C3=CC=NC=C3)C=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [1,1'-Biphenyl]-4-ol, CAS:92-69-3, Molecular Weight: 170.2072, C12H10O, Purity:97, SMILES: Oc1ccc(cc1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1'-Acetonaphthone, CAS:941-98-0, Molecular Weight: 170.2072, C12H10O, Purity:98, SMILES: CC(=O)c1cccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2'-Acetonaphthone, CAS:93-08-3, Molecular Weight: 170.2072, C12H10O, Purity:98, SMILES: CC(=O)c1ccc2ccccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Naphthaleneacetic acid, CAS:86-87-3, Molecular Weight: 186.2066, C12H10O2, Purity:98, SMILES: OC(CC1=CC=CC2=C1C=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(naphthalen-1-yl)acetic acid, CAS:86-87-3, Molecular Weight: 186.2066, C12H10O2, Purity:95, SMILES: OC(=O)Cc1cccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Phenoxyphenol, CAS:831-82-3, Molecular Weight: 186.2066, C12H10O2, Purity:97, SMILES: Oc1ccc(cc1)Oc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Methoxy-2-naphthaldehyde, CAS:3453-33-6, Molecular Weight: 186.2066, C12H10O2, Purity:98, SMILES: COc1ccc2cc(C=O)ccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Naphthalenecarboxylic acid, 4-hydroxy-, methyl ester, CAS:34205-71-5, Molecular Weight: 202.206, C12H10O3, Purity:95, SMILES: COC(=O)c1cc(O)c2c(c1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 1,4-Epoxynaphthalene-1(4H-Carboxylate, CAS:83164-95-8, Molecular Weight: 202.206, C12H10O3, Purity:95, SMILES: COC(=O)C12OC(C=C1)C1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Hydroxy-3-Methoxy-Naphthalene-2-Carboxylic Acid, CAS:1341038-04-7, Molecular Weight: 218.2054, C12H10O4, Purity:95, SMILES: COC1=C(C=C2C=CC=C(O)C2=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 4-Oxo-4H-Chromene-2-Carboxylate, CAS:14736-31-3, Molecular Weight: 218.2054, C12H10O4, Purity:95, SMILES: CCOC(=O)C1=CC(=O)C2=CC=CC=C2O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 3,5-dihydroxy-2-naphthoate, CAS:0, Molecular Weight: 218.2054, C12H10O4, Purity:95, SMILES: COC(=O)C1=C(O)C=C2C(O)=CC=CC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [1,1'-Biphenyl]-4,4'-Disulfonic Acid, CAS:5314-37-4, Molecular Weight: 314.334, C12H10O6S2, Purity:95, SMILES: OS(=O)(=O)C1=CC=C(C=C1)C1=CC=C(C=C1)S(O)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,2-Diphenyldisulfane, CAS:882-33-7, Molecular Weight: 218.338, C12H10S2, Purity:98, SMILES: S(Sc1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [1,1'-Biphenyl]-3-ylboronic acid, CAS:5122-95-2, Molecular Weight: 198.026, C12H11BO2, Purity:97, SMILES: OB(c1cccc(c1)c1ccccc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [1,1'-Biphenyl]-4-ylboronic acid, CAS:5122-94-1, Molecular Weight: 198.026, C12H11BO2, Purity:95, SMILES: OB(c1ccc(cc1)c1ccccc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Biphenylboronic acid, CAS:4688-76-0, Molecular Weight: 198.026, C12H11BO2, Purity:95, SMILES: OB(c1ccccc1c1ccccc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Biphenylboronic acid(contains of Anhydride), CAS:5122-94-1, Molecular Weight: 198.026, C12H11BO2, Purity:95, SMILES: OB(O)C1=CC=C(C=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Phenoxybenzeneboronic acid, CAS:108238-09-1, Molecular Weight: 214.025, C12H11BO3, Purity:99, SMILES: OB(O)c1ccccc1Oc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Phenoxyphenylboronic acid, CAS:108238-09-1, Molecular Weight: 214.025, C12H11BO3, Purity:95, SMILES: OB(O)C1=CC=CC=C1OC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Phenoxyphenylboronic acid, CAS:51067-38-0, Molecular Weight: 214.025, C12H11BO3, Purity:95, SMILES: OB(c1ccc(cc1)Oc1ccccc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-3-bromopyridinium bromide, CAS:928828-19-7, Molecular Weight: 329.03, C12H11Br2N, Purity:95, SMILES: Brc1ccc[n+](c1)Cc1ccccc1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-4-bromopyridin-1-ium bromide, CAS:2589-30-2, Molecular Weight: 329.03, C12H11Br2N, Purity:95, SMILES: Brc1cc[n+](cc1)Cc1ccccc1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Butanoic acid, 5-bromo-4-chloro-1H-indol-3-yl ester, CAS:129541-43-1, Molecular Weight: 316.578, C12H11BrClNO2, Purity:99, SMILES: CCCC(=O)Oc1c[nH]c2ccc(Br)c(Cl)c12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Benzyl-5-Bromopyridin-2-Amine, CAS:280116-83-8, Molecular Weight: 263.133, C12H11BrN2, Purity:95, SMILES: BrC1=CNC(C=C1)=NCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(Benzyloxy)-5-bromopyridin-2-amine, CAS:754230-78-9, Molecular Weight: 279.133, C12H11BrN2O, Purity:95, SMILES: Brc1cnc(c(c1)OCc1ccccc1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 1-(4-Bromophenyl-1H-Imidazole-5-Carboxylate, CAS:911641-38-8, Molecular Weight: 295.132, C12H11BrN2O2, Purity:95, SMILES: CCOC(=O)C1=CN=CN1C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(3-broMophenyl)-1,3-Cyclohexanedione, CAS:144128-71-2, Molecular Weight: 267.119, C12H11BrO2, Purity:95, SMILES: Brc1cccc(c1)C1CC(=O)CC(=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(4-BROMOPHENYL)CYCLOHEXANE-1,3-DIONE, CAS:239132-48-0, Molecular Weight: 267.119, C12H11BrO2, Purity:95, SMILES: Brc1ccc(cc1)C1CC(=O)CC(=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 1-(4-bromophenyl)-3-oxocyclobutanecarboxylate, CAS:, Molecular Weight: 283.118, C12H11BrO3, Purity:95, SMILES: O=C(C1(C2=CC=C(Br)C=C2)CC(C1)=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rafigrelide, CAS:1029711-88-3, Molecular Weight: 284.14124, C12H11Cl2N3O, Purity:98, SMILES: O=C1NC2=NC3=C(C(Cl)=C(Cl)C=C3)CN2C1(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,5-Dichloro-N-(1,1-dimethylpropynyl)benzamide, CAS:23950-58-5, Molecular Weight: 256.128, C12H11Cl2NO, Purity:95, SMILES: C#CC(NC(=O)c1cc(Cl)cc(c1)Cl)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3-fluoro-4-(2-fluoropyridin-4-yl)phenyl)methanamine hydrochloride, CAS:1449117-60-5, Molecular Weight: 256.679, C12H11ClF2N2, Purity:95, SMILES: Cl.NCC1=CC(F)=C(C=C1)C1=CC(F)=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,10-Phenanthroline monohydrochloride monohydrate, CAS:18851-33-7, Molecular Weight: 234.682, C12H11ClN2O, Purity:95, SMILES: c1ccc2c(n1)c1ncccc1cc2.O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-chloro-4-(pyridin-2-ylmethoxy)aniline, CAS:524955-09-7, Molecular Weight: 234.682, C12H11ClN2O, Purity:98, SMILES: Nc1ccc(OCc2ccccn2)c(Cl)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 3-(4-Chlorophenyl-1H-Pyrazole-5-Carboxylate, CAS:595610-40-5, Molecular Weight: 250.681, C12H11ClN2O2, Purity:95, SMILES: CCOC(=O)C1=NNC(=C1)C1=CC=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| O4I2, CAS:165682-93-9, Molecular Weight: 282.7459, C12H11ClN2O2S, Purity:98, SMILES: O=C(C1=CSC(NC2=CC=C(Cl)C=C2)=N1)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Furosemide, CAS:54-31-9, Molecular Weight: 330.7441, C12H11ClN2O5S, Purity:98, SMILES: O=C(O)C1=CC(S(=O)(N)=O)=C(Cl)C=C1NCC2=CC=CO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Allyl-4-(2-ChlorophenylThiazol-2-Amine, CAS:21344-92-3, Molecular Weight: 250.747, C12H11ClN2S, Purity:95, SMILES: ClC1=CC=CC=C1C1=CSC(N1)=NCC=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrrolo[2,1-f][1,2,4]triazin-4-amine, 2-chloro-N-(5-cyclopropyl-1H-pyrazol-3-yl)-, CAS:918538-08-6, Molecular Weight: 274.709, C12H11ClN6, Purity:90, SMILES: Clc1nc(Nc2n[nH]c(c2)C2CC2)c2n(n1)ccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(((2R,3S)-2-(2,4-difluorophenyl)-3-methyloxiran-2-yl)methyl)-1H-1,2,4-triazole, CAS:127000-90-2, Molecular Weight: 251.232, C12H11F2N3O, Purity:95, SMILES: C[C@@H]1O[C@@]1(Cn1cncn1)c1ccc(F)cc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (6R-3,5,5-Trifluoro-6-(2-Fluorophenyl-6-Methylpiperidin-2-One, CAS:0, Molecular Weight: 261.2155, C12H11F4NO, Purity:95, SMILES: C[C@@]1(NC(=O)C(F)CC1(F)F)C1=CC=CC=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 3-(4-Fluorophenyl-1H-Pyrazole-5-Carboxylate, CAS:866588-11-6, Molecular Weight: 234.2263, C12H11FN2O2, Purity:95, SMILES: CCOC(=O)C1=NNC(=C1)C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Amino-6-(4-fluorobenzylamino)-3-nitropyridine, CAS:33400-49-6, Molecular Weight: 262.2397, C12H11FN4O2, Purity:97, SMILES: Fc1ccc(cc1)CNc1ccc(c(n1)N)[N+](=O)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(5-Iodo-Pyridin-2-Yl-4-Methyl-Benzenesulfonamide, CAS:209971-43-7, Molecular Weight: 374.197, C12H11IN2O2S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)NC1=CC=C(I)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(5-iodo-2-methylbenzyl)thiophene, CAS:, Molecular Weight: 314.185, C12H11IS, Purity:95, SMILES: CC1=CC=C(I)C=C1CC2=CC=CS2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(P-Tolyl)pyridine, CAS:937735, Molecular Weight: 169.2224, C12H11N, Purity:97, SMILES: Cc1ccc(cc1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Aminobiphenyl, CAS:90-41-5, Molecular Weight: 169.2224, C12H11N, Purity:98, SMILES: Nc1ccccc1c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Aminobiphenyl, CAS:2243-47-2, Molecular Weight: 169.2224, C12H11N, Purity:95, SMILES: Nc1cccc(c1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Aminobiphenyl, CAS:92-67-1, Molecular Weight: 169.2224, C12H11N, Purity:95, SMILES: NC1=CC=C(C2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TCN238, CAS:125404-04-8, Molecular Weight: 197.2358, C12H11N3, Purity:98, SMILES: NC1=NC=CC(/C=C/C2=CC=CC=C2)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,5-dimethyl-4-(1H-pyrrolo[3,2-b]pyridin-6-yl)isoxazole, CAS:1627925-75-0, Molecular Weight: 213.2352, C12H11N3O, Purity:95, SMILES: CC1=C(C2=CN=C(C=CN3)C3=C2)C(C)=NO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PHA-767491, CAS:845714-00-3, Molecular Weight: 213.2352, C12H11N3O, Purity:98, SMILES: O=C1C2=C(NC(C3=CC=NC=C3)=C2)CCN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PluriSln 1, CAS:91396-88-2, Molecular Weight: 213.2352, C12H11N3O, Purity:98, SMILES: O=C(C1=CC=NC=C1)NNC2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 3-amino-6-phenylpyrazine-2-carboxylate, CAS:1503-42-0, Molecular Weight: 229.2346, C12H11N3O2, Purity:95, SMILES: COC(=O)c1nc(cnc1N)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-methyl-2-nitro-5-phenylpyridin-3-amine, CAS:152684-14-5, Molecular Weight: 229.2346, C12H11N3O2, Purity:95, SMILES: CNc1cc(cnc1[N+]([O-])=O)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(2-Methyl-4-NitrophenoxyPyridin-2-Amine, CAS:864244-98-4, Molecular Weight: 245.234, C12H11N3O3, Purity:95, SMILES: CC1=CC(=CC=C1OC1=CC(=N)NC=C1)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Carbamoyl-3,6,7,8-Tetrahydropyrrolo[3,2-E]Indole-2-Carboxylic Acid, CAS:105518-47-6, Molecular Weight: 245.234, C12H11N3O3, Purity:95, SMILES: NC(=O)N1CCC2=C1C=CC1=C2C=C(N1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Oxo-5-(Thiophen-2-Ylmethyl-4,5,6,7-Tetrahydropyrazolo[1,5-A]Pyrazine-3-Carboxylic Acid, CAS:685106-60-9, Molecular Weight: 277.299, C12H11N3O3S, Purity:95, SMILES: OC(=O)C1=C2N(CCN(CC3=CC=CS3)C2=O)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Benzylaminopurine, CAS:1214-39-7, Molecular Weight: 225.2492, C12H11N5, Purity:98, SMILES: C12=NC=NC(NCC3=CC=CC=C3)=C1NC=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(Benzyloxy)-7H-purin-2-amine, CAS:19916-73-5, Molecular Weight: 241.2486, C12H11N5O, Purity:98, SMILES: Nc1nc(OCc2ccccc2)c2c(n1)nc[nH]2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-O-Benzylguanine, CAS:19916-73-5, Molecular Weight: 241.2486, C12H11N5O, Purity:95, SMILES: N=C1NC2=C(N=CN2)C(OCC2=CC=CC=C2)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Triamterene, CAS:396-01-0, Molecular Weight: 253.2626, C12H11N7, Purity:98, SMILES: NC1=NC(N)=C2N=C(C3=CC=CC=C3)C(N)=NC2=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(Quinolin-6-yl)propanal, CAS:476660-18-1, Molecular Weight: 185.2218, C12H11NO, Purity:95, SMILES: O=CCCc1ccc2c(c1)cccn2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-methyl-2,3-dihydrocyclopenta[b]indol-1(4H)-one, CAS:50776-26-6, Molecular Weight: 185.2218, C12H11NO, Purity:95, SMILES: O=C1CCc2c1c1ccccc1n2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Phenoxyaniline, CAS:139-59-3, Molecular Weight: 185.2218, C12H11NO, Purity:98, SMILES: Nc1ccc(Oc2ccccc2)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-methyl-1-phenylpyridin-2(1H)-one, CAS:53179-13-8, Molecular Weight: 185.2218, C12H11NO, Purity:95, SMILES: Cc1ccc(=O)n(c1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pirfenidone, CAS:53179-13-8, Molecular Weight: 185.2218, C12H11NO, Purity:98, SMILES: O=C1C=CC(C)=CN1C2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-3-(6-Methyl-1H-Indol-3-YlAcrylic Acid, CAS:151590-36-2, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CC1=CC2=C(C=C1)C(\C=C\C(O)=O)=CN2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-Ethyl 3-(2-CyanophenylAcrylate, CAS:223567-59-7, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CCOC(=O)\C=C\C1=CC=CC=C1C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-Ethyl 3-(4-CyanophenylAcrylate, CAS:20655-58-7, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CCOC(=O)C=CC1=CC=C(C=C1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,3-DIACETYLINDOLE, CAS:17537-64-3, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CC(=O)N1C=C(C(C)=O)C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2(1H)-Pyridinone, 4-(phenylmethoxy)-, CAS:53937-02-3, Molecular Weight: 201.2212, C12H11NO2, Purity:98, SMILES: Oc1cc(OCc2ccccc2)ccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,3,6,7-tetrahydroazepino[3,2,1-hi]indole-1,4-dione, CAS:73356-94-2, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: O=C1CN2C3=C1C=CC=C3CCCC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,3,6,7-Tetrahydroazepino[3,2,1-hi]indole-1,4-dione, CAS:73356-94-2, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: O=C1CCCc2c3N1CC(=O)c3ccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Benzyloxy)pyridine N-oxide, CAS:2683-66-1, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: [O-][n+]1ccc(cc1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5,6-dihydro-4H-pyrrolo[3,2,1-ij]quinoline-1-carboxylic acid, CAS:124730-56-9, Molecular Weight: 201.2212, C12H11NO2, Purity:91, SMILES: OC(=O)c1cn2c3c1cccc3CCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Hydroxy-N-methyl-1-naphthamide, CAS:847802-91-9, Molecular Weight: 201.2212, C12H11NO2, Purity:97, SMILES: CNC(=O)c1cccc2c1ccc(c2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 6-quinolinecarboxylate, CAS:73987-38-9, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CCOC(=O)c1ccc2c(c1)cccn2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl isoquinoline-3-carboxylate, CAS:50458-79-2, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CCOC(=O)c1ncc2c(c1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl Isoquinoline-6-Carboxylate, CAS:188861-58-7, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CCOC(=O)C1=CC2=CC=NC=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ETHYL QUINOLINE-2-CARBOXYLATE, CAS:4491-33-2, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CCOC(=O)C1=NC2=CC=CC=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl Quinoline-5-Carboxylate, CAS:98421-25-1, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CCOC(=O)C1=CC=CC2=NC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl quinoline-7-carboxylate, CAS:, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: CCOC(=O)c1ccc2c(c1)nccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 2-methylquinoline-6-carboxylate, CAS:108166-01-4, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: COC(=O)c1ccc2c(c1)ccc(n2)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 8-methylquinoline-7-carboxylate, CAS:1030846-94-6, Molecular Weight: 201.2212, C12H11NO2, Purity:95, SMILES: COC(=O)c1ccc2c(c1C)nccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methyl-4-(4-Methylphenyl-5-Thiazolecarboxylic Acid, CAS:1007873-56-4, Molecular Weight: 233.286, C12H11NO2S, Purity:95, SMILES: CC1=NC(=C(S1)C(O)=O)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3-Oxobutyl-1H-Isoindole-1,3(2H-Dione, CAS:3783-77-5, Molecular Weight: 217.2206, C12H11NO3, Purity:95, SMILES: CC(=O)CCN1C(=O)C2=C(C=CC=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,4-dimethoxyquinoline-3-carbaldehyde, CAS:51179-18-1, Molecular Weight: 217.2206, C12H11NO3, Purity:90, SMILES: COc1nc2ccccc2c(OC)c1C=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Quinolinecarboxylic acid, 1,4-dihydro-4-oxo-, ethyl ester, CAS:52980-28-6, Molecular Weight: 217.2206, C12H11NO3, Purity:99, SMILES: CCOC(=O)c1c[nH]c2ccccc2c1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(1,3-Dioxoisoindolin-2-YlButanal, CAS:3598-60-5, Molecular Weight: 217.2206, C12H11NO3, Purity:95, SMILES: O=CCCCN1C(=O)C2=CC=CC=C2C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5,7-DIMETHOXYQUINOLINE-3-CARBALDEHYDE, CAS:363135-56-2, Molecular Weight: 217.2206, C12H11NO3, Purity:95, SMILES: COC1=CC2=C(C=C(C=O)C=N2)C(OC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CID755673, CAS:521937-07-5, Molecular Weight: 217.2206, C12H11NO3, Purity:98, SMILES: O=C1NCCCC2=C1OC3=CC=C(O)C=C32, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CID-797718, CAS:370586-05-3, Molecular Weight: 217.2206, C12H11NO3, Purity:98, SMILES: O=C1OC2=CC=C(O)C=C2C3=C1NCCC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(1,3-Dioxoisoindolin-2-YlButanoic Acid, CAS:3130-75-4, Molecular Weight: 233.22, C12H11NO4, Purity:95, SMILES: OC(=O)CCCN1C(=O)C2=CC=CC=C2C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Quinolinecarboxylic acid, 1,2-dihydro-4-hydroxy-5-methoxy-1-methyl-2-oxo-, CAS:248282-18-0, Molecular Weight: 249.2194, C12H11NO5, Purity:95, SMILES: COc1cccc2c1c(O)c(C(=O)O)c(=O)n2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(Benzyloxycarbonyloxy)succinimide, CAS:13139-17-8, Molecular Weight: 249.2194, C12H11NO5, Purity:97, SMILES: O=C(ON1C(=O)CCC1=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 10058-F4, CAS:403811-55-2, Molecular Weight: 249.3518, C12H11NOS2, Purity:98, SMILES: O=C1NC(S/C1=C/C2=CC=C(CC)C=C2)=S, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diphenylphosphine oxide, CAS:4559-70-0, Molecular Weight: 202.1889, C12H11OP, Purity:97, SMILES: O=P(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,7-Dimethylnaphthalene, CAS:582-16-1, Molecular Weight: 156.2237, C12H12, Purity:95, SMILES: CC1=CC2=CC(C)=CC=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Naphthalene, 6-ethynyl-1,2,3,4-tetrahydro-, CAS:408320-46-7, Molecular Weight: 156.2237, C12H12, Purity:95, SMILES: C#Cc1ccc2c(c1)CCCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [1,1'-Biphenyl]-4,4'-diyldiboronic acid, CAS:4151-80-8, Molecular Weight: 241.843, C12H12B2O4, Purity:95, SMILES: OB(c1ccc(cc1)c1ccc(cc1)B(O)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [4-(4-boronophenyl)phenyl]boronic acid, CAS:4151-80-8, Molecular Weight: 241.843, C12H12B2O4, Purity:95, SMILES: OB(O)C1=CC=C(C=C1)C1=CC=C(C=C1)B(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-BromophenylCyclopentanecarbonitrile, CAS:143328-19-2, Molecular Weight: 250.134, C12H12BrN, Purity:95, SMILES: BrC1=CC=C(C=C1)C1(CCCC1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ro-15-2041, CAS:77448-87-4, Molecular Weight: 294.14718, C12H12BrN3O, Purity:98, SMILES: O=C1N=C2NC3=C(C(C)=C(Br)C=C3)CN2C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 1-(6-bromopyridin-2-yl)-5-methyl-1H-pyrazole-4-carboxylate, CAS:1536648-98-2, Molecular Weight: 310.147, C12H12BrN3O2, Purity:95, SMILES: Cc1c(cnn1c1cccc(n1)Br)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-3-(3-BromobenzylidenePiperidin-2-One, CAS:0, Molecular Weight: 266.134, C12H12BrNO, Purity:95, SMILES: BrC1=CC=CC(\C=C2/CCCNC2=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-BromophenylOxane-4-Carbonitrile, CAS:1000705-54-3, Molecular Weight: 266.134, C12H12BrNO, Purity:95, SMILES: BrC1=CC=C(C=C1)C1(CCOCC1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-bromobenzoyl)piperidin-4-one, CAS:885274-92-0, Molecular Weight: 282.133, C12H12BrNO2, Purity:95, SMILES: Brc1ccc(cc1)C(=O)N1CCC(=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-bromobutyl)isoindoline-1,3-dione, CAS:5394-18-3, Molecular Weight: 282.133, C12H12BrNO2, Purity:95, SMILES: BrCCCCN1C(=O)c2ccccc2C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-4-(2,7-dichloropyrido[2,3-d]pyrimidin-4-yl)-3-methylmorpholine, CAS:1009303-42-7, Molecular Weight: 299.156, C12H12Cl2N4O, Purity:95, SMILES: C[C@H]1COCCN1c1nc(Cl)nc2c1ccc(n2)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PHA-767491 (hydrochloride), CAS:942425-68-5, Molecular Weight: 249.6962, C12H12ClN3O, Purity:98, SMILES: O=C1C2=C(NC(C3=CC=NC=C3)=C2)CCN1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6H-Purin-6-one, 2-amino-1,7-dihydro-7-(phenylmethyl)- (hydrochloride)(1:1), CAS:20755-15-1, Molecular Weight: 277.71, C12H12ClN5O, Purity:95, SMILES: Nc1nc2ncn(c2c(=O)[nH]1)Cc1ccccc1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dansyl chloride, CAS:605-65-2, Molecular Weight: 269.7472, C12H12ClNO2S, Purity:98, SMILES: O=S(C1=C2C=CC=C(N(C)C)C2=CC=C1)(Cl)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Albendazole sulfoxide D3, CAS:1448346-38-0, Molecular Weight: 284.3493, C12H12D3N3O3S, Purity:98, SMILES: CCCS(C1=CC=C(NC(NC(OC([2H])([2H])[2H])=O)=N2)C2=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,2R)-Ethyl 2-(3,4-difluorophenyl)cyclopropanecarboxylate, CAS:1006376-61-9, Molecular Weight: 226.2193, C12H12F2O2, Purity:90, SMILES: CCOC(=O)[C@@H]1C[C@H]1c1ccc(c(c1)F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| benzyl 3,3-difluorocyclobutane-1-carboxylate, CAS:935273-86-2, Molecular Weight: 226.2193, C12H12F2O2, Purity:95, SMILES: O=C(C1CC(C1)(F)F)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-(6-methyl-1,2,4,5-tetrazin-3-yl)phenyl)methanamine trifluoroacetic acid, CAS:1466420-02-9, Molecular Weight: 315.2512, C12H12F3N5O2, Purity:95, SMILES: NCC1=CC=C(C2=NN=C(C)N=N2)C=C1.FC(F)(C(O)=O)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BMS-538203, CAS:543730-41-2, Molecular Weight: 269.2258, C12H12FNO5, Purity:98, SMILES: O=C(O)/C(O)=C/C(N(CC1=CC=C(F)C=C1)OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-iodophenyl)-2,5-dimethyl-1H-pyrrole, CAS:288608-09-3, Molecular Weight: 297.1349, C12H12IN, Purity:95, SMILES: Ic1ccc(cc1)n1c(C)ccc1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,3-Dihydro-1H-cyclopenta[b]quinolin-9-ylamine, CAS:18528-78-4, Molecular Weight: 184.2371, C12H12N2, Purity:95, SMILES: Nc1c2CCCc2nc2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4'-Dimethyl-2,2'-bipyridine, CAS:1134-35-6, Molecular Weight: 184.2371, C12H12N2, Purity:98, SMILES: Cc1ccnc(c1)c1nccc(c1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4-Dimethyl-2,2-bipyridyl, CAS:1134-35-6, Molecular Weight: 184.2371, C12H12N2, Purity:95, SMILES: CC1=CC(=NC=C1)C1=NC=CC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5,5'-Dimethyl-2,2'-dipyridyl, CAS:1762-34-1, Molecular Weight: 184.2371, C12H12N2, Purity:95, SMILES: Cc1ccc(nc1)c1ccc(cn1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6,6'-Dimethyl-2,2'-bipyridyl, CAS:4411-80-7, Molecular Weight: 184.2371, C12H12N2, Purity:95, SMILES: Cc1cccc(n1)c1cccc(n1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6,6-Dimethyl-2,2-dipyridyl, CAS:4411-80-7, Molecular Weight: 184.2371, C12H12N2, Purity:95, SMILES: CC1=NC(=CC=C1)C1=CC=CC(C)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-NaphthylAcetamidoxime, CAS:925252-83-1, Molecular Weight: 200.2365, C12H12N2O, Purity:95, SMILES: ONC(=N)CC1=CC=CC2=C1C=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(benzyloxy)pyridin-2-amine, CAS:24016-03-3, Molecular Weight: 200.2365, C12H12N2O, Purity:95, SMILES: Nc1ncccc1OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Benzyloxy)pyridin-2-amine, CAS:85333-26-2, Molecular Weight: 200.2365, C12H12N2O, Purity:97, SMILES: Nc1nccc(c1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Methyl-6-Phenoxypyridin-3-Amine, CAS:1501708-26-4, Molecular Weight: 200.2365, C12H12N2O, Purity:95, SMILES: CC1=CC(OC2=CC=CC=C2)=NC=C1N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ARN2966, CAS:102212-26-0, Molecular Weight: 200.2365, C12H12N2O, Purity:98, SMILES: OC1=CC=CC=C1NCC2=NC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (5-(BenzyloxyPyrimidin-2-YlMethanol, CAS:132259-99-5, Molecular Weight: 216.2359, C12H12N2O2, Purity:95, SMILES: OCC1=NC=C(OCC2=CC=CC=C2)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [2,2'-Bipyridine]-4,4'-diyldimethanol, CAS:109073-77-0, Molecular Weight: 216.2359, C12H12N2O2, Purity:95, SMILES: OCc1ccnc(c1)c1nccc(c1)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,3,4,9-Tetrahydro-1H-b-carboline-1-carboxylic acid, CAS:102991-38-8, Molecular Weight: 216.2359, C12H12N2O2, Purity:98, SMILES: OC(=O)C1NCCc2c1[nH]c1ccccc21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methyl-1,6-Naphthyridine-3-Carboxylic Ethyl Ester, CAS:52816-67-8, Molecular Weight: 216.2359, C12H12N2O2, Purity:95, SMILES: CCOC(=O)C1=CC2=C(C=CN=C2)N=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-methoxy-4-(4-methyl-1H-imidazol-1-yl)benzaldehyde, CAS:870837-18-6, Molecular Weight: 216.2359, C12H12N2O2, Purity:99, SMILES: COc1cc(C=O)ccc1-n1cnc(C)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4'-dimethoxy-2,2'-bipyridine, CAS:17217-57-1, Molecular Weight: 216.2359, C12H12N2O2, Purity:95, SMILES: COc1ccnc(c1)-c1cc(OC)ccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4-DIMETHOXY-2,2-BIPYRIDINE, CAS:17217-57-1, Molecular Weight: 216.2359, C12H12N2O2, Purity:95, SMILES: COC1=CC(=NC=C1)C1=NC=CC(OC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(4-Methoxyphenyl-1-Methyl-1H-Pyrazole-4-Carbaldehyde, CAS:689250-54-2, Molecular Weight: 216.2359, C12H12N2O2, Purity:95, SMILES: COC1=CC=C(C=C1)C1=C(C=O)C=NN1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 3-Phenyl-1H-Pyrazole-5-Carboxylate, CAS:13599-12-7, Molecular Weight: 216.2359, C12H12N2O2, Purity:95, SMILES: CCOC(=O)C1=NNC(=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ETHYL 8-AMINOQUINOLINE-3-CARBOXYLATE, CAS:190138-00-2, Molecular Weight: 216.2359, C12H12N2O2, Purity:95, SMILES: CCOC(=O)c1cnc2c(c1)cccc2N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl-3-Phenyl Pyrazole-4-Carboxylate, CAS:181867-24-3, Molecular Weight: 216.2359, C12H12N2O2, Purity:95, SMILES: CCOC(=O)C1=CNN=C1C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dapsone, CAS:80-08-0, Molecular Weight: 248.3009, C12H12N2O2S, Purity:98, SMILES: O=S(C1=CC=C(N)C=C1)(C2=CC=C(N)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Methyl-3-(3-Nitropyridin-4-YlCyclohex-2-Enone, CAS:1187055-95-3, Molecular Weight: 232.2353, C12H12N2O3, Purity:95, SMILES: CC1CC(=O)C=C(C1)C1=CC=NC=C1[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nalidixic acid, CAS:389-08-2, Molecular Weight: 232.2353, C12H12N2O3, Purity:98, SMILES: O=C(C1=CN(CC)C2=C(C=CC(C)=N2)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-ethyl 5-methyl pyrazolo[1,5-a]pyridine-3,5-dicarboxylate, CAS:1101120-00-6, Molecular Weight: 248.2347, C12H12N2O4, Purity:95, SMILES: CCOC(=O)C1=C2C=C(C=CN2N=C1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SPDP, CAS:68181-17-9, Molecular Weight: 312.3647, C12H12N2O4S2, Purity:98, SMILES: O=C(ON1C(CCC1=O)=O)CCSSC2=NC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-Methoxy-Benzyl-3-(5-Nitro-Thiazol-2-Yl-Urea, CAS:487021-52-3, Molecular Weight: 308.313, C12H12N4O4S, Purity:95, SMILES: COC1=CC=C(CNC(=O)NC2=NC=C(S2)[N+]([O-])=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AR-A014418, CAS:487021-52-3, Molecular Weight: 308.3131, C12H12N4O4S, Purity:98, SMILES: O=C(NCC1=CC=C(OC)C=C1)NC2=NC=C([N+]([O-])=O)S2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Benzimidazole-7-carbonitrile, 5-[(4,5-dihydro-1H-imidazol-2-yl)amino]-4-methyl-, CAS:226081-74-9, Molecular Weight: 240.26388, C12H12N6, Purity:98, SMILES: N#CC1=C2NC=NC2=C(C)C(NC3=NCCN3)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ADX88178, CAS:1235318-89-4, Molecular Weight: 272.3289, C12H12N6S, Purity:98, SMILES: CC1=C(C2=CNN=C2)N=C(NC3=NC=CC(C)=N3)S1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,2,3,6,7,8-Hexahydroas-Indacen-1-One, CAS:14927-65-2, Molecular Weight: 172.2231, C12H12O, Purity:95, SMILES: O=C1CCC2=C1C1=C(CCC1)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1 5-DIMETHOXYNAPHTHALENE, CAS:10075-63-5, Molecular Weight: 188.2225, C12H12O2, Purity:98, SMILES: COc1cccc2c(OC)cccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,2-DIMETHYL-2H-CHROMENE-6-CARBALDEHYDE, CAS:69964-40-5, Molecular Weight: 188.2225, C12H12O2, Purity:95, SMILES: O=Cc1ccc2c(c1)C=CC(O2)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,6-Dimethoxynaphthalene, CAS:5486-55-5, Molecular Weight: 188.2225, C12H12O2, Purity:95, SMILES: COc1ccc2c(c1)ccc(c2)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-phenylcyclohexane-1,3-dione, CAS:493-72-1, Molecular Weight: 188.2225, C12H12O2, Purity:95, SMILES: O=C1CC(CC(=O)C1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(Allyloxy-2,3-Dihydro-1H-Inden-1-One, CAS:320574-74-1, Molecular Weight: 188.2225, C12H12O2, Purity:95, SMILES: C=CCOC1=CC2=C(CCC2=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 3,4-Dihydronaphthalene-2-Carboxylate, CAS:51849-37-7, Molecular Weight: 188.2225, C12H12O2, Purity:95, SMILES: COC(=O)C1=CC2=CC=CC=C2CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Ethyl-7-Hydroxy-4-Methyl-2H-Chromen-2-One, CAS:1484-73-7, Molecular Weight: 204.2219, C12H12O3, Purity:95, SMILES: CCC1=CC2=C(OC(=O)C=C2C)C=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 1-Oxo-2,3-Dihydro-1H-Indene-2-Carboxylate, CAS:6742-25-2, Molecular Weight: 204.2219, C12H12O3, Purity:95, SMILES: CCOC(=O)C1CC2=C(C=CC=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 1-Oxo-1,2,3,4-Tetrahydronaphthalene-2-Carboxylate, CAS:7442-52-6, Molecular Weight: 204.2219, C12H12O3, Purity:95, SMILES: COC(=O)C1CCC2=CC=CC=C2C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 1-oxo-1,2,3,4-tetrahydronaphthalene-2-carboxylate, CAS:7442-52-6, Molecular Weight: 204.2219, C12H12O3, Purity:95, SMILES: COC(=O)C1CCc2c(C1=O)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 5-Oxo-6,7,8-Trihydronaphthalene-2-Carboxylate, CAS:144464-66-4, Molecular Weight: 204.2219, C12H12O3, Purity:95, SMILES: COC(=O)C1=CC=C2C(=O)CCCC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ETHYL 2-HYDROXY-2,2-DI(THIOPHEN-2-YL)ACETATE, CAS:28569-88-2, Molecular Weight: 268.352, C12H12O3S2, Purity:95, SMILES: CCOC(=O)C(O)(c1cccs1)c1cccs1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| dimethyl (1s,2R,5s,6S)-cubane-1,4-dicarboxylate, CAS:29412-62-2, Molecular Weight: 220.2213, C12H12O4, Purity:95, SMILES: COC(=O)C12C3C4C2C2C1C3C42C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dimethyl Benzylidenemalonate, CAS:6626-84-2, Molecular Weight: 220.2213, C12H12O4, Purity:95, SMILES: COC(=O)C(=CC1=CC=CC=C1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Indene-4-carboxylic acid, 2,3-dihydro-6,7-dimethoxy-1-oxo-, CAS:148050-74-2, Molecular Weight: 236.2207, C12H12O5, Purity:95, SMILES: COc1cc(C(=O)O)c2c(c1OC)C(=O)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dimethylfraxetin, CAS:6035-49-0, Molecular Weight: 236.2207, C12H12O5, Purity:98, SMILES: O=C1C=CC2=CC(OC)=C(OC)C(OC)=C2O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 2-acetoxy-5-acetylbenzoate, CAS:61414-18-4, Molecular Weight: 236.2207, C12H12O5, Purity:95, SMILES: COC(=O)c1cc(ccc1OC(=O)C)C(=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trimethyl 1,3,5-benzene tricarboxylate, CAS:2672-58-4, Molecular Weight: 252.2201, C12H12O6, Purity:98, SMILES: COC(=O)c1cc(OC(=O)C)cc(c1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Ethoxy-2-naphthaleneboronic acid, CAS:156641-98-4, Molecular Weight: 216.041, C12H13BO3, Purity:95, SMILES: CCOc1ccc2c(c1)ccc(c2)B(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,4,6-Tribromophenyl caproate, CAS:16732-09-5, Molecular Weight: 428.94242, C12H13Br3O2, Purity:98, SMILES: CCCCCC(OC1=C(Br)C=C(Br)C=C1Br)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thieno[3,2-d]pyrimidine, 6-(bromomethyl)-2-chloro-7-methyl-4-(4-morpholinyl)-, CAS:1032758-45-4, Molecular Weight: 362.673, C12H13BrClN3OS, Purity:90, SMILES: BrCc1sc2c(c1C)nc(nc2N1CCOCC1)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Bromo-1-(Tetrahydro-2H-Pyran-2-Yl-1H-Indazole, CAS:478828-53-4, Molecular Weight: 281.148, C12H13BrN2O, Purity:95, SMILES: BrC1=CC=C2N(N=CC2=C1)C1CCCCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Boc-4-Bromo-1H-indazole, CAS:926922-37-4, Molecular Weight: 297.148, C12H13BrN2O2, Purity:97, SMILES: Brc1cccc2c1cnn2C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 6-bromo-1-isopropyl-1H-indazole-4-carboxylate, CAS:1346702-52-0, Molecular Weight: 297.148, C12H13BrN2O2, Purity:95, SMILES: COC(=O)c1cc(Br)cc2n(ncc12)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-bromo-1H-pyrrolo[2,3-b]pyridine-1-carboxylate, CAS:226085-17-2, Molecular Weight: 297.148, C12H13BrN2O2, Purity:95, SMILES: Brc1cn(c2c1cccn2)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 4-bromo-1H-pyrrolo[2,3-b]pyridine-1-carboxylate, CAS:1228014-35-4, Molecular Weight: 297.148, C12H13BrN2O2, Purity:95, SMILES: O=C(n1ccc2c1nccc2Br)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sulfabrom, CAS:116-45-0, Molecular Weight: 357.22622, C12H13BrN4O2S, Purity:98, SMILES: O=S(C1=CC=C(N)C=C1)(NC2=NC(C)=C(Br)C(C)=N2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Bromo-1-Indan-5-Yl-Propan-1-One, CAS:113364-57-1, Molecular Weight: 253.135, C12H13BrO, Purity:95, SMILES: BrCCC(=O)C1=CC=C2CCCC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-BROMO-1-(2,2-DIMETHYL-4H-1,3-BENZODIOXIN-6-YL)ETHANONE, CAS:102293-80-1, Molecular Weight: 285.134, C12H13BrO3, Purity:90, SMILES: BrCC(=O)c1ccc2c(c1)COC(O2)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 1-(4-bromophenyl)-3-hydroxycyclobutanecarboxylate, CAS:1432059-59-0, Molecular Weight: 285.134, C12H13BrO3, Purity:95, SMILES: O=C(C1(C2=CC=C(Br)C=C2)CC(O)C1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 1-bromo-4-hydroxy-5,6,7,8-tetrahydronaphthalene-2-carboxylate, CAS:1253654-65-7, Molecular Weight: 285.134, C12H13BrO3, Purity:95, SMILES: COC(=O)c1cc(O)c2CCCCc2c1Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 3-bromo-4-hydroxy-5,6,7,8-tetrahydronaphthalene-2-carboxylate, CAS:, Molecular Weight: 285.134, C12H13BrO3, Purity:95, SMILES: COC(=O)c1cc2CCCCc2c(O)c1Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acetamide, N-cyclopropyl-N-[(2,3-dichlorophenyl)methyl]-, CAS:1041439-18-2, Molecular Weight: 258.144, C12H13Cl2NO, Purity:98, SMILES: CC(=O)N(C1CC1)Cc1cccc(c1Cl)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-CHLORO-3H-SPIRO[ISOBENZOFURAN-1,4-PIPERIDIN]-3-ONE hydrochloride, CAS:1956318-12-9, Molecular Weight: 274.143, C12H13Cl2NO2, Purity:95, SMILES: Cl.ClC1=CC2=C(C=C1)C1(CCNCC1)OC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ro 41-1049 (hydrochloride), CAS:127917-66-2, Molecular Weight: 301.7675, C12H13ClFN3OS, Purity:98, SMILES: O=C(C1=C(C2=CC=CC(F)=C2)SC=N1)NCCN.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Indazole, 4-chloro-1-(tetrahydro-2H-pyran-2-yl)-, CAS:1137278-45-5, Molecular Weight: 236.697, C12H13ClN2O, Purity:95, SMILES: Clc1cccc2c1cnn2C1CCCCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Pyrrolo[2,3-b]pyridine-1-carboxylic acid, 4-chloro-, 1,1-dimethylethyl ester, CAS:945599-50-8, Molecular Weight: 252.697, C12H13ClN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)n1ccc2c(Cl)ccnc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-CHLORO-6,7-DIETHOXYQUINAZOLINE, CAS:162363-46-4, Molecular Weight: 252.697, C12H13ClN2O2, Purity:95, SMILES: CCOc1cc2ncnc(Cl)c2cc1OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Chloro-1,2-dihydro-2-oxospiro[4H-3,1-benzoxazin-4,4'-piperidine], CAS:92926-63-1, Molecular Weight: 252.697, C12H13ClN2O2, Purity:95, SMILES: Clc1ccc2NC(=O)OC3(CCNCC3)c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 2-amino-3-(7-chloro-1H-indol-3-yl)propanoate, CAS:, Molecular Weight: 252.697, C12H13ClN2O2, Purity:95, SMILES: O=C(OC)C(N)CC1=CNC2=C1C=CC=C2Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 2-chloro-1H-benzo[d]imidazole-1-carboxylate, CAS:214147-60-1, Molecular Weight: 252.697, C12H13ClN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)n1c(Cl)nc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrimethamine, CAS:58-14-0, Molecular Weight: 248.7114, C12H13ClN4, Purity:98, SMILES: NC1=NC(N)=C(C2=CC=C(Cl)C=C2)C(CC)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenepropanoic acid, 4-chloro--2-propen-1-yl-, CAS:91393-56-5, Molecular Weight: 224.683, C12H13ClO2, Purity:95, SMILES: C=CCC(C(=O)O)Cc1ccc(cc1)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| INF39, CAS:866028-26-4, Molecular Weight: 224.68342, C12H13ClO2, Purity:98, SMILES: O=C(OCC)C(CC1=CC=CC=C1Cl)=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 5-Chloro-2,2-Dimethyl-2,3-Dihydrobenzofuran-7-Carboxylate, CAS:1234844-87-1, Molecular Weight: 240.683, C12H13ClO3, Purity:95, SMILES: COC(=O)C1=C2OC(C)(C)CC2=CC(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Midodrine (D6 hydrochloride), CAS:1188265-43-1, Molecular Weight: 296.7802, C12H13D6ClN2O4, Purity:98, SMILES: OC(CNC(CN)=O)C1=CC(OC([2H])([2H])[2H])=CC=C1OC([2H])([2H])[2H].[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2R,3R)-2-(2,4-difluorophenyl)-1-(1H-1,2,4-triazol-1-yl)butane-2,3-diol, CAS:133775-25-4, Molecular Weight: 269.2473, C12H13F2N3O2, Purity:95, SMILES: C[C@@H](O)[C@](O)(Cn1cncn1)c1ccc(F)cc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-3,3-difluoropiperidin-4-one, CAS:1039741-54-2, Molecular Weight: 225.2345, C12H13F2NO, Purity:95, SMILES: O=C1CCN(CC1(F)F)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 3,3-Difluorocyclobutylcarbamate, CAS:939399-53-8, Molecular Weight: 241.2339, C12H13F2NO2, Purity:95, SMILES: FC1(F)CC(C1)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fluzinamide, CAS:76263-13-3, Molecular Weight: 274.2390296, C12H13F3N2O2, Purity:98, SMILES: O=C(N1CC(OC2=CC=CC(C(F)(F)F)=C2)C1)NC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(2-Trifluoromethyl-phenyl)-propionic acid ethyl ester, CAS:191155-80-3, Molecular Weight: 246.2256, C12H13F3O2, Purity:90, SMILES: CCOC(=O)CCc1ccccc1C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 3-(4-(trifluoromethyl)phenyl)propanoate, CAS:82989-27-3, Molecular Weight: 246.2256, C12H13F3O2, Purity:90, SMILES: CCOC(=O)CCc1ccc(cc1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Methylsulfonyl-2-(2,2,2-trifluoro-1-methylethoxy)benzoic acid methyl ester, CAS:845617-19-8, Molecular Weight: 326.289, C12H13F3O5S, Purity:99, SMILES: COC(=O)c1cc(ccc1OC(C)C(F)(F)F)S(C)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-fluorospiro[benzo[d][1,3]oxazine-4,4�piperidin]-2(1H)-one, CAS:92926-32-4, Molecular Weight: 236.2422, C12H13FN2O2, Purity:97, SMILES: Fc1ccc2NC(=O)OC3(CCNCC3)c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(4-fluorobenzyl-2-oxopyrrolidine-3-carboxamide, CAS:2007908-57-6, Molecular Weight: 236.2422, C12H13FN2O2, Purity:95, SMILES: FC1=CC=C(CNC(=O)C2CCNC2=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-Fluorophenyl)cyclohexanone, CAS:59227-02-0, Molecular Weight: 192.2294, C12H13FO, Purity:90, SMILES: O=C1CCCCC1c1ccc(cc1)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-Iodo-1H-Pyrrolo[3,2-C]Pyridine-1-Carboxylate, CAS:877060-48-5, Molecular Weight: 344.1483, C12H13IN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1C=C(I)C2=C1C=CN=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-(-)-1-(1-Naphthyl)ethylamine, CAS:10420-89-0, Molecular Weight: 171.2383, C12H13N, Purity:95, SMILES: C[C@H](N)C1=CC=CC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-(-)-1-(1-Naphthyl)ethylamine, CAS:3886-70-2, Molecular Weight: 171.2383, C12H13N, Purity:95, SMILES: C[C@@H](c1cccc2c1cccc2)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-1-(naphthalen-1-yl)ethanamine, CAS:10420-89-0, Molecular Weight: 171.2383, C12H13N, Purity:99, SMILES: C[C@H](N)c1cccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(naphthalen-1-yl)ethanamine, CAS:42882-31-5, Molecular Weight: 171.2383, C12H13N, Purity:98, SMILES: CC(N)c1cccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,3,4,9-Tetrahydro-1H-carbazole, CAS:942-01-8, Molecular Weight: 171.2383, C12H13N, Purity:98, SMILES: C1CCc2c(C1)[nH]c1ccccc21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Methyl-1-(naphthalen-1-yl)methanamine, CAS:14489-75-9, Molecular Weight: 171.2383, C12H13N, Purity:98, SMILES: CNCc1cccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rasagiline, CAS:136236-51-6, Molecular Weight: 171.2383, C12H13N, Purity:98, SMILES: C#CCN[C@H]1C2=CC=CC=C2CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TVP1022, CAS:185517-74-2, Molecular Weight: 171.2383, C12H13N, Purity:98, SMILES: C#CCN[C@H]1CCC2=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| bis(pyridin-2-ylmethyl)amine, CAS:1539-42-0, Molecular Weight: 199.2517, C12H13N3, Purity:95, SMILES: C(NCc1ccccn1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(4-Methoxyphenyl-6-Methyl-4-Pyrimidinamine, CAS:312507-33-8, Molecular Weight: 215.2511, C12H13N3O, Purity:95, SMILES: COC1=CC=C(NC2=NC=NC(C)=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 6-Cyclopropylpyrazolo[1,5-A]Pyrimidine-3-Carboxylate, CAS:0, Molecular Weight: 231.2505, C12H13N3O2, Purity:95, SMILES: CCOC(=O)C1=C2N=CC(=CN2N=C1)C1CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Farampator, CAS:211735-76-1, Molecular Weight: 231.2505, C12H13N3O2, Purity:98, SMILES: O=C(N1CCCCC1)C2=CC3=NON=C3C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fexinidazole, CAS:59729-37-2, Molecular Weight: 279.3149, C12H13N3O3S, Purity:98, SMILES: O=[N+](C1=CN=C(COC2=CC=C(SC)C=C2)N1C)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 5-nitroindazole-1-carboxylate, CAS:129488-09-1, Molecular Weight: 263.2493, C12H13N3O4, Purity:95, SMILES: [O-][N+](=O)c1ccc2c(c1)cnn2C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-amino-5-ethyl-4,6-dimethylthieno[2,3-b]pyridine-2-carbonitrile, CAS:0, Molecular Weight: 231.317, C12H13N3S, Purity:95, SMILES: CCC1=C(C)C2=C(SC(C#N)=C2N)N=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Furancarboxylic acid, 2-[6-amino-1-(2-hydroxyethyl)-1H-pyrazolo[3,4-d]pyrimidin-4-yl]hydrazide, CAS:377729-86-7, Molecular Weight: 303.2767, C12H13N7O3, Purity:95, SMILES: OCCn1ncc2c1nc(N)nc2NNC(=O)c1ccco1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-METHOXYPHENYL)CYCLOBUTANECARBONITRILE, CAS:29786-45-6, Molecular Weight: 187.2377, C12H13NO, Purity:95, SMILES: COc1ccc(cc1)C1(CCC1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(3,4-DimethoxyphenylCyclopropanecarbonitrile, CAS:20802-15-7, Molecular Weight: 203.2371, C12H13NO2, Purity:95, SMILES: COC1=C(OC)C=C(C=C1)C1(CC1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-acetyl-2-methyl-2,3-dihydroquinolin-4(1H-one, CAS:128649-34-3, Molecular Weight: 203.2371, C12H13NO2, Purity:95, SMILES: CC1CC(=O)C2=CC=CC=C2N1C(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzoylpiperidin-4-one, CAS:24686-78-0, Molecular Weight: 203.2371, C12H13NO2, Purity:97, SMILES: O=C(c1ccccc1)N1CCC(=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzylpiperidine-2,4-dione, CAS:70571-31-2, Molecular Weight: 203.2371, C12H13NO2, Purity:95, SMILES: O=C1CCN(C(=O)C1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(5-Methyl-2-Phenyl-1,3-Oxazol-4-YlEthan-1-Ol, CAS:103788-65-4, Molecular Weight: 203.2371, C12H13NO2, Purity:95, SMILES: CC1=C(CCO)N=C(O1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Pyrrolidine-1-Carbonyl-Benzaldehyde, CAS:80020-05-9, Molecular Weight: 203.2371, C12H13NO2, Purity:95, SMILES: O=CC1=CC=C(C=C1)C(=O)N1CCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 2,5-dihydro-1H-pyrrole-1-carboxylate, CAS:31970-04-4, Molecular Weight: 203.2371, C12H13NO2, Purity:95, SMILES: O=C(N1CC=CC1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 2-(1H-indol-3-yl)acetate, CAS:778-82-5, Molecular Weight: 203.2371, C12H13NO2, Purity:95, SMILES: CCOC(=O)Cc1c[nH]c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 2-Cyano-3-Phenylpropanoate, CAS:6731-58-4, Molecular Weight: 203.2371, C12H13NO2, Purity:95, SMILES: CCOC(=O)C(CC1=CC=CC=C1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Indole-3-butyric acid, CAS:133-32-4, Molecular Weight: 203.2371, C12H13NO2, Purity:98, SMILES: O=C(O)CCCC1=CNC2=C1C=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-BUTYL-5-NITROBENZOFURAN, CAS:133238-87-6, Molecular Weight: 219.2365, C12H13NO3, Purity:95, SMILES: CCCCc1cc2c(o1)ccc(c2)[N+](=O)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7,8-DiMethoxy-1,3-dihydro-2H-3-benzazepin-2-one, CAS:73942-87-7, Molecular Weight: 219.2365, C12H13NO3, Purity:95, SMILES: O=C1NC=CC2=CC(OC)=C(OC)C=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Aniracetam, CAS:72432-10-1, Molecular Weight: 219.2365, C12H13NO3, Purity:98, SMILES: O=C(N1CCCC1=O)C2=CC=C(OC)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 3-Oxocyclobutylcarbamate, CAS:130369-36-7, Molecular Weight: 219.2365, C12H13NO3, Purity:95, SMILES: O=C(NC1CC(=O)C1)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 3-oxopyrrolidine-1-carboxylate, CAS:130312-02-6, Molecular Weight: 219.2365, C12H13NO3, Purity:97, SMILES: O=C1CCN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 5-Amino-1,1A,2,7B-Tetrahydrocyclopropa[C]Chromene-4-Carboxylate, CAS:1412976-18-1, Molecular Weight: 219.2365, C12H13NO3, Purity:95, SMILES: COC(=O)C1=C(N)C=CC2=C1OCC1CC21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyridinium toluene-4-sulphonate, CAS:24057-28-1, Molecular Weight: 251.302, C12H13NO3S, Purity:95, SMILES: c1cccnc1.OOOSc1ccc(cc1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R-4-Benzyl-5-Oxo-3-Morpholinecarboxylic Acid, CAS:106973-36-8, Molecular Weight: 235.2359, C12H13NO4, Purity:95, SMILES: OC(=O)[C@H]1COCC(=O)N1CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-4-Benzyl-5-oxomorpholine-3-carboxylic acid, CAS:106910-79-6, Molecular Weight: 235.2359, C12H13NO4, Purity:95, SMILES: OC(=O)[C@@H]1COCC(=O)N1Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-Benzyl (5-oxotetrahydrofuran-3-yl)carbamate, CAS:87219-29-2, Molecular Weight: 235.2359, C12H13NO4, Purity:97, SMILES: O=C(N[C@@H]1COC(=O)C1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-4-Benzyl-5-Oxomorpholine-3-Carboxylic Acid, CAS:106910-79-6, Molecular Weight: 235.2359, C12H13NO4, Purity:95, SMILES: OC(=O)C1COCC(=O)N1CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-MethoxybenzoylAzetidine-3-Carboxylic Acid, CAS:1378408-99-1, Molecular Weight: 235.2359, C12H13NO4, Purity:95, SMILES: COC1=CC=CC=C1C(=O)N1CC(C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Benzyloxycarbonyl-Amino-Cyclopropyl-1-Carboxylic Acid, CAS:84677-06-5, Molecular Weight: 235.2359, C12H13NO4, Purity:95, SMILES: OC(=O)C1(CC1)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Phenoxycarbonyl)pyrrolidine-2-carboxylic acid, CAS:1161602-22-7, Molecular Weight: 235.2359, C12H13NO4, Purity:95, SMILES: OC(=O)C1CCCN1C(=O)Oc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Cbz-Azetidine-3-carboxylic acid, CAS:97628-92-7, Molecular Weight: 235.2359, C12H13NO4, Purity:98, SMILES: OC(=O)C1CN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-Methoxy-1-Methyl-EthoxyIsoindoline-1,3-Dione, CAS:0, Molecular Weight: 235.2359, C12H13NO4, Purity:95, SMILES: COC(C)(C)ON1C(=O)C2=CC=CC=C2C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| benzyl (5-oxotetrahydrofuran-3-yl)carbamate, CAS:305859-68-1, Molecular Weight: 235.2359, C12H13NO4, Purity:95, SMILES: O=C(NC1COC(=O)C1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ISO-1, CAS:478336-92-4, Molecular Weight: 235.2359, C12H13NO4, Purity:98, SMILES: O=C(OC)CC1ON=C(C(C=C2)=CC=C2O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 4-(2-NitrophenylAcetoacetate, CAS:66073-33-4, Molecular Weight: 251.2353, C12H13NO5, Purity:95, SMILES: CCOC(=O)CC(=O)CC1=C(C=CC=C1)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-Bromo-2,6-difluorophenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:1799485-20-3, Molecular Weight: 318.95, C12H14BBrF2O2, Purity:98, SMILES: CC1(C)OB(OC1(C)C)c1c(F)cc(Br)cc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-TETRAMETHYL-2-(2,4,6-TRICHLOROPHENYL)-1,3,2-DIOXABOROLANE, CAS:69807-93-8, Molecular Weight: 307.408, C12H14BCl3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=C(Cl)C=C(Cl)C=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-tetramethyl-2-(2,4,6-trichlorophenyl)-1,3,2-dioxaborolane, CAS:69807-93-8, Molecular Weight: 307.408, C12H14BCl3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1c(Cl)cc(Cl)cc1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-Tetramethyl-2-(3,4,5-trifluorophenyl)-1,3,2-dioxaborolane, CAS:827614-70-0, Molecular Weight: 258.045, C12H14BF3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cc(F)c(c(c1)F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Cyanophenylboronic acid, neopentyl ester, CAS:214360-47-1, Molecular Weight: 215.056, C12H14BNO2, Purity:95, SMILES: N#Cc1ccccc1B1OCC(CO1)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5,5-Bis(bromomethyl)-2-phenyl-1,3-dioxane, CAS:3733-29-7, Molecular Weight: 350.046, C12H14Br2O2, Purity:99, SMILES: BrCC1(CBr)COC(OC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Bromospiro[Indoline-3,4'-Piperidin]-2-One Hydrochloride, CAS:1707713-79-8, Molecular Weight: 317.609, C12H14BrClN2O, Purity:95, SMILES: Cl.BrC1=CC2=C(NC(=O)C22CCNCC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-3-bromo-1,2,5,6-tetrahydropyridine, CAS:1159982-62-3, Molecular Weight: 252.15, C12H14BrN, Purity:95, SMILES: BrC1=CCCN(CC2=CC=CC=C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-4-bromo-1,2,3,6-tetrahydropyridine, CAS:175347-95-2, Molecular Weight: 252.15, C12H14BrN, Purity:95, SMILES: BrC1=CCN(CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-4-bromo-1,2,3,6-tetrahydropyridine, CAS:175347-95-2, Molecular Weight: 252.15, C12H14BrN, Purity:95, SMILES: BrC1=CCN(CC1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-5-bromo-1,2,3,6-tetrahydropyridine, CAS:1159982-62-3, Molecular Weight: 252.15, C12H14BrN, Purity:95, SMILES: BrC1=CCCN(C1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5'-Bromo-1',2'-Dihydrospiro[Cyclopentane-1,3'-Indole], CAS:1160247-93-7, Molecular Weight: 252.15, C12H14BrN, Purity:95, SMILES: BrC1=CC2=C(NCC22CCCC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Bromo-2',3',5',6'-Tetrahydrospiro[Indoline-3,4'-Pyran], CAS:1160247-95-9, Molecular Weight: 268.15, C12H14BrNO, Purity:95, SMILES: BrC1=CC=C2NCC3(CCOCC3)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(3-BromophenylTetrahydro-2H-Pyran-4-Carboxamide, CAS:329025-26-5, Molecular Weight: 284.149, C12H14BrNO2, Purity:95, SMILES: NC(=O)C1(CCOCC1)C1=CC=CC(Br)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Florfenicol, CAS:73231-34-2, Molecular Weight: 358.2133, C12H14Cl2FNO4S, Purity:98, SMILES: O=C(N[C@H](CF)[C@H](O)C1=CC=C(S(=O)(C)=O)C=C1)C(Cl)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benoxafos, CAS:16759-59-4, Molecular Weight: 386.2542, C12H14Cl2NO3PS2, Purity:98, SMILES: S=P(OCC)(SCC1=NC2=CC(Cl)=CC(Cl)=C2O1)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-1-(Naphthalen-1-yl)ethanamine hydrochloride, CAS:82572-04-1, Molecular Weight: 207.699, C12H14ClN, Purity:99, SMILES: C[C@H](c1cccc2c1cccc2)N.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-amino-3-(7-chloro-1H-indol-3-yl)-N-methylpropanamide, CAS:, Molecular Weight: 251.712, C12H14ClN3O, Purity:95, SMILES: O=C(NC)C(N)CC1=CNC2=C1C=CC=C2Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-CHLORO-2-(1,4-DIAZEPAN-1-YL)BENZO[D]OXAZOLE, CAS:914299-55-1, Molecular Weight: 251.712, C12H14ClN3O, Purity:95, SMILES: Clc1ccc2c(c1)nc(o2)N1CCNCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(1H-Pyrazol-4-yl)-7-((2-(trimethylsilyl)ethoxy)methyl-7H-pyrrolo[2,3-d] pyrimidine, CAS:1146629-75-5, Molecular Weight: 267.711, C12H14ClN3O2, Purity:95, SMILES: CC(C)(C)C(=O)OCN1C=CC2=C(Cl)N=CN=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thieno[3,2-d]pyrimidine-6-methanol, 2-chloro-7-methyl-4-(4-morpholinyl)-, CAS:1032758-44-3, Molecular Weight: 299.776, C12H14ClN3O2S, Purity:90, SMILES: OCc1sc2c(c1C)nc(nc2N1CCOCC1)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2H-Imidazo[4,5-b]pyridin-2-one, 6-chloro-1-(1-ethylpropyl)-1,3-dihydro-7-(2H-tetrazol-5-yl)-, CAS:1178978-20-5, Molecular Weight: 307.73886, C12H14ClN7O, Purity:98, SMILES: O=C1NC2=NC=C(Cl)C(C3=NNN=N3)=C2N1C(CC)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R-2-amino-2-(2-chlorophenylcyclohexanone, CAS:0, Molecular Weight: 223.699, C12H14ClNO, Purity:95, SMILES: N[C@]1(CCCCC1=O)C1=CC=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-2-amino-2-(2-chlorophenylcyclohexanone, CAS:83777-65-5, Molecular Weight: 223.699, C12H14ClNO, Purity:95, SMILES: N[C@@]1(CCCCC1=O)C1=CC=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CNP-AFU, CAS:157843-41-9, Molecular Weight: 319.69506, C12H14ClNO7, Purity:98, SMILES: O[C@@H]1[C@@H](O[C@@H](C)[C@@H](O)[C@H]1O)OC(C=CC([N+]([O-])=O)=C2)=C2Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TERT-BUTYL N-[(2,5-DIFLUOROBENZOYL)AMINO]-CARBAMATE, CAS:1079843-62-1, Molecular Weight: 272.248, C12H14F2N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)NNC(=O)C1=C(F)C=CC(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,3-Difluorocyclobutylmethyl tosylate, CAS:681128-40-5, Molecular Weight: 276.3, C12H14F2O3S, Purity:97, SMILES: Cc1ccc(cc1)S(=O)(=O)OCC1CC(F)(F)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-[2-(TrifluoromethoxyPhenoxy]Piperidine, CAS:902836-49-1, Molecular Weight: 261.2403, C12H14F3NO2, Purity:95, SMILES: FC(F)(F)OC1=C(OC2CCNCC2)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl N-[4-(trifluoromethyl)phenyl]carbamate, CAS:141940-37-6, Molecular Weight: 261.2403, C12H14F3NO2, Purity:95, SMILES: O=C(OC(C)(C)C)Nc1ccc(cc1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(2-CYANOPROPAN-2-YLAMINO)-2-FLUORO-N-METHYLBENZAMIDE, CAS:915087-32-0, Molecular Weight: 235.2575, C12H14FN3O, Purity:95, SMILES: CNC(=O)c1ccc(cc1F)NC(C#N)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1E,3E-1-(4-Fluorophenyl-2-Methylpent-1-En-3-One Oxime, CAS:1170613-55-4, Molecular Weight: 207.2441, C12H14FNO, Purity:95, SMILES: CCC(=N/O)\C(C)=C\C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-FLUOROPHENYL)-2-METHYL-1-PENTEN-3-ONE OXIME, CAS:1357350-70-9, Molecular Weight: 207.2441, C12H14FNO, Purity:95, SMILES: CCC(=N/O)\C(C)=C\c1ccc(F)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-([(TERT-BUTOXY)CARBONYL]AMINO)-2-FLUOROBENZOIC ACID, CAS:141940-32-1, Molecular Weight: 255.2423, C12H14FNO4, Purity:95, SMILES: CC(C)(C)OC(=O)NC1=CC(C(O)=O)=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-([(TERT-BUTOXY)CARBONYL]AMINO)-2-FLUOROBENZOIC ACID, CAS:141940-32-1, Molecular Weight: 255.2423, C12H14FNO4, Purity:95, SMILES: CC(C)(C)OC(=O)Nc1ccc(F)c(c1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 5-((2-Ethoxy-2-OxoethylAmino-2-Fluorobenzoate, CAS:885278-30-8, Molecular Weight: 255.2423, C12H14FNO4, Purity:95, SMILES: CCOC(=O)CNC1=CC(C(=O)OC)=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-aminophenyl)cyclopentanecarbonitrile, CAS:115279-73-7, Molecular Weight: 186.253, C12H14N2, Purity:97, SMILES: N#CC1(CCCC1)c1ccc(cc1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Allyl(BenzylAminoAcetonitrile, CAS:127073-69-2, Molecular Weight: 186.253, C12H14N2, Purity:95, SMILES: C=CCN(CC#N)CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Detomidine, CAS:76631-46-4, Molecular Weight: 186.253, C12H14N2, Purity:98, SMILES: CC1=C(C)C(CC2=CN=CN2)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N,N,2-trimethylquinolin-6-amine, CAS:92-99-9, Molecular Weight: 186.253, C12H14N2, Purity:95, SMILES: CN(C)c1ccc2nc(C)ccc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(1H-Indol-5-yl)morpholine, CAS:245117-16-2, Molecular Weight: 202.2524, C12H14N2O, Purity:95, SMILES: O1CCN(CC1)c1ccc2c(c1)cc[nH]2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Benzylmorpholine-2-Carbonitrile, CAS:126645-52-1, Molecular Weight: 202.2524, C12H14N2O, Purity:95, SMILES: N#CC1CN(CC2=CC=CC=C2)CCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| L-Praziquanamine, CAS:99746-73-3, Molecular Weight: 202.2524, C12H14N2O, Purity:98, SMILES: O=C1CNC[C@@]2([H])N1CCC3=C2C=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(Propan-2-Yl-1H-Indole-5-Carboxamide, CAS:953029-91-9, Molecular Weight: 202.2524, C12H14N2O, Purity:95, SMILES: CC(C)NC(=O)C1=CC=C2NC=CC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Spiro[Indoline-3,4'-Piperidin]-2-One, CAS:252882-61-4, Molecular Weight: 202.2524, C12H14N2O, Purity:95, SMILES: O=C1NC2=C(C=CC=C2)C11CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3-methoxy-4-(4-methyl-1H-imidazol-1-yl)phenyl)methanol, CAS:1017789-63-7, Molecular Weight: 218.2518, C12H14N2O2, Purity:95, SMILES: COc1cc(CO)ccc1n1cnc(c1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-amino-3-(4-methyl-1H-indol-3-yl)propanoic acid, CAS:1954-45-6, Molecular Weight: 218.2518, C12H14N2O2, Purity:95, SMILES: Cc1cccc2[nH]cc(CC(N)C(O)=O)c12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-METHYL-D-TRYPTOPHAN, CAS:99295-79-1, Molecular Weight: 218.2518, C12H14N2O2, Purity:95, SMILES: Cc1ccc2[nH]cc(C[C@@H](N)C(O)=O)c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-METHYL-L-TRYPTOPHAN, CAS:154-06-3, Molecular Weight: 218.2518, C12H14N2O2, Purity:95, SMILES: Cc1ccc2[nH]cc(C[C@H](N)C(O)=O)c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-METHYL-TRYPTOPHAN, CAS:951-55-3, Molecular Weight: 218.2518, C12H14N2O2, Purity:95, SMILES: Cc1ccc2[nH]cc(C[C@H](N)C(O)=O)c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Indoximod, CAS:110117-83-4, Molecular Weight: 218.2518, C12H14N2O2, Purity:98, SMILES: N[C@H](CC1=CN(C)C2=CC=CC=C12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Indoximod, CAS:110117-83-4, Molecular Weight: 218.2518, C12H14N2O2, Purity:97, SMILES: Cn1cc(C[C@@H](N)C(O)=O)c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phenylpiracetam, CAS:77472-70-9, Molecular Weight: 218.2518, C12H14N2O2, Purity:98, SMILES: O=C(N)CN1C(CC(C2=CC=CC=C2)C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Primidone, CAS:125-33-7, Molecular Weight: 218.2518, C12H14N2O2, Purity:98, SMILES: O=C(C1(CC)C2=CC=CC=C2)NCNC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 1H-pyrrolo[3,2-b]pyridine-1-carboxylate, CAS:1018950-15-6, Molecular Weight: 218.2518, C12H14N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)n1ccc2ncccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4(1H)-Quinazolinone, 6,7-diethoxy- (9CI), CAS:179246-15-2, Molecular Weight: 234.2512, C12H14N2O3, Purity:95, SMILES: CCOc1cc2c(cc1OCC)nc[nH]c2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Benzyloxycarbonylpiperazin-2-one, CAS:78818-15-2, Molecular Weight: 234.2512, C12H14N2O3, Purity:95, SMILES: O=C1NCCN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-METHOXY-TRYPTOPHAN, CAS:199540-73-3, Molecular Weight: 234.2512, C12H14N2O3, Purity:95, SMILES: COc1cccc2[nH]cc(C[C@H](N)C(O)=O)c12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-METHOXY-L-TRYPTOPHAN, CAS:25197-96-0, Molecular Weight: 234.2512, C12H14N2O3, Purity:95, SMILES: COc1ccc2[nH]cc(C[C@H](N)C(O)=O)c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Methoxy-L-tryptophan, CAS:16730-11-3, Molecular Weight: 234.2512, C12H14N2O3, Purity:95, SMILES: COc1ccc2c(c1)[nH]cc2C[C@@H](C(=O)O)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Z-Asn-OH, CAS:2304-96-3, Molecular Weight: 266.25, C12H14N2O5, Purity:98, SMILES: NC(=O)C[C@H](NC(=O)OCc1ccccc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl 2-(3-Nitropyridin-4-YlMalonate, CAS:54415-82-6, Molecular Weight: 282.2494, C12H14N2O6, Purity:95, SMILES: CCOC(=O)C(C(=O)OCC)C1=CC=NC=C1[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DAB, CAS:7411-49-6, Molecular Weight: 214.2664, C12H14N4, Purity:98, SMILES: NC1=CC=C(C2=CC=C(N)C(N)=C2)C=C1N.[4HCl], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tirasemtiv, CAS:1005491-05-3, Molecular Weight: 230.2658, C12H14N4O, Purity:98, SMILES: O=C1N(C(CC)CC)C2=NC(C#C)=CN=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sulfamethazine, CAS:57-68-1, Molecular Weight: 278.3302, C12H14N4O2S, Purity:98, SMILES: O=S(C1=CC=C(N)C=C1)(NC2=NC(C)=CC(C)=N2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sulfisomidin, CAS:515-64-0, Molecular Weight: 278.3302, C12H14N4O2S, Purity:98, SMILES: O=S(C1=CC=C(N)C=C1)(NC2=NC(C)=NC(C)=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Deazaneplanocin A, CAS:102052-95-9, Molecular Weight: 262.2646, C12H14N4O3, Purity:98, SMILES: O[C@@H]1[C@H](O)C(CO)=C[C@H]1N2C=NC3=C2C=CN=C3N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(TERT-BUTOXYCARBONYLAMINO)PYRAZOLO[1,5-A]PYRIMIDINE-3-CARBOXYLIC ACID, CAS:1383056-73-2, Molecular Weight: 278.264, C12H14N4O4, Purity:95, SMILES: CC(C)(C)OC(=O)Nc1nn2cccnc2c1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sulfadimethoxine, CAS:122-11-2, Molecular Weight: 310.3289, C12H14N4O4S, Purity:98, SMILES: O=S(C1=CC=C(N)C=C1)(NC2=NC(OC)=NC(OC)=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sulfadoxine, CAS:2447-57-6, Molecular Weight: 310.3289, C12H14N4O4S, Purity:98, SMILES: O=S(NC1=NC=NC(OC)=C1OC)(C2=CC=C(N)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Butanone, 4-[6-amino-9-methyl-8-(2H-1,2,3-triazol-2-yl)-9H-purin-2-yl]-, CAS:1246018-36-9, Molecular Weight: 286.29256, C12H14N8O, Purity:98, SMILES: CC(CCC1=NC(N)=C2N=C(N3N=CC=N3)N(C)C2=N1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Faropenem sodium hydrate, CAS:122547-49-3, Molecular Weight: 307.298, C12H14NNaO5S, Purity:95, SMILES: C[C@H]([C@H]1C(=O)N2[C@@H]1SC(=C2[C@H]1CCCO1)C(=O)[O-])O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,2-dimethyl-1,2,3,4-tetrahydronaphthalen-1-one, CAS:2977-45-9, Molecular Weight: 174.239, C12H14O, Purity:95, SMILES: O=C1c2ccccc2CCC1(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Phenylcyclohexanone, CAS:1444-65-1, Molecular Weight: 174.239, C12H14O, Purity:90, SMILES: O=C1CCCCC1c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-phenylcyclohexanone, CAS:4894-75-1, Molecular Weight: 174.239, C12H14O, Purity:95, SMILES: O=C1CCC(CC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5,8-dimethyl-1,2,3,4-tetrahydronaphthalen-1-one, CAS:5037-63-8, Molecular Weight: 174.239, C12H14O, Purity:95, SMILES: O=C1CCCc2c1c(C)ccc2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| cyclopentyl(phenyl)methanone, CAS:5422-88-8, Molecular Weight: 174.239, C12H14O, Purity:98, SMILES: O=C(C1CCCC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Phenylcyclopentanecarboxylic acid, CAS:77-55-4, Molecular Weight: 190.2384, C12H14O2, Purity:98, SMILES: OC(=O)C1(CCCC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-methyl-2-(4-vinylphenyl)propanoic acid, CAS:1256584-72-1, Molecular Weight: 190.2384, C12H14O2, Purity:97, SMILES: C=Cc1ccc(cc1)C(C(=O)O)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Hydroxyphenyl)cyclohexanone, CAS:105640-07-1, Molecular Weight: 190.2384, C12H14O2, Purity:97, SMILES: O=C1CCC(CC1)c1ccc(cc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-METHOXY-1-METHYL-2-TETRALONE, CAS:1204-23-5, Molecular Weight: 190.2384, C12H14O2, Purity:95, SMILES: COc1ccc2c(c1)C(C)C(=O)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Butylphthalide, CAS:6066-49-5, Molecular Weight: 190.2384, C12H14O2, Purity:98, SMILES: O=C1OC(CCCC)C2=C1C=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cyclopropanecarboxylic Acid, 1-(4-Methylphenyl-, Methyl Ester, CAS:959632-00-9, Molecular Weight: 190.2384, C12H14O2, Purity:95, SMILES: COC(=O)C1(CC1)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ligustilide, CAS:4431-01-0, Molecular Weight: 190.2384, C12H14O2, Purity:98, SMILES: O=C1O/C(C2=C1C=CCC2)=C\CCC
, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-Ethyl 3-(2-MethoxyphenylAcrylate, CAS:24393-54-2, Molecular Weight: 206.2378, C12H14O3, Purity:95, SMILES: CCOC(=O)\C=C\C1=CC=CC=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-methoxyphenyl)cyclobutanecarboxylic acid, CAS:50921-37-4, Molecular Weight: 206.2378, C12H14O3, Purity:95, SMILES: COc1ccc(cc1)C1(CCC1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Phenyltetrahydro-2H-Pyran-4-Carboxylic Acid, CAS:182491-21-0, Molecular Weight: 206.2378, C12H14O3, Purity:95, SMILES: OC(=O)C1(CCOCC1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5,8-dimethoxyl-2-tetralone, CAS:37464-90-7, Molecular Weight: 206.2378, C12H14O3, Purity:99, SMILES: COc1ccc(OC)c2CC(=O)CCc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6,7-dimethoxyl-2-tetralone, CAS:2472-13-1, Molecular Weight: 206.2378, C12H14O3, Purity:95, SMILES: COc1cc2CCC(=O)Cc2cc1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 3-oxo-4-phenylbutanoate, CAS:718-08-1, Molecular Weight: 206.2378, C12H14O3, Purity:95, SMILES: CCOC(=O)CC(=O)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 4-(allyloxybenzoate, CAS:5443-37-8, Molecular Weight: 206.2378, C12H14O3, Purity:95, SMILES: CCOC(=O)C1=CC=C(OCC=C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl Chroman-2-Carboxylate, CAS:24698-77-9, Molecular Weight: 206.2378, C12H14O3, Purity:95, SMILES: CCOC(=O)C1CCC2=CC=CC=C2O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 4-hydroxy-5,6,7,8-tetrahydronaphthalene-2-carboxylate, CAS:89228-42-2, Molecular Weight: 206.2378, C12H14O3, Purity:95, SMILES: COC(=O)c1cc(O)c2CCCCc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 2-(6-Hydroxy-2,3-Dihydrobenzo[B]Thiophen-3-YlAcetate, CAS:1022979-94-7, Molecular Weight: 238.303, C12H14O3S, Purity:95, SMILES: CCOC(=O)CC1CSC2=C1C=CC(O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-3-(2-CARBOXYBUTYL)BENZOIC ACID, CAS:1464137-13-0, Molecular Weight: 222.2372, C12H14O4, Purity:95, SMILES: CC[C@H](Cc1cccc(c1)C(O)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(Cyclopropylmethoxy-4-Methoxybenzoic Acid, CAS:159783-28-5, Molecular Weight: 222.2372, C12H14O4, Purity:95, SMILES: COC1=C(OCC2CC2)C=C(C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Methyl-3-Phenylglutaric Acid, CAS:4160-92-3, Molecular Weight: 222.2372, C12H14O4, Purity:95, SMILES: CC(CC(O)=O)(CC(O)=O)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(tert-butoxycarbonyl)benzoic acid, CAS:20576-82-3, Molecular Weight: 222.2372, C12H14O4, Purity:95, SMILES: CC(C)(C)OC(=O)c1ccc(cc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-HYDROXY-2,2-DIMETHYLCHROMAN-5-CARBOXYLIC ACID, CAS:158227-26-0, Molecular Weight: 222.2372, C12H14O4, Purity:95, SMILES: CC1(C)CC(O)c2c(O1)cccc2C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acetic acid, 2-(4-acetyl-2-methylphenoxy)-, methyl ester, CAS:166953-80-6, Molecular Weight: 222.2372, C12H14O4, Purity:95, SMILES: COC(=O)COc1ccc(cc1C)C(=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenepropanoic acid, -[(acetyloxy)methyl]-, (S)-, CAS:121232-85-7, Molecular Weight: 222.2372, C12H14O4, Purity:95, SMILES: OC(=O)[C@@H](Cc1ccccc1)COC(=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl isophthalate, CAS:636-53-3, Molecular Weight: 222.2372, C12H14O4, Purity:98, SMILES: CCOC(=O)c1cccc(c1)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl phthalate, CAS:84-66-2, Molecular Weight: 222.2372, C12H14O4, Purity:99, SMILES: CCOC(=O)c1ccccc1C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 4-Hydroxychroman-2-Carboxylate, CAS:124524-76-1, Molecular Weight: 222.2372, C12H14O4, Purity:95, SMILES: CCOC(=O)C1CC(O)C2=CC=CC=C2O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-3-(2,3,4-trimethoxyphenylacrylic acid, CAS:116406-19-0, Molecular Weight: 238.2366, C12H14O5, Purity:95, SMILES: COC1=C(OC)C(OC)=C(\C=C\C(O)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3-methoxybenzylsuccinic acid, CAS:20940-75-4, Molecular Weight: 238.2366, C12H14O5, Purity:95, SMILES: COC1=CC=CC(CC(CC(O)=O)C(O)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-FORMYL-3-METHOXY-PHENOXY)-BUTYRIC ACID, CAS:309964-23-6, Molecular Weight: 238.2366, C12H14O5, Purity:98, SMILES: COc1cc(OCCCC(O)=O)ccc1C=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 3-(2,5-dimethoxyphenyl-3-oxopropanoate, CAS:1225553-37-6, Molecular Weight: 238.2366, C12H14O5, Purity:95, SMILES: COC(=O)CC(=O)C1=C(OC)C=CC(OC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| diethyl 2,5-dihydroxyterephthalate, CAS:5870-38-2, Molecular Weight: 254.236, C12H14O6, Purity:95, SMILES: CCOC(=O)c1cc(O)c(cc1O)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl 4,6-Dihydroxyisophthalate, CAS:52959-29-2, Molecular Weight: 254.236, C12H14O6, Purity:95, SMILES: CCOC(=O)C1=CC(C(=O)OCC)=C(O)C=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dimethyl 2-(2-methoxyphenoxy)malonate, CAS:150726-89-9, Molecular Weight: 254.236, C12H14O6, Purity:97, SMILES: COC(=O)C(C(=O)OC)Oc1ccccc1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| dimethyl 5-(((methylsulfonyl)oxy)methyl)isophthalate, CAS:, Molecular Weight: 302.3, C12H14O7S, Purity:95, SMILES: O=C(OC)C1=CC(COS(=O)(C)=O)=CC(C(OC)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3,5-Dichlorophenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:68716-51-8, Molecular Weight: 272.963, C12H15BCl2O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cc(Cl)cc(c1)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,6-Dichloro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenol, CAS:1003298-87-0, Molecular Weight: 288.963, C12H15BCl2O3, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cc(Cl)c(O)c(Cl)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Chloro-4-Nitrophenylboronic Acid, Pinacol Ester, CAS:1426804-80-9, Molecular Weight: 283.516, C12H15BClNO4, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=C(Cl)C=C(C=C1)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2,6-Difluorophenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:863868-37-5, Molecular Weight: 240.054, C12H15BF2O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1c(F)cccc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,6-Difluorophenylboronic acid, pinacol ester, CAS:863868-37-5, Molecular Weight: 240.054, C12H15BF2O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=C(F)C=CC=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,5-Difluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenol, CAS:1029439-87-9, Molecular Weight: 256.054, C12H15BF2O3, Purity:97, SMILES: CC1(C)OB(OC1(C)C)c1c(F)cc(O)cc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Trifluoromethyl)pyridine-4-boronic acid, pinacol ester, CAS:1036990-42-7, Molecular Weight: 273.059, C12H15BF3NO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1ccnc(c1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)-5-(trifluoromethyl)pyridine, CAS:1084953-47-8, Molecular Weight: 273.059, C12H15BF3NO2, Purity:98, SMILES: CC1(C)OB(OC1(C)C)c1cncc(c1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Fluoro-5-Nitrophenylboronic Acid Pinacol Ester, CAS:425378-68-3, Molecular Weight: 267.061, C12H15BFNO4, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=C(F)C=CC(=C1)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Cyanopyridine-5-Boronic Acid Pinacol Ester, CAS:741709-63-7, Molecular Weight: 230.071, C12H15BN2O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CN=C(C=C1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Cyanopyridine-5-boronic acid pinacol ester, CAS:741709-63-7, Molecular Weight: 230.071, C12H15BN2O2, Purity:97, SMILES: N#Cc1ccc(cn1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Cyanopyridine-4-boronic acid pinacol ester, CAS:878194-92-4, Molecular Weight: 230.071, C12H15BN2O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=NC=C1C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-3-Bromopiperidin-4-one HBr, CAS:83877-88-7, Molecular Weight: 349.062, C12H15Br2NO, Purity:95, SMILES: O=C1CCN(CC1Br)Cc1ccccc1.Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Bromobenzoyl)piperidine hydrochloride, CAS:64671-00-7, Molecular Weight: 304.611, C12H15BrClNO, Purity:97, SMILES: O=C(c1ccc(cc1)Br)C1CCNCC1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R-N-((S-1-(4-bromophenyl-2,2,2-trifluoroethyl-2-methylpropane-2-sulfinamide, CAS:336105-31-8, Molecular Weight: 358.218, C12H15BrF3NOS, Purity:95, SMILES: CC(C)(C)[S@@](=O)N[C@@H](C1=CC=C(Br)C=C1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl N-[(4-bromo-2-fluoro-phenyl)methyl]carbamate, CAS:864262-97-5, Molecular Weight: 304.155, C12H15BrFNO2, Purity:95, SMILES: CC(C)(C)OC(=O)NCc1ccc(Br)cc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl Methyl 2-(5-Bromopyrimidin-2-YlMalonate, CAS:948594-79-4, Molecular Weight: 331.162, C12H15BrN2O4, Purity:95, SMILES: COC(=O)C(C(=O)OC(C)(C)C)C1=NC=C(Br)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(bromomethyl)benzoate, CAS:108052-76-2, Molecular Weight: 271.15, C12H15BrO2, Purity:95, SMILES: CC(C)(C)OC(=O)c1ccc(CBr)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-Bromo-2-Methylbenzoate, CAS:445003-37-2, Molecular Weight: 271.15, C12H15BrO2, Purity:95, SMILES: CC1=CC(Br)=CC=C1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TERT-BUTYL 2,4-DICHLORO-5,6-DIHYDROPYRIDO[3,4-D]PYRIMIDINE-7(8H)-CARBOXYLATE, CAS:916420-27-4, Molecular Weight: 304.172, C12H15Cl2N3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCc2c(Cl)nc(Cl)nc2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-Chlorophenyl)-4-piperidinylmethanone Hydrochloride, CAS:55695-51-7, Molecular Weight: 260.16, C12H15Cl2NO, Purity:95, SMILES: O=C(C1=CC=C(Cl)C=C1)C2CCNCC2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NSC 405020, CAS:7497-07-6, Molecular Weight: 260.1596, C12H15Cl2NO, Purity:98, SMILES: O=C(NC(C)CCC)C1=CC=C(Cl)C(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2-Chlorophenyl(Morpholin-4-YlAcetic Acid Hydrochloride, CAS:0, Molecular Weight: 292.158, C12H15Cl2NO3, Purity:95, SMILES: Cl.OC(=O)C(N1CCOCC1)C1=CC=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-Chloro-Phenyl-Morpholin-4-Yl-Acetic Acid Hydrochloride, CAS:0, Molecular Weight: 292.158, C12H15Cl2NO3, Purity:95, SMILES: Cl.OC(=O)C(N1CCOCC1)C1=CC=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thiamphenicol, CAS:15318-45-3, Molecular Weight: 356.2222, C12H15Cl2NO5S, Purity:98, SMILES: O=C(N[C@H](CO)[C@H](O)C1=CC=C(S(=O)(C)=O)C=C1)C(Cl)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(2-(Trifluoromethyl)phenyl)piperidine hydrochloride, CAS:255051-14-0, Molecular Weight: 265.702, C12H15ClF3N, Purity:95, SMILES: FC(c1ccccc1C1CCNCC1)(F)F.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Fluoro-3-(piperidin-4-yl)-1H-indazole hydrochloride, CAS:153025-27-5, Molecular Weight: 255.719, C12H15ClFN3, Purity:95, SMILES: Fc1ccc2c(c1)[nH]nc2C1CCNCC1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Detomidine (hydrochloride), CAS:90038-01-0, Molecular Weight: 222.7139, C12H15ClN2, Purity:98, SMILES: CC1=C(C)C(CC2=CN=CN2)=CC=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(piperidin-4-yloxy)benzonitrile hydrochloride, CAS:333954-90-8, Molecular Weight: 238.713, C12H15ClN2O, Purity:95, SMILES: N#CC1=CC=C(OC2CCNCC2)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| D-Tryptophan methyl ester hydrochloride, CAS:14907-27-8, Molecular Weight: 254.713, C12H15ClN2O2, Purity:95, SMILES: Cl.COC(=O)[C@H](N)CC1=CNC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DU717, CAS:59943-31-6, Molecular Weight: 314.7911, C12H15ClN4O2S, Purity:98, SMILES: CN1CCN(C2=NC3=CC=C(Cl)C=C3S(N2)(=O)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Deazaneplanocin A (hydrochloride), CAS:120964-45-6, Molecular Weight: 298.7255, C12H15ClN4O3, Purity:98, SMILES: O[C@@H]1[C@H](O)C(CO)=C[C@H]1N2C=NC3=C2C=CN=C3N.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phosalone, CAS:2310-17-0, Molecular Weight: 367.8086, C12H15ClNO4PS2, Purity:98, SMILES: S=P(OCC)(SCN1C(OC2=CC(Cl)=CC=C12)=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl-3-(chloromethyl)benzoate, CAS:220510-74-7, Molecular Weight: 226.699, C12H15ClO2, Purity:97, SMILES: ClCc1cccc(c1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clofibrate, CAS:637-07-0, Molecular Weight: 242.6987, C12H15ClO3, Purity:98, SMILES: CC(C)(OC1=CC=C(Cl)C=C1)C(OCC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-3,3-difluoropiperidin-4-ol, CAS:1239596-53-2, Molecular Weight: 227.2504, C12H15F2NO, Purity:95, SMILES: OC1CCN(CC2=CC=CC=C2)CC1(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-3,3-difluoropiperidin-4-ol, CAS:1239596-53-2, Molecular Weight: 227.2504, C12H15F2NO, Purity:95, SMILES: OC1CCN(CC1(F)F)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-3,3-Difluoro-Piperidine-4,4-Diol, CAS:1067914-81-1, Molecular Weight: 243.2498, C12H15F2NO2, Purity:95, SMILES: OC1(O)CCN(CC2=CC=CC=C2)CC1(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(morpholinomethyl)-3-(trifluoromethyl)aniline, CAS:694499-30-4, Molecular Weight: 260.2555, C12H15F3N2O, Purity:95, SMILES: Nc1ccc(CN2CCOCC2)c(c1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tegadifur, CAS:62987-05-7, Molecular Weight: 270.2569032, C12H15FN2O4, Purity:98, SMILES: O=C1N(C2OCCC2)C(C(F)=CN1C3OCCC3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-fluorophenyl)cyclohexan-1-ol, CAS:851337-37-6, Molecular Weight: 194.2453, C12H15FO, Purity:95, SMILES: OC1CCCCC1c1ccc(cc1)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 3-(2'-Fluoro-4'-MethoxyphenylPropionate, CAS:691904-77-5, Molecular Weight: 226.2441, C12H15FO3, Purity:95, SMILES: CCOC(=O)CCC1=CC=C(OC)C=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-ethyl-3-iodophenyl)-2-methylpropanoic acid, CAS:1256584-73-2, Molecular Weight: 318.1508, C12H15IO2, Purity:90, SMILES: CCc1ccc(cc1I)C(C(=O)O)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-1,2,3,6-tetrahydropyridine, CAS:40240-12-8, Molecular Weight: 173.2542, C12H15N, Purity:95, SMILES: C1=CCN(CC1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Phenyl-1-propyl-1H-pyrazol-5-amine, CAS:3524-48-9, Molecular Weight: 201.2676, C12H15N3, Purity:95, SMILES: CCCn1nc(cc1N)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Indanazoline, CAS:40507-78-6, Molecular Weight: 201.2676, C12H15N3, Purity:98, SMILES: C1(NC2=CC=CC3=C2CCC3)=NCCN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-isobutylpyrazolo[1,5-a]pyridine-2-carboxamide, CAS:1205915-19-0, Molecular Weight: 217.267, C12H15N3O, Purity:95, SMILES: O=C(C1=NN2C=CC=CC2=C1)NCC(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Boc-5-aminoindazole, CAS:129488-10-4, Molecular Weight: 233.2664, C12H15N3O2, Purity:95, SMILES: CC(C)(C)OC(=O)n1ncc2cc(N)ccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Pyrrolo[2,3-b]pyridine-1-carboxylic acid, 4-amino-, 1,1-dimethylethyl ester, CAS:173898-20-9, Molecular Weight: 233.2664, C12H15N3O2, Purity:95, SMILES: CC(C)(C)OC(=O)n1ccc2c(N)ccnc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pardoprunox, CAS:269718-84-5, Molecular Weight: 233.2664, C12H15N3O2, Purity:98, SMILES: O=C1OC2=C(N3CCN(C)CC3)C=CC=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 5-Amino-1H-Indazole-1-Carboxylate, CAS:129488-10-4, Molecular Weight: 233.2664, C12H15N3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1N=CC2=C1C=CC(N)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Albendazole, CAS:54965-21-8, Molecular Weight: 265.3314, C12H15N3O2S, Purity:98, SMILES: O=C(OC)NC1=NC2=CC=C(SCCC)C=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oxibendazole, CAS:20559-55-1, Molecular Weight: 249.2658, C12H15N3O3, Purity:98, SMILES: O=C(OC)NC1=NC2=CC=C(OCCC)C=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NSC59984, CAS:803647-40-7, Molecular Weight: 265.2652, C12H15N3O4, Purity:98, SMILES: O=C(N1CCN(C)CC1)/C=C/C2=CC=C([N+]([O-])=O)O2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amezinium (methylsulfate), CAS:30578-37-1, Molecular Weight: 313.3296, C12H15N3O5S, Purity:98, SMILES: COC1=CC(N)=CN=[N+]1C2=CC=CC=C2.O=S(OC)([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(methylsulfonyl)-2,4,5,6-tetrahydropyrrolo[3,4-c]pyrazol-5-ium benzenesulfonate, CAS:1280210-80-1, Molecular Weight: 345.395, C12H15N3O5S2, Purity:99, SMILES: OS(=O)(=O)c1ccccc1.CS(=O)(=O)n1cc2CNCc2n1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-acetamidophenyl)-3-allylthiourea, CAS:17098-56-5, Molecular Weight: 249.332, C12H15N3OS, Purity:95, SMILES: C=CCNC(=S)Nc1ccc(cc1)NC(=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-amino-5-ethyl-4,6-dimethylthieno[2,3-b]pyridine-2-carboxamide, CAS:312915-90-5, Molecular Weight: 249.332, C12H15N3OS, Purity:95, SMILES: CCC1=C(C)C2=C(SC(C(N)=O)=C2N)N=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Entecavir, CAS:142217-69-4, Molecular Weight: 277.2792, C12H15N5O3, Purity:98, SMILES: O=C1NC(N)=NC2=C1N=CN2[C@@H]3C([C@H](CO)[C@@H](O)C3)=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tigemonam, CAS:102507-71-1, Molecular Weight: 437.4056, C12H15N5O9S2, Purity:98, SMILES: OC(CO/N=C(C1=CSC(N)=N1)\C(N[C@H]2C(C)(N(OS(=O)(O)=O)C2=O)C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,2,3,5,6,7-hexahydropyrido[3,2,1-ij]quinolin-8-ol, CAS:41175-50-2, Molecular Weight: 189.2536, C12H15NO, Purity:95, SMILES: Oc1ccc2CCCN3CCCc1c23, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-6-oxa-1-azaspiro[3.3]heptane, CAS:1223573-38-3, Molecular Weight: 189.2536, C12H15NO, Purity:95, SMILES: c1ccc(cc1)CN1CCC21COC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Methyl-3-phenylpiperidin-4-one, CAS:3881-28-5, Molecular Weight: 189.2536, C12H15NO, Purity:90, SMILES: CN1CCC(=O)C(C1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Oxa-6-azaspiro[3.3]heptane, 6-(phenylmethyl)-, CAS:46246-91-7, Molecular Weight: 189.2536, C12H15NO, Purity:95, SMILES: C(N1CC2(COC2)C1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3H-Spiro[2-benzofuran-1,4'-piperidine], CAS:38309-60-3, Molecular Weight: 189.2536, C12H15NO, Purity:97, SMILES: N1CCC2(CC1)OCc1c2cccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-Tert-Butyl 3-(Pyridin-2-YlAcrylate, CAS:181517-75-9, Molecular Weight: 205.253, C12H15NO2, Purity:95, SMILES: CC(C)(C)OC(=O)\C=C\C1=CC=CC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-4-(HydroxymethylPyrrolidin-2-One, CAS:96449-69-3, Molecular Weight: 205.253, C12H15NO2, Purity:95, SMILES: OCC1CN(CC2=CC=CC=C2)C(=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-BENZYL-4-HYDROXY-4-METHYLPYRROLIDIN-2-ONE, CAS:71392-17-1, Molecular Weight: 205.253, C12H15NO2, Purity:95, SMILES: CC1(O)CN(Cc2ccccc2)C(=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-pyrrolidine-3-carboxylic acid, CAS:5731-18-0, Molecular Weight: 205.253, C12H15NO2, Purity:95, SMILES: OC(=O)C1CCN(C1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-PiperidinylBenzoic Acid, CAS:42093-97-0, Molecular Weight: 205.253, C12H15NO2, Purity:95, SMILES: OC(=O)C1=CC=CC=C1N1CCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-Isopropoxy-3-methoxyphenyl)acetonitrile, CAS:861069-45-6, Molecular Weight: 205.253, C12H15NO2, Purity:94, SMILES: N#CCc1ccc(c(c1)OC)OC(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Ethyl-5-Hydroxy-1,3-Dimethyl-2,3-Dihydro-1H-Indol-2-One, CAS:120713-59-9, Molecular Weight: 205.253, C12H15NO2, Purity:95, SMILES: CCC1(C)C(=O)N(C)C2=C1C=C(O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Pyrrolidin-1-YlmethylBenzoic Acid, CAS:159691-25-5, Molecular Weight: 205.253, C12H15NO2, Purity:95, SMILES: OC(=O)C1=CC=C(CN2CCCC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Methyl-3-oxo-N-phenylpentanamide, CAS:124401-38-3, Molecular Weight: 205.253, C12H15NO2, Purity:95, SMILES: CC(C(=O)CC(=O)Nc1ccccc1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Bromo-1,2,3,4-Tetrahydroisoquinoline Hydrochloride, CAS:215798-19-9, Molecular Weight: 205.253, C12H15NO2, Purity:95, SMILES: COC1=CC=C2C(CC(=O)NC2(C)C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-tosyl-6-azabicyclo[3.1.0]hexane, CAS:81097-48-5, Molecular Weight: 237.318, C12H15NO2S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)N1C2CCCC12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-(-)-1-Cbz-3-Pyrrolidinol, CAS:100858-33-1, Molecular Weight: 221.2524, C12H15NO3, Purity:95, SMILES: O[C@@H]1CCN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(N-(2,4-dimethylphenyl)acetamido)acetic acid, CAS:299928-38-4, Molecular Weight: 221.2524, C12H15NO3, Purity:95, SMILES: CC1=C(N(C(C)=O)CC(O)=O)C=CC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(2,2-DimethylpropionylaminoBenzoic Acid, CAS:56619-96-6, Molecular Weight: 221.2524, C12H15NO3, Purity:95, SMILES: CC(C)(C)C(=O)NC1=CC(=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(2,2-DimethylpropionylaminoBenzoic Acid, CAS:56619-97-7, Molecular Weight: 221.2524, C12H15NO3, Purity:95, SMILES: CC(C)(C)C(=O)NC1=CC=C(C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Morpholinylmethyl)benzoic acid, CAS:62642-62-0, Molecular Weight: 221.2524, C12H15NO3, Purity:95, SMILES: OC(=O)c1ccc(cc1)CN1CCOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Benzylmorpholine-2-carboxylic acid, CAS:769087-80-1, Molecular Weight: 221.2524, C12H15NO3, Purity:95, SMILES: OC(=O)C1OCCN(C1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Benzyl-morpholine-3-carboxylic acid, CAS:1219426-63-7, Molecular Weight: 221.2524, C12H15NO3, Purity:97, SMILES: OC(=O)C1COCCN1Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acetic acid, 2-[[2-(1,1-dimethylethyl)phenyl]amino]-2-oxo-, CAS:254751-08-1, Molecular Weight: 221.2524, C12H15NO3, Purity:90, SMILES: OC(=O)C(=O)Nc1ccccc1C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzoic acid, 4-(formylamino)-, 1,1-dimethylethyl ester, CAS:477721-50-9, Molecular Weight: 221.2524, C12H15NO3, Purity:98, SMILES: CC(C)(C)OC(=O)c1ccc(NC=O)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 3-hydroxypyrrolidine-1-carboxylate, CAS:95656-88-5, Molecular Weight: 221.2524, C12H15NO3, Purity:97, SMILES: OC1CCN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| benzyl N[1(hydroxymethyl)cyclopropyl]carbamate, CAS:103500-22-7, Molecular Weight: 221.2524, C12H15NO3, Purity:95, SMILES: OCC1(CC1)NC(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 3-(benzylamino-3-oxopropanoate, CAS:29689-63-2, Molecular Weight: 221.2524, C12H15NO3, Purity:95, SMILES: CCOC(=O)CC(=O)NCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Metaxalone, CAS:1665-48-1, Molecular Weight: 221.2524, C12H15NO3, Purity:98, SMILES: O=C1OC(COC2=CC(C)=CC(C)=C2)CN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(4-methylbenzenesulfonyl)-2-oxa-6-azaspiro[3.3]heptane, CAS:13573-28-9, Molecular Weight: 253.317, C12H15NO3S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)N1CC2(C1)COC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vanitiolide, CAS:17692-71-6, Molecular Weight: 253.3174, C12H15NO3S, Purity:98, SMILES: S=C(C1=CC=C(O)C(OC)=C1)N2CCOCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((4-NitrobenzylOxyTetrahydro-2H-Pyran, CAS:18483-99-3, Molecular Weight: 237.2518, C12H15NO4, Purity:95, SMILES: [O-][N+](=O)C1=CC=C(COC2CCCCO2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-nitrophenoxy)hexanal, CAS:, Molecular Weight: 237.2518, C12H15NO4, Purity:95, SMILES: CCCCC(OC1=CC=C([N+]([O-])=O)C=C1)C=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-((tert-butoxycarbonyl)amino)benzoic acid, CAS:111331-82-9, Molecular Weight: 237.2518, C12H15NO4, Purity:95, SMILES: CC(C)(C)OC(=O)Nc1cccc(c1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-((tert-butoxycarbonyl)amino)benzoic acid, CAS:66493-39-8, Molecular Weight: 237.2518, C12H15NO4, Purity:95, SMILES: CC(C)(C)OC(=O)Nc1ccc(cc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzoic Acid, 4-[(2-Ethoxy-2-OxoethylAmino]-, Methyl Ester, CAS:729600-41-3, Molecular Weight: 237.2518, C12H15NO4, Purity:95, SMILES: CCOC(=O)CNC1=CC=C(C=C1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Tert-Butoxycarbonyl-5,6-Dihydro-4H-Thieno[3,2-B]Pyrrole-2-Carboxylic Acid, CAS:1250999-99-5, Molecular Weight: 269.317, C12H15NO4S, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=C1C=C(S2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 2-((4-MethylphenylsulfonamidoMethylAcrylate, CAS:1467725-31-0, Molecular Weight: 269.317, C12H15NO4S, Purity:95, SMILES: COC(=O)C(=C)CNS(=O)(=O)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(((benzyloxycarbonylamino-3-hydroxybutanoic acid, CAS:83349-20-6, Molecular Weight: 253.2512, C12H15NO5, Purity:95, SMILES: OC(CNC(=O)OCC1=CC=CC=C1)CC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-NITROPHENYL-BETA-D-GLUCOPYRANOSIDE, CAS:2492-87-7, Molecular Weight: 301.2494, C12H15NO8, Purity:95, SMILES: OC[C@H]1O[C@@H](OC2=CC=C(C=C2)[N+]([O-])=O)[C@H](O)[C@@H](O)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ONPG, CAS:369-07-3, Molecular Weight: 301.2494, C12H15NO8, Purity:98, SMILES: O[C@H]([C@@H](O)[C@H]1O)[C@@H](O[C@@H]1CO)OC2=C([N+]([O-])=O)C=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PNPG, CAS:2492-87-7, Molecular Weight: 301.2494, C12H15NO8, Purity:98, SMILES: O[C@H]1[C@@H](O[C@H](CO)[C@@H](O)[C@@H]1O)OC2=CC=C([N+]([O-])=O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Bromophenylboronic acid pinacol ester, CAS:594823-67-3, Molecular Weight: 282.969, C12H16BBrO2, Purity:95, SMILES: Brc1cccc(c1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Bromophenylboronic acid, pinacol ester, CAS:68716-49-4, Molecular Weight: 282.969, C12H16BBrO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-Chlorophenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:870195-94-1, Molecular Weight: 238.518, C12H16BClO2, Purity:95, SMILES: Clc1ccccc1B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Chloro-4-Hydroxyphenylboronic Acid, Pinacol Ester, CAS:629658-06-6, Molecular Weight: 254.518, C12H16BClO3, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=C(O)C(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,6-Difluoro-4-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-YlAniline, CAS:939968-08-8, Molecular Weight: 255.069, C12H16BF2NO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC(F)=C(N)C(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Amino-3-(TrifluoromethylPyridine-5-Boronic Acid Pinacol Ester, CAS:947249-01-6, Molecular Weight: 288.074, C12H16BF3N2O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CN=C(N)C(=C1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Amino-4-(trifluoromethyl)pyridine-5-boronic acid pinacol ester, CAS:944401-57-4, Molecular Weight: 288.074, C12H16BF3N2O2, Purity:95, SMILES: FC(c1cc(N)ncc1B1OC(C(O1)(C)C)(C)C)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-IODOPHENYLBORONIC ACID PINACOL ESTER, CAS:73852-88-7, Molecular Weight: 329.97, C12H16BIO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=C(I)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)-[1,2,4]triazolo[1,5-a]pyridine, CAS:1160790-18-0, Molecular Weight: 245.085, C12H16BN3O2, Purity:97, SMILES: CC1(C)OB(OC1(C)C)c1ccc2n(c1)ncn2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(tetramethyl-1,3,2-dioxaborolan-2-yl)-[1,2,4]triazolo[4,3-a]pyridine, CAS:1314137-24-0, Molecular Weight: 245.085, C12H16BN3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1ccc2n(c1)cnn2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-Tetramethyl-2-(2-nitrophenyl)-1,3,2-dioxaborolane, CAS:190788-59-1, Molecular Weight: 249.071, C12H16BNO4, Purity:95, SMILES: [O-][N+](=O)c1ccccc1B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Nitrophenylboronic Acid Pinacol Ester, CAS:171364-83-3, Molecular Weight: 249.071, C12H16BNO4, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=C(C=C1)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Nitrophenylboronic acid, pinacol ester, CAS:171364-83-3, Molecular Weight: 249.071, C12H16BNO4, Purity:98, SMILES: CC1(C)OB(OC1(C)C)c1ccc(cc1)[N+](=O)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vaborbactam, CAS:1360457-46-0, Molecular Weight: 297.1351, C12H16BNO5S, Purity:98, SMILES: O=C(O)C[C@@H]1CC[C@H](NC(CC2=CC=CS2)=O)B(O)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| cyclobutanecarboxylic acid [3-(5-bromo-2-chloro-pyrimidin-4-ylamino)-propyl]-amide, CAS:1243268-69-0, Molecular Weight: 347.639, C12H16BrClN4O, Purity:95, SMILES: Clc1ncc(Br)c(NCCCNC(=O)C2CCC2)n1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Boc-2-bromobenzylamine, CAS:162356-90-3, Molecular Weight: 286.165, C12H16BrNO2, Purity:97, SMILES: O=C(OC(C)(C)C)NCc1ccccc1Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl (4-(bromomethyl)phenyl)carbamate, CAS:239074-27-2, Molecular Weight: 286.165, C12H16BrNO2, Purity:95, SMILES: CC(C)(C)OC(=O)Nc1ccc(CBr)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-Bromobenzylcarbamate, CAS:171663-13-1, Molecular Weight: 286.165, C12H16BrNO2, Purity:95, SMILES: CC(C)(C)OC(=O)NCC1=CC(Br)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-bromobenzylcarbamate, CAS:68819-84-1, Molecular Weight: 286.165, C12H16BrNO2, Purity:97, SMILES: CC(C)(C)OC(=O)NCc1ccc(Br)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl3-Bromo-6,7-dihydrothieno[3,2-c]pyridine-5(4H)-carboxylate, CAS:1000577-81-0, Molecular Weight: 318.23, C12H16BrNO2S, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=C(C1)C(Br)=CS2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Chloro-N-(Piperidin-4-YlBenzamide Hydrochloride, CAS:1835590-54-9, Molecular Weight: 275.174, C12H16Cl2N2O, Purity:95, SMILES: Cl.ClC1=CC=CC=C1C(=O)NC1CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Chloro-4-(4-Methylpiperazin-1-YlBenzoic Acid Hydrochloride, CAS:0, Molecular Weight: 291.174, C12H16Cl2N2O2, Purity:95, SMILES: Cl.CN1CCN(CC1)C1=CC(Cl)=C(C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MPTP (hydrochloride), CAS:23007-85-4, Molecular Weight: 209.7151, C12H16ClN, Purity:98, SMILES: CN1CC=C(C2=CC=CC=C2)CC1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Cyclohexyl-4-Chloroaniline, CAS:56506-61-7, Molecular Weight: 209.715, C12H16ClN, Purity:95, SMILES: ClC1=CC=C(NC2CCCCC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pardoprunox (hydrochloride), CAS:269718-83-4, Molecular Weight: 269.7273, C12H16ClN3O2, Purity:98, SMILES: O=C1OC2=C(N3CCN(C)CC3)C=CC=C2N1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R-4-Benzyl-2-(ChloromethylMorpholine, CAS:186293-54-9, Molecular Weight: 225.715, C12H16ClNO, Purity:95, SMILES: ClC[C@H]1CN(CC2=CC=CC=C2)CCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Benzyl-2-(ChloromethylMorpholine, CAS:40987-25-5, Molecular Weight: 225.715, C12H16ClNO, Purity:95, SMILES: ClCC1CN(CC2=CC=CC=C2)CCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Spiro-[1-phthalan]piperidine, HCl, CAS:37663-44-8, Molecular Weight: 225.715, C12H16ClNO, Purity:95, SMILES: N1CCC2(CC1)OCc1c2cccc1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-Methyl 2-Phenylpyrrolidine-3-Carboxylate Hydrochloride, CAS:82959-88-4, Molecular Weight: 241.714, C12H16ClNO2, Purity:95, SMILES: Cl.COC(=O)[C@@H]1CCN[C@H]1C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-benzyl-2-morpholinecarboxylic acid hydrochloride, CAS:135072-15-0, Molecular Weight: 257.713, C12H16ClNO3, Purity:97, SMILES: OC(=O)C1OCCN(C1)Cc1ccccc1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-3,3-difluoropiperidin-4-amine, CAS:1039741-55-3, Molecular Weight: 226.2656, C12H16F2N2, Purity:95, SMILES: NC1CCN(CC1(F)F)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(trifluoromethylmorpholine 4-methylbenzenesulfonate, CAS:1196152-13-2, Molecular Weight: 327.32, C12H16F3NO4S, Purity:95, SMILES: FC(F)(F)C1COCCN1.CC1=CC=C(C=C1)S(O)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Cyclohexyl-4-Fluoroaniline, CAS:136684-94-1, Molecular Weight: 193.2605, C12H16FN, Purity:95, SMILES: FC1=CC=C(NC2CCCCC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ((2R,5S-5-(4-amino-5-fluoro-2-oxopyrimidin-1(2H-yl-1,3-oxathiolan-2-ylmethyl butyrate, CAS:143446-69-9, Molecular Weight: 317.337, C12H16FN3O4S, Purity:95, SMILES: CCCC(=O)OC[C@@H]1O[C@@H](CS1)N1C=C(F)C(=N)NC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ((2S,5R-5-(4-amino-5-fluoro-2-oxopyrimidin-1(2H-yl-1,3-oxathiolan-2-ylmethyl butyrate, CAS:143446-69-9, Molecular Weight: 317.337, C12H16FN3O4S, Purity:95, SMILES: CCCC(=O)OC[C@H]1O[C@H](CS1)N1C=C(F)C(=N)NC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(6-Amino-3,3-dimethylindolin-1-yl)ethanone, CAS:453562-71-5, Molecular Weight: 204.2682, C12H16N2O, Purity:97, SMILES: CC(=O)N1CC(C)(C)c2ccc(N)cc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-1,4-Diazepan-5-One, CAS:55186-89-5, Molecular Weight: 204.2682, C12H16N2O, Purity:95, SMILES: O=C1CCN(CC2=CC=CC=C2)CCN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-Piperidin-4-One Oxime, CAS:949-69-9, Molecular Weight: 204.2682, C12H16N2O, Purity:95, SMILES: ON=C1CCN(CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Methylpiperazin-1-yl)benzaldehyde, CAS:27913-99-1, Molecular Weight: 204.2682, C12H16N2O, Purity:98, SMILES: O=Cc1ccc(cc1)N1CCN(CC1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Methylpiperazino)benzaldehyde, CAS:27913-99-1, Molecular Weight: 204.2682, C12H16N2O, Purity:95, SMILES: CN1CCN(CC1)C1=CC=C(C=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| VO-Ohpic (trihydrate), CAS:476310-60-8, Molecular Weight: 415.2032, C12H16N2O11V+, Purity:98, SMILES: O=C(O1)C2=NC=CC=C2O[V]13(OC(C4=[N]3C=CC=C4O)=O)([H])(O)=O.O.O.O.[H+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4-methylpiperazin-1-yl)benzoic acid, CAS:215309-01-6, Molecular Weight: 220.2676, C12H16N2O2, Purity:97, SMILES: CN1CCN(CC1)c1cccc(c1)C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Methylpiperazin-1-yl)benzoic acid, CAS:86620-62-4, Molecular Weight: 220.2676, C12H16N2O2, Purity:99, SMILES: CN1CCN(CC1)c1ccc(cc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzaldehyde (Tert-ButoxycarbonylHydrazone, CAS:24469-50-9, Molecular Weight: 220.2676, C12H16N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)NN=CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl piperazine-1-carboxylate, CAS:31166-44-6, Molecular Weight: 220.2676, C12H16N2O2, Purity:95, SMILES: O=C(N1CCNCC1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Eltoprazine, CAS:98224-03-4, Molecular Weight: 220.2676, C12H16N2O2, Purity:98, SMILES: N1(C2=C3OCCOC3=CC=C2)CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N'-Cyclopentylidene-4-Methylbenzenesulfonohydrazide, CAS:17529-98-5, Molecular Weight: 252.333, C12H16N2O2S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)NN=C1CCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 2-Morpholin-4-Yl-Nicotinate, CAS:773139-22-3, Molecular Weight: 236.267, C12H16N2O3, Purity:95, SMILES: CCOC(=O)C1=C(N=CC=C1)N1CCOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-4-Amino-2-(((benzyloxy)carbonyl)amino)butanoic acid, CAS:70882-66-5, Molecular Weight: 252.2664, C12H16N2O4, Purity:97, SMILES: NCC[C@@H](NC(=O)OCc1ccccc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-4-Amino-2-(((benzyloxy)carbonyl)amino)butanoic acid, CAS:62234-40-6, Molecular Weight: 252.2664, C12H16N2O4, Purity:98, SMILES: NCC[C@H](NC(=O)OCc1ccccc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| diethyl 1,2-phenylenedicarbamate, CAS:6324-13-6, Molecular Weight: 252.2664, C12H16N2O4, Purity:95, SMILES: CCOC(=O)Nc1ccccc1NC(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 5-(tert-butoxycarbonylamino)nicotinate, CAS:168618-38-0, Molecular Weight: 252.2664, C12H16N2O4, Purity:95, SMILES: COC(=O)c1cncc(c1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Alpha-Cbz-Glycine N-Methoxy-N-Methylamide, CAS:121505-94-0, Molecular Weight: 252.2664, C12H16N2O4, Purity:95, SMILES: CON(C)C(=O)CNC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RJR-2403 (oxalate), CAS:220662-95-3, Molecular Weight: 252.2664, C12H16N2O4, Purity:98, SMILES: CNCC/C=C/C1=CC=CN=C1.OC(C(O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-[(Tert-ButoxyCarbonyl]-4H,5H,6H,7H-[1,2]Oxazolo[4,5-C]Pyridine-3-Carboxylic Acid, CAS:912265-93-1, Molecular Weight: 268.2658, C12H16N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=C(C1)C(=NO2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-allyl-3-(4-ethylphenyl)thiourea, CAS:220604-75-1, Molecular Weight: 220.334, C12H16N2S, Purity:90, SMILES: CCc1ccc(cc1)NC(=S)NCC=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Xylazine, CAS:7361-61-7, Molecular Weight: 220.3338, C12H16N2S, Purity:98, SMILES: CC1=C(C(C)=CC=C1)NC2=NCCCS2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| γ-GT, CAS:63699-78-5, Molecular Weight: 328.278, C12H16N4O7, Purity:98, SMILES: O=C(O)C1=CC(NC(CC[C@H](N)C(O)=O)=O)=CC=C1[N+]([O-])=O.N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-(tert-Butyl)phenyl)ethanone, CAS:943-27-1, Molecular Weight: 176.2548, C12H16O, Purity:98, SMILES: CC(=O)c1ccc(cc1)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(TERT-PENTYL)BENZALDEHYDE, CAS:67468-54-6, Molecular Weight: 176.2548, C12H16O, Purity:95, SMILES: CCC(C)(C)c1ccc(C=O)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Cyclohexylphenol, CAS:1131-60-8, Molecular Weight: 176.2548, C12H16O, Purity:95, SMILES: Oc1ccc(cc1)C1CCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-ethylphenyl)-2-methylpropanoic acid, CAS:1247119-83-0, Molecular Weight: 192.2542, C12H16O2, Purity:99, SMILES: CCc1ccc(cc1)C(C)(C)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(4'-Hydroxyphenoxy)-1-hexene, CAS:85234-58-8, Molecular Weight: 192.2542, C12H16O2, Purity:95, SMILES: C=CCCCCOc1ccc(cc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 3-(3-methylphenyl)propanoate, CAS:7297-13-4, Molecular Weight: 192.2542, C12H16O2, Purity:96, SMILES: CCOC(=O)CCc1cccc(c1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,3-Propanediol, 2-(phenylmethyl)-, 1-acetate, CAS:90107-01-0, Molecular Weight: 208.2536, C12H16O3, Purity:95, SMILES: OCC(Cc1ccccc1)COC(=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Isopropyl-3,4-dimethoxybenzaldehyde, CAS:77256-02-1, Molecular Weight: 208.2536, C12H16O3, Purity:95, SMILES: COc1ccc(c(c1OC)C(C)C)C=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| alpha-Asarone, CAS:2883-98-9, Molecular Weight: 208.2536, C12H16O3, Purity:98, SMILES: C/C=C/C1=C(OC)C=C(OC)C(OC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 3-(4-hydroxy-2-methylphenyl)propanoate, CAS:628333-29-9, Molecular Weight: 208.2536, C12H16O3, Purity:90, SMILES: CCOC(=O)CCc1ccc(cc1C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 4-oxoadamantane-1-carboxylate, CAS:56674-88-5, Molecular Weight: 208.2536, C12H16O3, Purity:95, SMILES: COC(=O)C12CC3CC(C2)C(=O)C(C1)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-methyl 3-(1,4-dioxaspiro[4.5]dec-7-en-7-ylacrylate, CAS:0, Molecular Weight: 224.253, C12H16O4, Purity:95, SMILES: COC(=O)\C=C\C1=CCCC2(C1)OCCO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R-2,3-Dihydroxy-3-Methyl-Butyric Acid Benzyl Ester, CAS:184528-76-5, Molecular Weight: 224.253, C12H16O4, Purity:95, SMILES: CC(C)(O)[C@@H](O)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzeneacetic acid, 3-methoxy-4-(1-methylethoxy)-, CAS:88449-50-7, Molecular Weight: 224.253, C12H16O4, Purity:93, SMILES: COc1cc(ccc1OC(C)C)CC(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzoic Acid, 3,5-Diethoxy-, Methyl Ester, CAS:198623-55-1, Molecular Weight: 224.253, C12H16O4, Purity:95, SMILES: CCOC1=CC(=CC(OCC)=C1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 2-(3,5-DimethoxyphenylAcetate, CAS:65976-77-4, Molecular Weight: 224.253, C12H16O4, Purity:95, SMILES: CCOC(=O)CC1=CC(OC)=CC(OC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetrahydro-2H-Pyran-4-Yl 4-Methylbenzenesulfonate, CAS:97986-34-0, Molecular Weight: 256.318, C12H16O4S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OC1CCOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Toluene-4-Sulfonic Acid 2-Cyclopropoxy-Ethyl Ester, CAS:862728-59-4, Molecular Weight: 256.318, C12H16O4S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OCCOC1CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Malotilate, CAS:59937-28-9, Molecular Weight: 288.383, C12H16O4S2, Purity:98, SMILES: O=C(OC(C)C)/C(C(OC(C)C)=O)=C1SC=CS\1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2R,3S,4R,5R-2-(BenzyloxyTetrahydro-2H-Pyran-3,4,5-Triol, CAS:5329-50-0, Molecular Weight: 240.2524, C12H16O5, Purity:95, SMILES: O[C@@H]1CO[C@@H](OCC2=CC=CC=C2)[C@@H](O)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1,1-dioxidothietan-3-yl)ethyl 4-methylbenzenesulfonate, CAS:1637751-74-6, Molecular Weight: 304.382, C12H16O5S2, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)OCCC1CS(=O)(=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Arbutin, CAS:497-76-7, Molecular Weight: 272.2513, C12H16O7, Purity:98, SMILES: O[C@H]([C@H]([C@@H]([C@@H](CO)O1)O)O)[C@@H]1OC2=CC=C(O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Fluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)aniline, CAS:819058-34-9, Molecular Weight: 237.078, C12H17BFNO2, Purity:97, SMILES: CC1(C)OB(OC1(C)C)c1ccc(N)c(F)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-AMino-4-fluorobenzeneboronic acid pinacol ester, CAS:1003575-43-6, Molecular Weight: 237.078, C12H17BFNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC(N)=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Amino-2-Fluorophenylboronic Acid Pinacol Ester, CAS:819057-45-9, Molecular Weight: 237.078, C12H17BFNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=C(N)C=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-methoxy-3-nitro-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine, CAS:1083168-94-8, Molecular Weight: 280.085, C12H17BN2O5, Purity:95, SMILES: COc1ncc(cc1[N+]([O-])=O)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)phenol, CAS:214360-76-6, Molecular Weight: 220.073, C12H17BO3, Purity:98, SMILES: CC1(C)OB(OC1(C)C)c1cccc(O)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)phenol, CAS:269409-70-3, Molecular Weight: 220.073, C12H17BO3, Purity:97, SMILES: CC1(C)OB(OC1(C)C)c1ccc(cc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-bromo-1,3-diisopropylbenzene, CAS:57190-17-7, Molecular Weight: 241.167, C12H17Br, Purity:95, SMILES: CC(C)c1cccc(C(C)C)c1Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl (2-bromo-4,5,6,7-tetrahydrobenzo[d]thiazol-6-yl)carbamate, CAS:1251009-79-6, Molecular Weight: 333.245, C12H17BrN2O2S, Purity:95, SMILES: CC(C)(C)OC(=O)NC1CCC2=C(C1)SC(Br)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Piperidin-4-yl)-1H-pyrrolo[2,3-b]pyridinedihydrochloride, CAS:1185295-25-3, Molecular Weight: 274.189, C12H17Cl2N3, Purity:95, SMILES: N1CCC(CC1)c1cc2c([nH]1)nccc2.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2-Chlorophenyl(DiethylaminoAcetic Acid Hydrochloride, CAS:0, Molecular Weight: 278.175, C12H17Cl2NO2, Purity:95, SMILES: Cl.CCN(CC)C(C(O)=O)C1=CC=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-Chlorophenyl(DiethylaminoAcetic Acid Hydrochloride, CAS:0, Molecular Weight: 278.175, C12H17Cl2NO2, Purity:95, SMILES: Cl.CCN(CC)C(C(O)=O)C1=CC=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Meclofenoxate (hydrochloride), CAS:3685-84-5, Molecular Weight: 294.1743, C12H17Cl2NO3, Purity:98, SMILES: ClC1=CC=C(OCC(OCCN(C)C)=O)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-FLUOROBENZYL)PIPERIDINE HYDROCHLORIDE Salt, CAS:193357-52-7, Molecular Weight: 229.721, C12H17ClFN, Purity:97, SMILES: Cl.Fc1ccc(CC2CCNCC2)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Piperidinamine, 2-[(4-chlorophenyl)methyl]-, (2R-trans)- (9CI), CAS:177707-18-5, Molecular Weight: 224.73, C12H17ClN2, Purity:95, SMILES: N[C@H]1CCN[C@@H](C1)Cc1ccc(cc1)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-3-Amino-1-N-Cbz-pyrrolidine hydrochloride, CAS:870621-17-3, Molecular Weight: 256.729, C12H17ClN2O2, Purity:97, SMILES: N[C@@H]1CCN(C1)C(=O)OCc1ccccc1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-[(4-methylpiperazin-1-yl)carbonyl]phenol hydrochloride, CAS:85858-94-2, Molecular Weight: 256.729, C12H17ClN2O2, Purity:95, SMILES: CN1CCN(CC1)C(=O)c1ccc(cc1)O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Eltoprazine (hydrochloride), CAS:98206-09-8, Molecular Weight: 256.7286, C12H17ClN2O2, Purity:98, SMILES: [H]Cl.N1(C2=C3OCCOC3=CC=C2)CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2-(2-ChlorobenzylHydrazinecarboxylate, CAS:135941-95-6, Molecular Weight: 256.729, C12H17ClN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)NNCC1=CC=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-Benzyl (4-Hydroxypyrrolidin-3-YlCarbamate Hydrochloride, CAS:0, Molecular Weight: 272.728, C12H17ClN2O3, Purity:95, SMILES: Cl.O[C@@H]1CNC[C@H]1NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 2-(S)-[N-Carbobenzyloxy]amino-3-aminopropionate, Hydrochloride, CAS:35761-27-4, Molecular Weight: 288.727, C12H17ClN2O4, Purity:95, SMILES: Cl.COC(=O)[C@H](CN)NC(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Xylazine (hydrochloride), CAS:23076-35-9, Molecular Weight: 256.7948, C12H17ClN2S, Purity:98, SMILES: CC1=C(C(C)=CC=C1)NC2=NCCCS2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Xylazine hydrochloride, CAS:23076-35-9, Molecular Weight: 256.795, C12H17ClN2S, Purity:95, SMILES: Cl.CC1=CC=CC(C)=C1NC1=NCCCS1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Chloro-2,4-di(4-morpholinyl)pyrimidine, CAS:10244-24-3, Molecular Weight: 284.742, C12H17ClN4O2, Purity:95, SMILES: Clc1cc(nc(n1)N1CCOCC1)N1CCOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thiamine monochloride, CAS:59-43-8, Molecular Weight: 300.80758, C12H17ClN4OS, Purity:98, SMILES: CC1=C(CCO)SC=[N+]1CC2=CN=C(C)N=C2N.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-(Boc)-3,3-Difluoro-1,2,3,6-tetrahydropyridin-4-yl)acetic acid, CAS:, Molecular Weight: 277.2645, C12H17F2NO4, Purity:95, SMILES: OC(=O)CC1=CCN(CC1(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3,3-difluoro-4-(2,2,2-trifluoroacetamido)piperidine-1-carboxylate, CAS:, Molecular Weight: 332.267, C12H17F5N2O3, Purity:95, SMILES: O=C(N1CCC(C(C1)(F)F)NC(=O)C(F)(F)F)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R-1-(4-fluorobenzyl-3-methylpiperazine, CAS:422270-29-9, Molecular Weight: 208.2752, C12H17FN2, Purity:95, SMILES: C[C@@H]1CN(CC2=CC=C(F)C=C2)CCN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Aminomethyl-4-(4-fluorobenzyl)morpholine, CAS:112914-13-3, Molecular Weight: 224.2746, C12H17FN2O, Purity:95, SMILES: FC1=CC=C(C=C1)CN2CC(CN)OCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Tert-Butyl-2-Ethoxy-1-Iodobenzene, CAS:870007-40-2, Molecular Weight: 304.1673, C12H17IO, Purity:95, SMILES: CCOC1=C(I)C=CC(=C1)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Methyl-4-phenylpiperidine, CAS:774-52-7, Molecular Weight: 175.2701, C12H17N, Purity:95, SMILES: CN1CCC(CC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,4,4-TRIMETHYL-1,2,3,4-TETRAHYDROISOQUINOLINE, CAS:1110704-58-9, Molecular Weight: 175.2701, C12H17N, Purity:95, SMILES: CN1Cc2ccccc2C(C)(C)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Ethyl-4-(4-nitrophenyl)piperazine, CAS:115619-00-6, Molecular Weight: 235.2823, C12H17N3O2, Purity:95, SMILES: CCN1CCN(CC1)c1ccc(cc1)[N+](=O)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Methyl-4-(4-nitrobenzyl)piperazine, CAS:70261-81-3, Molecular Weight: 235.2823, C12H17N3O2, Purity:95, SMILES: CN1CCN(CC1)Cc1ccc(cc1)[N+](=O)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methylsulfanyl-5,7-dihydro-pyrrolo[3,4-d]pyrimidine-6-carboxylic acid tert-butyl ester, CAS:365996-86-7, Molecular Weight: 267.347, C12H17N3O2S, Purity:95, SMILES: CSc1ncc2c(n1)CN(C2)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(3-Methoxy-4-Nitrophenyl-4-Methylpiperazine, CAS:761440-26-0, Molecular Weight: 251.2817, C12H17N3O3, Purity:95, SMILES: COC1=CC(=CC=C1[N+]([O-])=O)N1CCN(C)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Formyl-5,6-Dihydro-8H-Imidazo[1,2-A]Pyrazine-7-Carboxylic Acid Tert-Butyl Ester, CAS:1174068-98-4, Molecular Weight: 251.2817, C12H17N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2C=C(C=O)N=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cariporide, CAS:159138-80-4, Molecular Weight: 283.3467, C12H17N3O3S, Purity:98, SMILES: O=C(NC(N)=N)C1=CC=C(C(C)C)C(S(=O)(C)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(Tert-Butoxycarbonyl-4,5,6,7-Tetrahydro-1H-Pyrazolo[4,3-C]Pyridine-3-Carboxylic Acid, CAS:518990-56-2, Molecular Weight: 267.2811, C12H17N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=NNC(C(O)=O)=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(Tert-Butoxycarbonyl-4,5,6,7-Tetrahydropyrazolo[1,5-A]Pyrazine-2-Carboxylic Acid, CAS:1209492-73-8, Molecular Weight: 267.2811, C12H17N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2N=C(C=C2C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(Tert-Butoxycarbonyl-4,5,6,7-Tetrahydropyrazolo[1,5-A]Pyrazine-3-Carboxylic Acid, CAS:1280214-48-3, Molecular Weight: 267.2811, C12H17N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2N=CC(C(O)=O)=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(Tert-Butoxycarbonyl-4,5,6,7-Tetrahydropyrazolo[1,5-A]Pyrazine-7-Carboxylic Acid, CAS:1823815-24-2, Molecular Weight: 267.2811, C12H17N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC(N2N=CC=C2C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-N-Boc-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrazine-2-carboxylic acid, CAS:1209492-73-8, Molecular Weight: 267.2811, C12H17N3O4, Purity:98, SMILES: CC(C)(C)OC(=O)N1CCn2nc(cc2C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-(Tert-Butoxycarbonyl-5,6,7,8-Tetrahydroimidazo[1,2-A]Pyrazine-3-Carboxylic Acid, CAS:1314391-59-7, Molecular Weight: 267.2811, C12H17N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2C(C1)=NC=C2C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-(Tert-Butoxycarbonyl-5,6,7,8-Tetrahydroimidazo[1,5-A]Pyrazine-1-Carboxylic Acid, CAS:1160248-16-7, Molecular Weight: 267.2811, C12H17N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2C=NC(C(O)=O)=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 2-(methylsulfonyl)-5H-pyrrolo[3,4-d]pyrimidine-6(7H)-carboxylate, CAS:365996-87-8, Molecular Weight: 299.346, C12H17N3O4S, Purity:95, SMILES: O=C(N1Cc2c(C1)nc(nc2)S(=O)(=O)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NU2058, CAS:161058-83-9, Molecular Weight: 247.2963, C12H17N5O, Purity:98, SMILES: NC1=NC(OCC2CCCCC2)=C3NC=NC3=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Entecavir (monohydrate), CAS:209216-23-9, Molecular Weight: 295.2945, C12H17N5O4, Purity:98, SMILES: O=C1NC(N)=NC2=C1N=CN2[C@@H]3C([C@H](CO)[C@@H](O)C3)=C.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thiamine nitrate, CAS:532-43-4, Molecular Weight: 327.35948, C12H17N5O4S, Purity:98, SMILES: CC1=C(CCO)SC=[N+]1CC2=CN=C(C)N=C2N.[O-][N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1-Phenylpiperidin-4-yl)methanol, CAS:697306-45-9, Molecular Weight: 191.2695, C12H17NO, Purity:95, SMILES: OCC1CCN(CC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzylpiperidin-4-ol, CAS:4727-72-4, Molecular Weight: 191.2695, C12H17NO, Purity:95, SMILES: OC1CCN(CC1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-ethyl-2-phenylmorpholine, CAS:100368-98-7, Molecular Weight: 191.2695, C12H17NO, Purity:95, SMILES: CCC1NCCOC1c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DEET, CAS:134-62-3, Molecular Weight: 191.2695, C12H17NO, Purity:98, SMILES: O=C(N(CC)CC)C1=CC=CC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3-(Benzylamino)oxetan-3-yl)ethanol, CAS:1223573-34-9, Molecular Weight: 207.2689, C12H17NO2, Purity:90, SMILES: OCCC1(NCc2ccccc2)COC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Amino-3-(4-isopropylphenyl)propionic acid, CAS:117391-53-4, Molecular Weight: 207.2689, C12H17NO2, Purity:95, SMILES: NC(c1ccc(cc1)C(C)C)CC(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ciclopirox, CAS:29342-05-0, Molecular Weight: 207.2689, C12H17NO2, Purity:98, SMILES: CC(C=C(C1CCCCC1)N2O)=CC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-1-Benzylazetidine-2,4-DiylDimethanol, CAS:127310-66-1, Molecular Weight: 207.2689, C12H17NO2, Purity:95, SMILES: OC[C@H]1C[C@@H](CO)N1CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(3-MethoxyphenylPivalamide, CAS:56619-93-3, Molecular Weight: 207.2689, C12H17NO2, Purity:95, SMILES: COC1=CC=CC(NC(=O)C(C)(C)C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-BENZYL-BETA-ALANINE ETHYL ESTER, CAS:23583-21-3, Molecular Weight: 207.2689, C12H17NO2, Purity:95, SMILES: CCOC(=O)CCNCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(tert-butoxycarbonyl)-4,5,6,7-tetrahydro-6H-thieno[2,3-c]pyridine, CAS:165947-52-4, Molecular Weight: 239.334, C12H17NO2S, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=C(C1)SC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bucetin, CAS:1083-57-4, Molecular Weight: 223.2683, C12H17NO3, Purity:98, SMILES: CC(O)CC(NC1=CC=C(OCC)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bufexamac, CAS:2438-72-4, Molecular Weight: 223.2683, C12H17NO3, Purity:98, SMILES: O=C(NO)CC1=CC=C(OCCCC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cerulenin, CAS:17397-89-6, Molecular Weight: 223.2683, C12H17NO3, Purity:98, SMILES: O=C([C@@H]1O[C@@H]1C(CC/C=C/C/C=C/C)=O)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Etamivan, CAS:304-84-7, Molecular Weight: 223.2683, C12H17NO3, Purity:98, SMILES: O=C(N(CC)CC)C1=CC=C(O)C(OC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 2-amino-3-(4-hydroxyphenyl)-2-methylpropanoate, CAS:16323-00-5, Molecular Weight: 223.2683, C12H17NO3, Purity:98, SMILES: CCOC(=O)C(C)(N)Cc1ccc(O)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| isobutyl (4-(hydroxymethyl)phenyl)carbamate, CAS:1342997-75-4, Molecular Weight: 223.2683, C12H17NO3, Purity:95, SMILES: CC(C)COC(=O)Nc1ccc(CO)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(4-Methoxybenzyl)-b-alanine methyl ester, CAS:55383-92-1, Molecular Weight: 223.2683, C12H17NO3, Purity:95, SMILES: COC(=O)CCNCc1ccc(cc1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl (3-methoxyphenylcarbamate, CAS:60144-52-7, Molecular Weight: 223.2683, C12H17NO3, Purity:95, SMILES: COC1=CC=CC(NC(=O)OC(C)(C)C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl (4-MethoxyphenylCarbamate, CAS:18437-68-8, Molecular Weight: 223.2683, C12H17NO3, Purity:95, SMILES: COC1=CC=C(NC(=O)OC(C)(C)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 5-oxo-3,3a,4,5-tetrahydrocyclopenta[c]pyrrole-2(1H-carboxylate, CAS:148404-32-4, Molecular Weight: 223.2683, C12H17NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CC(=O)C=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl benzyloxycarbamate, CAS:79722-21-7, Molecular Weight: 223.2683, C12H17NO3, Purity:95, SMILES: O=C(OC(C)(C)C)NOCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Carbamic Acid, N-(2,2-Dimethoxyethyl-, Phenylmethyl Ester, CAS:114790-39-5, Molecular Weight: 239.2677, C12H17NO4, Purity:95, SMILES: COC(CNC(=O)OCC1=CC=CC=C1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl 3,5-Dimethyl-1H-Pyrrole-2,4-Dicarboxylate, CAS:2436-79-5, Molecular Weight: 239.2677, C12H17NO4, Purity:95, SMILES: CCOC(=O)C1=C(C)C(C(=O)OCC)=C(C)N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl 3,5-dimethyl-1H-pyrrole-2,4-dicarboxylate, CAS:2436-79-5, Molecular Weight: 239.2677, C12H17NO4, Purity:97, SMILES: CCOC(=O)c1[nH]c(C)c(C(=O)OCC)c1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 3-(3-(methoxymethoxy)pyridin-4-yl)propanoate, CAS:, Molecular Weight: 239.2677, C12H17NO4, Purity:92, SMILES: CCOC(=O)CCc1ccncc1OCOC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-(Hydroxymethyl-4H-Furo[2,3-C]Pyrrole-5(6H-Carboxylate, CAS:1823776-29-9, Molecular Weight: 239.2677, C12H17NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2=C(C1)C(CO)=CO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2-METHANESULFONYL-1-METHYL-ETHYL-CARBAMIC ACID BENZYL ESTER, CAS:1341040-10-5, Molecular Weight: 271.333, C12H17NO4S, Purity:95, SMILES: C[C@@H](CS(C)(=O)=O)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2-METHANESULFONYL-1-METHYL-ETHYL-CARBAMIC ACID BENZYL ESTER, CAS:1032451-76-5, Molecular Weight: 271.333, C12H17NO4S, Purity:95, SMILES: C[C@H](CS(C)(=O)=O)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Oxa-3-Azabicyclo[3.1.1]Heptane Tosylate, CAS:1339953-58-0, Molecular Weight: 271.333, C12H17NO4S, Purity:95, SMILES: C1C2CNCC1O2.CC1=CC=C(C=C1)S(O)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Oxa-3-azabicyclo[3.1.1]heptane tosylate, CAS:1339953-58-0, Molecular Weight: 271.333, C12H17NO4S, Purity:95, SMILES: C1C2CNCC1O2.Cc1ccc(cc1)S(O)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(Tert-Butoxycarbonyl-P-Toluenesulfonamide, CAS:18303-04-3, Molecular Weight: 271.333, C12H17NO4S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| METHANESULFONIC ACID 2-BENZYLOXYCARBONYLAMINO-PROPYL ESTER, CAS:161494-74-2, Molecular Weight: 287.332, C12H17NO5S, Purity:95, SMILES: C[C@H](COS(C)(=O)=O)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Boc-O-tosyl hydroxylamine, CAS:105838-14-0, Molecular Weight: 287.332, C12H17NO5S, Purity:95, SMILES: O=C(OC(C)(C)C)NOS(=O)(=O)c1ccc(cc1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Nitrophenyl (2-(trimethylsilyl)ethyl) carbonate, CAS:80149-80-0, Molecular Weight: 283.3526, C12H17NO5Si, Purity:99, SMILES: C[Si](C)(C)CCOC(=O)Oc1ccc(cc1)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| m-Aminophenyl boronic acid, hemisulphate, CAS:66472-86-4, Molecular Weight: 371.967, C12H18B2N2O8S, Purity:95, SMILES: OS(=O)(=O)O.Nc1cccc(c1)B(O)O.Nc1cccc(c1)B(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Fluorophenylboronic acid, pinacol ester, CAS:214360-58-4, Molecular Weight: 240.079, C12H18BFO3, Purity:95, SMILES: CC(C)(O)C(C)(C)OB(O)C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acetamide, N-[5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-pyrimidinyl]-, CAS:1218791-37-7, Molecular Weight: 263.101, C12H18BN3O3, Purity:95, SMILES: CC(=O)Nc1ncc(cn1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)aniline, CAS:191171-55-8, Molecular Weight: 219.088, C12H18BNO2, Purity:95, SMILES: Nc1ccccc1B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)aniline, CAS:214360-73-3, Molecular Weight: 219.088, C12H18BNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1ccc(cc1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Methyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine, CAS:1171891-31-8, Molecular Weight: 219.088, C12H18BNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cnccc1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-methyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridin-2(1H)-one, CAS:1002309-52-5, Molecular Weight: 235.087, C12H18BNO3, Purity:95, SMILES: Cn1cc(ccc1=O)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine, CAS:408502-23-8, Molecular Weight: 235.087, C12H18BNO3, Purity:97, SMILES: COc1cc(ccn1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine, CAS:445264-61-9, Molecular Weight: 235.087, C12H18BNO3, Purity:95, SMILES: COc1ccc(cn1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Methoxypyridine-5-Boronic Acid Pinacol Ester, CAS:445264-60-8, Molecular Weight: 235.087, C12H18BNO3, Purity:95, SMILES: COC1=CC(=CN=C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Methoxypyridine-5-boronic acid pinacol ester, CAS:445264-60-8, Molecular Weight: 235.087, C12H18BNO3, Purity:95, SMILES: COc1cncc(c1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Methoxy-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine, CAS:758699-74-0, Molecular Weight: 235.087, C12H18BNO3, Purity:97, SMILES: COc1ccncc1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenesulfonamide-3-Boronic Acid Pinacol Ester, CAS:486422-08-6, Molecular Weight: 283.152, C12H18BNO4S, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=CC(=C1)S(N)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,5-Dibromo-3-octylthiophene, CAS:149703-84-4, Molecular Weight: 354.144, C12H18Br2S, Purity:95, SMILES: CCCCCCCCC1=C(Br)SC(Br)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3-((5-bromo-2-chloro-4-pyrimidinyl)amino)propyl)-carbamic acid tert-butyl ester, CAS:1046784-89-7, Molecular Weight: 365.654, C12H18BrClN4O2, Purity:95, SMILES: CC(C)(C)OC(=O)NCCCNc1nc(Cl)ncc1Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-Bromo-8,9-Dihydro-5H-Imidazo[1,2-D][1,4]Diazepine-7(6H-Carboxylate, CAS:1330765-01-9, Molecular Weight: 316.194, C12H18BrN3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2C(Br)=CN=C2CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-benzylpiperidine hydrochloride, CAS:192872-58-5, Molecular Weight: 211.731, C12H18ClN, Purity:95, SMILES: Cl.C(C1CCCCN1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-CHLORO-7-((2-(TRIMETHYLSILYL)ETHOXY)METHYL)-7H-PYRROLO[2,3-D]PYRIMIDINE, CAS:941685-26-3, Molecular Weight: 283.829, C12H18ClN3OSi, Purity:95, SMILES: C[Si](C)(C)CCOCn1ccc2c(Cl)ncnc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-chloro-3-((2-(trimethylsilyl)ethoxy)methyl)-3H-imidazo[4,5-b]pyridine, CAS:2098583-31-2, Molecular Weight: 283.829, C12H18ClN3OSi, Purity:95, SMILES: ClC1=C2C(N(C=N2)COCC[Si](C)(C)C)=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cyclopropanamine, N-[2-(3-methoxyphenoxy)ethyl]-, hydrochloride (1:1), CAS:1781746-08-4, Molecular Weight: 243.73, C12H18ClNO2, Purity:95, SMILES: Cl.COc1cccc(OCCNC2CC2)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl (S)-2-amino-4-phenylbutanoate hydrochloride, CAS:90891-21-7, Molecular Weight: 243.73, C12H18ClNO2, Purity:97, SMILES: CCOC(=O)[C@H](CCc1ccccc1)N.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HOKU-81, CAS:58020-43-2, Molecular Weight: 243.7298, C12H18ClNO2, Purity:98, SMILES: ClC1=C(C(O)CNC(C)(C)C)C=CC(O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| H-Val-Obzl.HCl, CAS:2462-34-2, Molecular Weight: 243.73, C12H18ClNO2, Purity:97, SMILES: Cl.[H][C@](N)(C(C)C)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tiletamine (hydrochloride), CAS:14176-50-2, Molecular Weight: 259.7954, C12H18ClNOS, Purity:98, SMILES: O=C1C(C2=CC=CS2)(NCC)CCCC1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-(2,2,2-trifluoroacetyl)piperidine-1-carboxylate, CAS:884512-51-0, Molecular Weight: 281.2714, C12H18F3NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCCC(C1)C(=O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-(2,2,2-Trifluoroacetyl)piperidine-1-carboxylate, CAS:884512-51-0, Molecular Weight: 281.2714, C12H18F3NO3, Purity:95, SMILES: O=C(N1CCCC(C1)C(=O)C(F)(F)F)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(2,2,2-trifluoroacetyl)piperidine-1-carboxylate, CAS:1093759-80-8, Molecular Weight: 281.2714, C12H18F3NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C(=O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(2,2,2-Trifluoroacetyl)piperidine-1-carboxylate, CAS:1093759-80-8, Molecular Weight: 281.2714, C12H18F3NO3, Purity:95, SMILES: O=C(N1CCC(CC1)C(=O)C(F)(F)F)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-methyl-1-(oxetan-3-yl)piperazine bis(2,2,2-trifluoroacetate), CAS:1776946-72-5, Molecular Weight: 384.2721, C12H18F6N2O5, Purity:95, SMILES: OC(=O)C(F)(F)F.OC(=O)C(F)(F)F.CC1CNCCN1C1COC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1S,3S,4R,6S-2-(Tert-Butoxycarbonyl-6-Fluoro-2-Azabicyclo[2.2.1]Heptane-3-Carboxylic Acid, CAS:1272757-81-9, Molecular Weight: 259.274, C12H18FNO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1C2CC(C[C@@H]2F)[C@H]1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1S,3S,4S,5S-2-(Tert-Butoxycarbonyl-5-Fluoro-2-Azabicyclo[2.2.1]Heptane-3-Carboxylic Acid, CAS:1272757-92-2, Molecular Weight: 259.274, C12H18FNO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1C2C[C@H](F)C(C2)[C@H]1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (6S)-5-AZASPIRO[2.4]HEPTANE-5,6-DICARBOXYLIC ACID 5-(1,1-DIMETHYLETHYL) ESTER POTASSIUM SALT, CAS:1441673-92-2, Molecular Weight: 279.3739, C12H18KNO4, Purity:95, SMILES: [K+].CC(C)(C)OC(=O)N1CC2(CC2)C[C@H]1C([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3-(pyrrolidin-1-ylmethyl)phenyl)methanamine, CAS:91271-78-2, Molecular Weight: 190.2847, C12H18N2, Purity:90, SMILES: NCc1cccc(CN2CCCC2)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3S)-(+)-1-Benzyl-3-(methylamino)pyrrolidine, CAS:169749-99-9, Molecular Weight: 190.2847, C12H18N2, Purity:95, SMILES: CN[C@H]1CCN(C1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-1-Benzylpiperidin-3-amine, CAS:168466-84-0, Molecular Weight: 190.2847, C12H18N2, Purity:97, SMILES: N[C@@H]1CCCN(C1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzylpiperidin-4-amine, CAS:50541-93-0, Molecular Weight: 190.2847, C12H18N2, Purity:95, SMILES: NC1CCN(Cc2ccccc2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Propyl-1,2,3,4-tetrahydroquinolin-7-amine, CAS:1049677-37-3, Molecular Weight: 190.2847, C12H18N2, Purity:95, SMILES: NC1=CC2=C(C=C1)CCCN2CCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-METHYL-1-(3-METHYLPHENYL)PIPERAZINE, CAS:35947-10-5, Molecular Weight: 190.2847, C12H18N2, Purity:95, SMILES: CC1=CC(N2C(C)CNCC2)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(1-Methyl-Piperidin-4-Yl-Aniline, CAS:454482-12-3, Molecular Weight: 190.2847, C12H18N2, Purity:95, SMILES: CN1CCC(CC1)C1=CC=C(N)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-benzyl-1,4-oxazinan-2-yl)methylamine, CAS:110859-47-7, Molecular Weight: 206.2841, C12H18N2O, Purity:95, SMILES: NCC1OCCN(C1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(3-methoxybenzyl)piperazine, CAS:55212-32-3, Molecular Weight: 206.2841, C12H18N2O, Purity:95, SMILES: COc1cccc(c1)CN1CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-Boc-3-Piperidinylidene)acetonitrile, CAS:1159982-27-0, Molecular Weight: 222.2835, C12H18N2O2, Purity:95, SMILES: N#C/C=C/1\CCCN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6,6-Dimethyl-4,5,6,7-tetrahydro-2H-indazole-3-carboxylic acid ethyl ester, CAS:1233243-56-5, Molecular Weight: 222.2835, C12H18N2O2, Purity:95, SMILES: CCOC(=O)c1[nH]nc2CC(C)(C)CCc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl (3-(cyanomethyl)bicyclo[1.1.1]pentan-1-yl)carbamate, CAS:2096992-22-0, Molecular Weight: 222.2835, C12H18N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)NC12CC(CC#N)(C1)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-(CyanomethylenePiperidine-1-Carboxylate, CAS:197569-11-2, Molecular Weight: 222.2835, C12H18N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)=CC#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-aminobenzylcarbamate, CAS:94838-55-8, Molecular Weight: 222.2835, C12H18N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)NCc1ccc(N)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl N-[4-(aminomethyl)phenyl]carbamate, CAS:220298-96-4, Molecular Weight: 222.2835, C12H18N2O2, Purity:97, SMILES: NCc1ccc(cc1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (6-Ethylsulfanyl-Pyridin-3-Yl-Carbamic Acid Tert-Butyl Ester, CAS:1198785-11-3, Molecular Weight: 254.349, C12H18N2O2S, Purity:95, SMILES: CCSC1=NC=C(NC(=O)OC(C)(C)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thiamylal, CAS:77-27-0, Molecular Weight: 254.3485, C12H18N2O2S, Purity:98, SMILES: O=C(C(CC=C)(C(C)CCC)C(N1)=O)NC1=S, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(2,2-DiethoxyethylIsonicotinamide, CAS:91908-44-0, Molecular Weight: 238.2829, C12H18N2O3, Purity:95, SMILES: CCOC(CNC(=O)C1=CC=NC=C1)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl (3-(2-hydroxyethylpyridin-4-ylcarbamate, CAS:219834-80-7, Molecular Weight: 238.2829, C12H18N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N=C1C=CNC=C1CCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-Cyano-2,2-Dimethyl-3-Oxopyrrolidine-1-Carboxylate, CAS:946497-94-5, Molecular Weight: 238.2829, C12H18N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC(C#N)C(=O)C1(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 7-Cyano-5-Oxa-2-Azaspiro[3.4]Octane-2-Carboxylate, CAS:1330763-36-4, Molecular Weight: 238.2829, C12H18N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CC(CO2)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tolbutamide, CAS:64-77-7, Molecular Weight: 270.3479, C12H18N2O3S, Purity:98, SMILES: O=S(C1=CC=C(C)C=C1)(NC(NCCCC)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-butyl 2-methyl 5-cyanopyrrolidine-1,2-dicarboxylate, CAS:1822575-16-5, Molecular Weight: 254.2823, C12H18N2O4, Purity:95, SMILES: COC(=O)C1CCC(C#N)N1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,5-Diazaspiro[3.5]nonane-2-carboxylic acid, 6,8-dioxo-, 1,1-dimethylethyl ester, CAS:1105662-95-0, Molecular Weight: 254.2823, C12H18N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CC(=O)CC(=O)N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Propyl-1H-imidazole-4,5-dicarboxy acid diethyl ester, CAS:144689-94-1, Molecular Weight: 254.2823, C12H18N2O4, Purity:95, SMILES: CCOC(=O)n1c(CCC)ncc1C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl 2-propylImidazoledicarbonate, CAS:144689-94-1, Molecular Weight: 254.2823, C12H18N2O4, Purity:95, SMILES: CCCC1=NC=C(N1C(=O)OCC)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Midodrine, CAS:42794-76-3, Molecular Weight: 254.2823, C12H18N2O4, Purity:98, SMILES: O=C(NCC(C1=CC(OC)=CC=C1OC)O)CN, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 5-((tert-butoxycarbonyl)amino)-2-methylthiazole-4-carboxylate, CAS:899898-44-3, Molecular Weight: 286.347, C12H18N2O4S, Purity:98, SMILES: CCOC(=O)c1nc(C)sc1NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Tert-Butoxycarbonyl-7-Oxo-2,6-Diazaspiro[3.4]Octane-5-Carboxylic Acid, CAS:1357351-94-0, Molecular Weight: 270.2817, C12H18N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CC(=O)NC2C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-(Tert-Butoxycarbonyl-1-Oxa-2,7-Diazaspiro[4.4]Non-2-Ene-3-Carboxylic Acid, CAS:1160247-02-8, Molecular Weight: 270.2817, C12H18N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)CC(=NO2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(Tert-Butoxycarbonyl-1-Methyl-4,5,6,7-Tetrahydro-1H-[1,2,3]Triazolo[4,5-C]Pyridine-7-Carboxylic Acid, CAS:1391733-57-5, Molecular Weight: 282.2957, C12H18N4O4, Purity:95, SMILES: CN1N=NC2=C1C(CN(C2)C(=O)OC(C)(C)C)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Puromycin aminonucleoside, CAS:58-60-6, Molecular Weight: 294.3097, C12H18N6O3, Purity:98, SMILES: OC[C@@H]1[C@@H](N)[C@H]([C@H](N2C=NC3=C2N=CN=C3N(C)C)O1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TOPS, CAS:40567-80-4, Molecular Weight: 279.331, C12H18NNaO3S, Purity:98, SMILES: O=S(CCCN(CC)C1=CC=CC(C)=C1)([O-])=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| ADPS, CAS:82611-88-9, Molecular Weight: 295.3304, C12H18NNaO4S, Purity:98, SMILES: O=S(CCCN(CC)C1=CC=CC(OC)=C1)([O-])=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| TOOS, CAS:82692-93-1, Molecular Weight: 295.3304, C12H18NNaO4S, Purity:98, SMILES: O=S(CC(O)CN(CC)C1=CC=CC(C)=C1)([O-])=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| ADOS, CAS:82692-96-4, Molecular Weight: 311.3298, C12H18NNaO5S, Purity:98, SMILES: O=S(CC(O)CN(CC)C1=CC=CC(OC)=C1)([O-])=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,6-Diisopropylphenol, CAS:2078-54-8, Molecular Weight: 178.2707, C12H18O, Purity:98, SMILES: CC(C)c1cccc(C(C)C)c1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-adamantyl)acetic acid, CAS:4942-47-6, Molecular Weight: 194.2701, C12H18O2, Purity:95, SMILES: OC(=O)CC12CC3CC(C2)CC(C1)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Methyl-3-Phenylpentane-1,5-Diol, CAS:84100-46-9, Molecular Weight: 194.2701, C12H18O2, Purity:95, SMILES: CC(CCO)(CCO)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hexylresorcinol, CAS:136-77-6, Molecular Weight: 194.2701, C12H18O2, Purity:98, SMILES: OC1=CC=C(CCCCCC)C(O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 4-hydroxyadamantan-1-carboxylate, CAS:81968-76-5, Molecular Weight: 210.2695, C12H18O3, Purity:95, SMILES: COC(=O)C12CC3CC(C2)C(C(C1)C3)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(3,4,5-TrimethoxyphenylPropan-1-Ol, CAS:29652-81-1, Molecular Weight: 226.2689, C12H18O4, Purity:95, SMILES: CCC(O)C1=CC(OC)=C(OC)C(OC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dimethyl Bicyclo[2.2.2]Octane-1,4-Dicarboxylate, CAS:1459-96-7, Molecular Weight: 226.2689, C12H18O4, Purity:95, SMILES: COC(=O)C12CCC(CC1)(CC2)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| dimethyl bicyclo[2.2.2]octane-1,4-dicarboxylate, CAS:1459-96-7, Molecular Weight: 226.2689, C12H18O4, Purity:95, SMILES: COC(=O)C12CCC(CC1)(CC2)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 2-{1,4-dioxaspiro[4.5]decan-8-ylidene}acetate, CAS:51656-91-8, Molecular Weight: 226.2689, C12H18O4, Purity:90, SMILES: CCOC(=O)C=C1CCC2(CC1)OCCO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 2-((1aR,1bR,4aR,5aR-3,3-dimethyltetrahydro-1aH-oxireno[2',3':3,4]cyclopenta[1,2-d][1,3]dioxol-1a-ylacetate, CAS:0, Molecular Weight: 242.2683, C12H18O5, Purity:95, SMILES: CCOC(=O)C[C@@]12O[C@@H]1C[C@H]1OC(C)(C)O[C@@H]21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Acetyl-4-(EthoxycarbonylHeptanedioic Acid, CAS:72653-14-6, Molecular Weight: 274.2671, C12H18O7, Purity:95, SMILES: CCOC(=O)C(CCC(O)=O)(CCC(O)=O)C(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Cyclopropyl-4-(4,4,5,5-tetraMethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole, CAS:1151802-22-0, Molecular Weight: 234.102, C12H19BN2O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CN(N=C1)C1CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-cyclopropyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole, CAS:1151802-22-0, Molecular Weight: 234.102, C12H19BN2O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cnn(c1)C1CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methyl-5-(Tetramethyl-1,3,2-Dioxaborolan-2-YlPyridin-3-Amine, CAS:1257554-08-7, Molecular Weight: 234.102, C12H19BN2O2, Purity:95, SMILES: CC1=C(N)C=C(C=N1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridin-3-amine, CAS:893440-50-1, Molecular Weight: 250.102, C12H19BN2O3, Purity:95, SMILES: COc1ncc(cc1N)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4,4,5,5-TETRAMETHYL-1,3,2-DIOXABOROLAN-2-YL)PHENOL, CAS:214360-76-6, Molecular Weight: 238.088, C12H19BO4, Purity:95, SMILES: CC(C)(O)C(C)(C)OB(O)C1=CC(O)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-bromoethyl)adamantane, CAS:773-37-5, Molecular Weight: 243.183, C12H19Br, Purity:95, SMILES: BrCCC12CC3CC(C2)CC(C1)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-(2,2-DibromovinylPiperidine-1-Carboxylate, CAS:203664-61-3, Molecular Weight: 369.093, C12H19Br2NO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C=C(Br)Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Neostigmine (Bromide), CAS:114-80-7, Molecular Weight: 303.1955, C12H19BrN2O2, Purity:98, SMILES: C[N+](C)(C)C1=CC=CC(OC(N(C)C)=O)=C1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Bromo-1-Oxa-2,8-Diaza-Spiro[4.5]Dec-2-Ene-8-Carboxylic Acid Tert-Butyl Ester, CAS:1250999-79-1, Molecular Weight: 319.195, C12H19BrN2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(Br)=NO2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-(4-BROMOBUTYL)PIPERAZIN-1-YL)PYRIMIDINE, CAS:87789-48-8, Molecular Weight: 299.21, C12H19BrN4, Purity:95, SMILES: BrCCCCN1CCN(CC1)c1ncccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3-BROMOPHENOXY(TERT-BUTYLDIMETHYLSILANE, CAS:65423-56-5, Molecular Weight: 287.268, C12H19BrOSi, Purity:95, SMILES: CC(C)(C)[Si](C)(C)OC1=CC=CC(Br)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mefenorex (hydrochloride), CAS:5586-87-8, Molecular Weight: 248.19196, C12H19Cl2N, Purity:98, SMILES: CC(NCCCCl)CC1=CC=CC=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clenbuterol (hydrochloride), CAS:21898-19-1, Molecular Weight: 313.6511, C12H19Cl3N2O, Purity:98, SMILES: OC(CNC(C)(C)C)C1=CC(Cl)=C(N)C(Cl)=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(2-fluorophenoxy)-N-(2-methoxyethyl)propan-1-amine hydrochloride, CAS:2070015-40-4, Molecular Weight: 263.736, C12H19ClFNO2, Purity:95, SMILES: COCCNCCCOC1=CC=CC=C1F.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Midodrine (hydrochloride), CAS:43218-56-0, Molecular Weight: 290.7433, C12H19ClN2O4, Purity:98, SMILES: O=C(NCC(C1=CC(OC)=CC=C1OC)O)CN.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Tert-Butyl 1-Methyl 2-(2-ChloroallylSuccinate, CAS:192516-46-4, Molecular Weight: 262.73, C12H19ClO4, Purity:95, SMILES: COC(=O)C(CC(Cl)=C)CC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3,3-Difluoro-4-formyl-4-methylpiperidine-1-carboxylate, CAS:1400764-63-7, Molecular Weight: 263.281, C12H19F2NO3, Purity:95, SMILES: O=CC1C(C)CN(CC1(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-butyl 2-Methyl 5,5-difluoropiperidine-1,2-dicarboxylate, CAS:, Molecular Weight: 279.2804, C12H19F2NO4, Purity:95, SMILES: COC(=O)C1CCC(CN1C(=O)OC(C)(C)C)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-butyl 3-Methyl 4,4-difluoropiperidine-1,3-dicarboxylate, CAS:1303974-67-5, Molecular Weight: 279.2804, C12H19F2NO4, Purity:95, SMILES: COC(=O)C1CN(CCC1(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-butyl 3-methyl 5,5-difluoropiperidine-1,3-dicarboxylate, CAS:1255667-06-1, Molecular Weight: 279.2804, C12H19F2NO4, Purity:95, SMILES: COC(=O)C1CN(CC(C1)(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-(Boc)-3,3-difluoropiperidin-4-yl)acetic acid, CAS:1373503-54-8, Molecular Weight: 279.2804, C12H19F2NO4, Purity:95, SMILES: OC(=O)CC1CCN(CC1(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-(BOC)Piperidin-4-yl)-2,2-difluoroacetic acid, CAS:1258638-62-8, Molecular Weight: 279.2804, C12H19F2NO4, Purity:95, SMILES: O=C(N1CCC(CC1)C(C(=O)O)(F)F)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-(tert-butoxycarbonyl)-3,3-difluoropiperidin-4-yl)acetic acid, CAS:1373503-54-8, Molecular Weight: 279.2804, C12H19F2NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC(O)=O)C(F)(F)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-(tert-Butoxycarbonyl)-4,4-difluoropiperidin-3-yl)acetic acid, CAS:, Molecular Weight: 279.2804, C12H19F2NO4, Purity:95, SMILES: OC(=O)CC1CN(CCC1(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-Acetoxy-4,4-difluoropiperidine-1-carboxylate, CAS:, Molecular Weight: 279.2804, C12H19F2NO4, Purity:95, SMILES: CC(=O)OC1CN(CCC1(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-butyl 3-methyl 5,5-difluoro-4-hydroxypiperidine-1,3-dicarboxylate, CAS:, Molecular Weight: 295.2798, C12H19F2NO5, Purity:95, SMILES: COC(=O)C1CN(CC(C1O)(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(2,2,2-trifluoro-1-(hydroxyimino)ethyl)piperidine-1-carboxylate, CAS:1313739-03-5, Molecular Weight: 296.2861, C12H19F3N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C(\C(F)(F)F)=N/O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(2,2,2-Trifluoro-1-(hydroxyimino)ethyl)piperidine-1-carboxylate, CAS:1313739-03-5, Molecular Weight: 296.2861, C12H19F3N2O3, Purity:95, SMILES: O/N=C(/C(F)(F)F)\C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,6-Diisopropylaniline, CAS:24544-04-5, Molecular Weight: 177.286, C12H19N, Purity:95, SMILES: CC(C)c1cccc(C(C)C)c1N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Ethylpiperazin-1-YlAniline, CAS:115619-01-7, Molecular Weight: 205.2994, C12H19N3, Purity:95, SMILES: CCN1CCN(CC1)C1=CC=C(N)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-ethylpiperazino)aniline, CAS:115619-01-7, Molecular Weight: 205.2994, C12H19N3, Purity:97, SMILES: CCN1CCN(CC1)c1ccc(cc1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Methylpiperazin-1-ylmethyl)phenylamine, CAS:70261-82-4, Molecular Weight: 205.2994, C12H19N3, Purity:95, SMILES: CN1CCN(Cc2ccc(N)cc2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methoxy-4-(4-methylpiperazin-1-yl)aniline, CAS:122833-04-9, Molecular Weight: 221.2988, C12H19N3O, Purity:95, SMILES: COc1cc(ccc1N)N1CCN(CC1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 6-methyl-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate, CAS:, Molecular Weight: 237.2982, C12H19N3O2, Purity:95, SMILES: CC1Cn2cncc2CN1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 8,9-Dihydro-5H-Imidazo[1,2-D][1,4]Diazepine-7(6H-Carboxylate, CAS:1330764-98-1, Molecular Weight: 237.2982, C12H19N3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2C=CN=C2CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl (2-Amino-4,5,6,7-Tetrahydrobenzo[D]Thiazol-6-YlCarbamate, CAS:820231-27-4, Molecular Weight: 269.363, C12H19N3O2S, Purity:95, SMILES: CC(C)(C)OC(=O)NC1CCC2=C(C1)SC(N)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Hydroxymethyl-1,4,6,7-Tetrahydro-Imidazo[4,5-C]Pyridine-5-Carboxylic Acid Tert-Butyl Ester, CAS:1251000-69-7, Molecular Weight: 253.2976, C12H19N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=C(C1)NC(CO)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Hydroxymethyl-1,4,6,7-Tetrahydro-Pyrazolo[4,3-C]Pyridine-5-Carboxylic Acid Tert-Butyl Ester, CAS:1250998-91-4, Molecular Weight: 253.2976, C12H19N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=C(C1)C(CO)=NN2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Hydroxymethyl-1,4,6,7-Tetrahydro-Imidazo[4,5-C]Pyridine-5-Carboxylic Acid Tert-Butyl Ester, CAS:1250997-79-5, Molecular Weight: 253.2976, C12H19N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=C(NC=N2)C1CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl ((2,4,5,7-Tetrahydropyrano[3,4-C]Pyrazol-7-YlMethylCarbamate, CAS:1445951-11-0, Molecular Weight: 253.2976, C12H19N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)NCC1OCCC2=CNN=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 2-(hydroxymethyl)-6,7-dihydropyrazolo[1,5-a]pyrazine-5(4H)-carboxylate, CAS:1251002-29-5, Molecular Weight: 253.2976, C12H19N3O3, Purity:98, SMILES: CC(C)(C)OC(=O)N1CCn2nc(CO)cc2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-(Hydroxymethyl-5,6-Dihydroimidazo[1,2-A]Pyrazine-7(8H-Carboxylate, CAS:1314391-41-7, Molecular Weight: 253.2976, C12H19N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2C(CO)=CN=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-Hydroxy-4,5,6,8-Tetrahydropyrazolo[3,4-C]Azepine-7(1H-Carboxylate, CAS:1445951-64-3, Molecular Weight: 253.2976, C12H19N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCCC2=C(C1)NN=C2O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 7-(Hydroxymethyl-6,7-Dihydropyrazolo[1,5-A]Pyrazine-5(4H-Carboxylate, CAS:1823856-64-9, Molecular Weight: 253.2976, C12H19N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC(CO)N2N=CC=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(5-ethylpyrimidin-2-ylpiperidin-4-yl methanesulfonate, CAS:1046817-01-9, Molecular Weight: 285.363, C12H19N3O3S, Purity:95, SMILES: CCC1=CN=C(N=C1)N1CCC(CC1)OS(C)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 4-((Tert-ButoxycarbonylAmino-1-Methyl-1H-Imidazole-2-Carboxylate, CAS:128293-63-0, Molecular Weight: 269.297, C12H19N3O4, Purity:95, SMILES: CCOC(=O)C1=NC(NC(=O)OC(C)(C)C)=CN1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2,4-Dioxo-1,3,8-Triazaspiro[4.5]Decane-8-Carboxylate, CAS:183673-70-3, Molecular Weight: 269.297, C12H19N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)NC(=O)NC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (5R,6S)-3-((2-Formimidamidoethyl)thio)-6-((R)-1-hydroxyethyl)-7-oxo-1-azabicyclo[3.2.]hept-2-ene-2-carboxylic acid hydrate, CAS:74431-23-5, Molecular Weight: 317.361, C12H19N3O5S, Purity:97, SMILES: O.[H][C@]12CC(SCCNC=N)=C(N1C(=O)[C@@H]2[C@@H](C)O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Piperazin-1-yl)-2-(pyrrolidin-1-yl)pyrimidine, CAS:1503527-77-2, Molecular Weight: 233.3128, C12H19N5, Purity:95, SMILES: C1CCN(C1)C1=NC=CC(=N1)N1CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Norepinephrine (bitartrate monohydrate), CAS:108341-18-0, Molecular Weight: 337.28, C12H19NO10, Purity:98, SMILES: OC1=CC=C([C@@H](O)CN)C=C1O.O=C(O)[C@H](O)[C@@H](O)C(O)=O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Boc-3-Ethynylpiperidine, CAS:664362-16-7, Molecular Weight: 209.2848, C12H19NO2, Purity:97, SMILES: C#CC1CCCN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Boc-4-Ethynylpiperidine, CAS:287192-97-6, Molecular Weight: 209.2848, C12H19NO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C#C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mirogabalin, CAS:1138245-13-2, Molecular Weight: 209.2848, C12H19NO2, Purity:98, SMILES: O=C(O)C[C@]1(CN)[C@]2([H])C=C(CC)C[C@]2([H])C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-ethynylpiperidine-1-carboxylate, CAS:287192-97-6, Molecular Weight: 209.2848, C12H19NO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C#C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Heparan Sulfate, CAS:9050-30-0, Molecular Weight: 1000, C12H19NO20S3 (monomer), Purity:98, SMILES: O=S(OCC1O[C@@H](OC)[C@@H](NS(=O)([O-])=O)[C@@H](OS(=O)([O-])=O)[C@H]1O[C@@H]2OC(C([O-])=O)[C@H](O[C@@H]3OC(COS(=O)([O-])=O)[C@H](O[C@@H]4OC(C([O-])=O)[C@H](OC)[C@H](O)[C@@H]4OS(=O)([O-])=O)[C@H](O)[C@@H]3NS(=O)([O-])=O)[C@H](O)[C@@H]2O)([O-])=O.[n], HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3R,7aR)-3-(tert-butyl)-1-hydroxy-7a-vinyltetrahydropyrrolo[1,2-c]oxazol-5(3H)-one, CAS:1214741-21-5, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: CC(C)(C)[C@H]1OC(O)[C@@]2(CCC(=O)N12)C=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-OXO-6-AZA-SPIRO[3.4]OCTANE-6-CARBOXYLIC ACID TERT-BUTYL ESTER, CAS:203661-71-6, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(=O)C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Oxo-3-Aza-Bicyclo[3.2.1]Octane-3-Carboxylic Acid Tert-Butyl Ester, CAS:637301-19-0, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CCC(C1)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-5-Oxo-Hexahydro-Cyclopenta[C]Pyrrole-2-Carboxylic Acid Tert-Butyl Ester, CAS:146231-54-1, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2CC(=O)C[C@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Tert-Butyl 4-Oxohexahydrocyclopenta[C]Pyrrole-2(1H-Carboxylate, CAS:130658-14-9, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2CCC(=O)[C@@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Boc-nortropinone, CAS:185099-67-6, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: O=C1C[C@@H]2CC[C@H](C1)N2C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1S,4S-tert-butyl 1-vinyl-2-oxa-5-azabicyclo[2.2.1]heptane-5-carboxylate, CAS:0, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(CC1CO2)C=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2-Oxo-6-Azaspiro[3.4]Octane-6-Carboxylate, CAS:203661-71-6, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(=O)C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-Oxo-6-Azabicyclo[3.2.1]Octane-6-Carboxylate, CAS:359779-74-1, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CC1CC(=O)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-Oxo-8-Azabicyclo[3.2.1]Octane-8-Carboxylate, CAS:185099-67-6, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1[C@H]2CC[C@@H]1CC(=O)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-ethynyl-4-hydroxypiperidine-1-carboxylate, CAS:275387-83-2, Molecular Weight: 225.2842, C12H19NO3, Purity:95, SMILES: C#CC1(O)CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 5-oxohexahydrocyclopenta[c]pyrrole-2(1H)-carboxylate, CAS:148404-28-8, Molecular Weight: 225.2842, C12H19NO3, Purity:97, SMILES: CC(C)(C)OC(=O)N1CC2CC(=O)CC2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Terbutaline (sulfate), CAS:23031-32-5, Molecular Weight: 274.32, C12H19NO3 . 1/2H2O4S, Purity:98, SMILES: OC1=CC(C(O)CNC(C)(C)C)=CC(O)=C1.[0.5H2SO4], HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,2S)-1-tert-Butoxycarbonylamino-2-vinyl-cyclopropanecarboxylic acid methyl ester, CAS:159622-09-0, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: C=C[C@@H]1C[C@]1(NC(=O)OC(C)(C)C)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,3S,4S-2-(Tert-Butoxycarbonyl-2-Azabicyclo[2.2.1]Heptane-3-Carboxylic Acid, CAS:869682-22-4, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1[C@@H]2CC[C@@H](C2)[C@H]1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (6S-5-(Tert-Butoxycarbonyl-5-Azaspiro[2.4]Heptane-6-Carboxylic Acid, CAS:1129634-44-1, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(CC2)C[C@H]1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-butyl 2-methyl 1,2,3,6-tetrahydropyridine-1,2-dicarboxylate, CAS:164298-41-3, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: COC(=O)C1CC=CCN1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((Meso-1R,5S,6S-3-(Tert-Butoxycarbonyl-3-Azabicyclo[3.1.0]Hexan-6-YlAcetic Acid, CAS:1401464-08-1, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2[C@H](CC(O)=O)[C@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3-((tert-butoxycarbonyl)amino)bicyclo[1.1.1]pentan-1-yl)acetic acid, CAS:2096992-27-5, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)NC12CC(CC(O)=O)(C1)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Azabicyclo[2.2.1]heptane-2,3-dicarboxylic acid, 2-(1,1-dimethylethyl) ester, (1R,3S,4S)-, CAS:291775-59-2, Molecular Weight: 241.2836, C12H19NO4, Purity:99, SMILES: CC(C)(C)OC(=O)N1[C@@H]2CC[C@@H](C2)[C@H]1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Boc-2-aza-spiro[3.3]heptane-6-carboxylic acid, CAS:1211526-53-2, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(CC(C2)C(O)=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Aza-Bicyclo[3.2.0]Heptane-1,3-Dicarboxylic Acid 3-Tert-Butyl Ester, CAS:1250993-43-1, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CCC2(C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(Tert-Butoxycarbonyl-5-Azaspiro[2.4]Heptane-1-Carboxylic Acid, CAS:150543-61-6, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC2C(O)=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Azaspiro[2.4]heptane-5,6-dicarboxylic acid, 5-(1,1-dimethylethyl) ester, (6S)-, CAS:1129634-44-1, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(CC2)C[C@H]1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-(Tert-Butoxycarbonyl-7-Azabicyclo[2.2.1]Heptane-2-Endo-Carboxylic Acid, CAS:711082-67-6, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1[C@H]2CC[C@@H]1[C@@H](C2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-boc-3-oxa-7-azabicyclo[3.3.1]nonan-9-one, CAS:454695-20-6, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: O=C(N1CC2COCC(C1)C2=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-3-Aza-Bicyclo[4.1.0]Heptane-3,6-Dicarboxylic Acid 3-Tert-Butyl Ester, CAS:1251012-36-8, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC[C@@]2(C[C@@H]2C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Exo-7-(Tert-Butoxycarbonyl-7-Azabicyclo[2.2.1]Heptane-2-Exo-Carboxylic Acid, CAS:500556-91-2, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1[C@H]2CC[C@@H]1[C@H](C2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| exo-7-Boc-7-azabicyclo[2.2.1]heptan-2-yl carboxylic acid racemate, CAS:500556-91-2, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1[C@H]2CC[C@@H]1[C@H](C2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 3-([(Tert-ButoxyCarbonyl]AminoBicyclo[1.1.1]Pentane-1-Carboxylate, CAS:676371-64-5, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: COC(=O)C12CC(C1)(C2)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 3-{[(tert-butoxy)carbonyl]amino}bicyclo[1.1.1]pentane-1-carboxylate, CAS:676371-64-5, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: COC(=O)C12CC(C1)(C2)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(6S,9S-Ethyl 3-Oxo-1-Oxa-4-Azaspiro[5.5]Undecane-9-Carboxylate, CAS:1422344-43-1, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CCOC(=O)C1CCC2(CC1)CNC(=O)CO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 3-(2-ethoxy-2-oxoethylidene)azetidine-1-carboxylate, CAS:1002355-96-5, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CCOC(=O)C=C1CN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-(2-Ethoxy-2-OxoethylideneAzetidine-1-Carboxylate, CAS:1002355-96-5, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CCOC(=O)C=C1CN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-Oxo-1-Oxa-7-Azaspiro[4.4]Nonane-7-Carboxylate, CAS:1823269-85-7, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)OCCC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 7-Oxo-3-Oxa-9-Azabicyclo[3.3.1]Nonane-9-Carboxylate, CAS:280761-97-9, Molecular Weight: 241.2836, C12H19NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1C2COCC1CC(=O)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-1-(3-Ethoxy-4-methoxyphenyl)-2-(methylsulfonyl)ethanamine, CAS:608141-42-0, Molecular Weight: 273.349, C12H19NO4S, Purity:95, SMILES: CCOC1=C(OC)C=CC(=C1)[C@H](N)CS(C)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-1-(3-Ethoxy-4-methoxyphenyl)-2-(methylsulfonyl)ethanamine, CAS:608141-42-0, Molecular Weight: 273.349, C12H19NO4S, Purity:95, SMILES: CCOc1cc(ccc1OC)[C@@H](CS(=O)(=O)C)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(3-Ethoxy-4-methoxy-phenyl)-2-methanesulfonyl-ethylamine, CAS:253168-94-4, Molecular Weight: 273.349, C12H19NO4S, Purity:95, SMILES: CCOc1cc(ccc1OC)C(CS(=O)(=O)C)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-Ethyl-N-Boc-pyroglutamate, CAS:144978-12-1, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CCOC(=O)[C@@H]1CCC(=O)N1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Boc-D-Pyroglutamic acid ethyl ester, CAS:144978-35-8, Molecular Weight: 257.283, C12H19NO5, Purity:97, SMILES: CCOC(=O)[C@H]1CCC(=O)N1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Tert-Butyl 2-Methyl 4-Oxopiperidine-1,2-Dicarboxylate, CAS:81357-18-8, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: COC(=O)C1CC(=O)CCN1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-TERT-BUTYL 2-METHYL 4-OXOPIPERIDINE-1,2-DICARBOXYLATE, CAS:81357-18-8, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: COC(=O)C1CC(=O)CCN1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-Butyl 3-ethyl 4-oxopyrrolidine-1,3-dicarboxylate, CAS:146256-98-6, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CCOC(=O)C1CN(CC1=O)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-TERT-BUTYL 3-METHYL 4-OXOPIPERIDINE-1,3-DICARBOXYLATE, CAS:161491-24-3, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: COC(=O)C1CN(CCC1=O)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-Butyl 3-methyl 4-oxopiperidine-1,3-dicarboxylate, CAS:161491-24-3, Molecular Weight: 257.283, C12H19NO5, Purity:97, SMILES: COC(=O)C1CN(CCC1=O)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-butyl 3-methyl 5-oxopiperidine-1,3-dicarboxylate, CAS:1303974-96-0, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: COC(=O)C1CC(=O)CN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Tert-Butoxycarbonyl-5-Oxa-2-Azaspiro[3.4]Octane-7-Carboxylic Acid, CAS:1251009-46-7, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CC(CO2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Oxa-2-Aza-Spiro[3.4]Octane-2,6-Dicarboxylic Acid 2-Tert-Butyl Ester, CAS:1251006-00-4, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CCC(O2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Dihydro-Furo[3,4-C]Pyrrole-3A,5-Dicarboxylic Acid 5-Tert-Butyl Ester, CAS:1251019-97-2, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2COC[C@]2(C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 1-Boc-2-Oxopyrrolidine-3-Carboxylate, CAS:188528-95-2, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CCOC(=O)C1CCN(C(=O)OC(C)(C)C)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl N-(tert-Butoxycarbonyl)-D-pyroglutamate, CAS:144978-35-8, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CCOC(=O)[C@H]1CCC(=O)N1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1R,4R-5-Tert-Butyl 7-Methyl 2-Oxa-5-Azabicyclo[2.2.1]Heptane-5,7-Dicarboxylate, CAS:0, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: COC(=O)C1C2CN(C1CO2)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1R,5S,6S-3-(Tert-Butoxycarbonyl-8-Oxa-3-Azabicyclo[3.2.1]Octane-6-Carboxylic Acid, CAS:1251010-77-1, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CC(C(C1)O2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1S,3S,4R,6S-2-(Tert-Butoxycarbonyl-6-Hydroxy-2-Azabicyclo[2.2.1]Heptane-3-Carboxylic Acid, CAS:1250884-25-3, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1C2CC(C[C@@H]2O)[C@H]1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(3R,3aS,6aS-5-(tert-butoxycarbonylhexahydro-2H-furo[2,3-c]pyrrole-3-carboxylic acid, CAS:1273566-11-2, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2OC[C@@H]([C@H]2C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(3S,3aS,6aS-5-(tert-butoxycarbonylhexahydro-2H-furo[2,3-c]pyrrole-3-carboxylic acid, CAS:1273566-32-7, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2OC[C@H]([C@H]2C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-acetoxy-4-oxopiperidine-1-carboxylate, CAS:, Molecular Weight: 257.283, C12H19NO5, Purity:95, SMILES: CC(=O)OC1CN(CCC1=O)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-2-(1-(tert-butoxycarbonyl)pyrrolidin-3-yl)malonic acid, CAS:1228312-13-7, Molecular Weight: 273.2824, C12H19NO6, Purity:98, SMILES: CC(C)(C)OC(=O)N1CC[C@H](C1)C(C(O)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1S,3S,4S,6R,7S-2-(Tert-Butoxycarbonyl-6,7-Dihydroxy-2-Azabicyclo[2.2.1]Heptane-3-Carboxylic Acid, CAS:1171024-33-1, Molecular Weight: 273.2824, C12H19NO6, Purity:95, SMILES: CC(C)(C)OC(=O)N1C2[C@H](O)CC(C2O)[C@H]1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methylpyridine-3-boronic acid pinacol ester, CAS:1012084-56-8, Molecular Weight: 237.103, C12H20BNO3, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cccnc1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methylpyridine-4-boronic acid pinacol ester, CAS:660867-80-1, Molecular Weight: 237.103, C12H20BNO3, Purity:95, SMILES: Cc1nccc(c1)B(OC(C(O)(C)C)(C)C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methylpyridine-5-boronic acid pinacol ester, CAS:610768-32-6, Molecular Weight: 237.103, C12H20BNO3, Purity:95, SMILES: Cc1ccc(cn1)B(OC(C(O)(C)C)(C)C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Aminophenylboronic Acid Pinacol Ester, CAS:210907-84-9, Molecular Weight: 237.103, C12H20BNO3, Purity:95, SMILES: Nc1cccc(c1)B(OC(C(O)(C)C)(C)C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 4-(2-bromoacetyl)piperidine-1-carboxylate, CAS:301221-79-4, Molecular Weight: 306.196, C12H20BrNO3, Purity:95, SMILES: BrCC(=O)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-Benzylmorpholin-2-YlMethanamine Dihydrochloride, CAS:110859-49-9, Molecular Weight: 279.206, C12H20Cl2N2O, Purity:95, SMILES: Cl.Cl.NCC1CN(CC2=CC=CC=C2)CCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Azetidin-3-Yl-4-(Pyridin-2-YlPiperazine Dihydrochloride, CAS:0, Molecular Weight: 291.22, C12H20Cl2N4, Purity:95, SMILES: Cl.Cl.C1NCC1N1CCN(CC1)C1=CC=CC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Procarbazine (Hydrochloride), CAS:366-70-1, Molecular Weight: 257.7597, C12H20ClN3O, Purity:98, SMILES: O=C(NC(C)C)C1=CC=C(CNNC)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Unable to generate chemical name, CAS:207857-15-6, Molecular Weight: 391.364, C12H20F3N3O6S, Purity:95, SMILES: CC(C)(C)OC(=O)NC(NC(=O)OC(C)(C)C)=NS(=O)(=O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-(2,2,2-Trifluoro-1-hydroxyethyl)piperidine-1-carboxylate, CAS:, Molecular Weight: 283.2873, C12H20F3NO3, Purity:95, SMILES: O=C(N1CCCC(C1)C(C(F)(F)F)O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(2,2,2-trifluoro-1-hydroxyethyl)piperidine-1-carboxylate, CAS:184042-83-9, Molecular Weight: 283.2873, C12H20F3NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C(O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(2,2,2-Trifluoro-1-hydroxyethyl)piperidine-1-carboxylate, CAS:184042-83-9, Molecular Weight: 283.2873, C12H20F3NO3, Purity:95, SMILES: O=C(N1CCC(CC1)C(C(F)(F)F)O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Boc-2-fluoro-8-aza-bicyclo[3.2.1]octan-3-ol, CAS:1404196-40-2, Molecular Weight: 245.2905, C12H20FNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C2CCC1C(F)C(O)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3,4)-Trans-1-tert-butyl 4-methyl 3-fluoropiperidine-1,4-dicarboxylate racemate, CAS:, Molecular Weight: 261.2899, C12H20FNO4, Purity:95, SMILES: COC(=O)[C@H]1CCN(C[C@@H]1F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-(Tertbutoxycarbonyl)-3-fluoropiperidin-4-yl)acetic acid, CAS:1373502-96-5, Molecular Weight: 261.2899, C12H20FNO4, Purity:95, SMILES: OC(=O)CC1CCN(CC1F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| cis-1-tert-Butyl 4-methyl 3-fluoropiperidine-1,4-dicarboxylate, CAS:895243-98-8, Molecular Weight: 261.2899, C12H20FNO4, Purity:95, SMILES: COC(=O)[C@H]1CCN(C[C@H]1F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-(2-Ethoxy-2-Oxoethyl-3-Fluoroazetidine-1-Carboxylate, CAS:1445951-08-5, Molecular Weight: 261.2899, C12H20FNO4, Purity:95, SMILES: CCOC(=O)CC1(F)CN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Boc-4-(Cyanomethyl)piperidine, CAS:256411-39-9, Molecular Weight: 224.2994, C12H20N2O2, Purity:95, SMILES: N#CCC1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-(cyanomethyl)piperidine-1-carboxylate, CAS:948015-72-3, Molecular Weight: 224.2994, C12H20N2O2, Purity:95, SMILES: N#CCC1CCCN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Boc-2,6-Diazaspiro[4.4]nonan-1-one, CAS:1221818-45-6, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: O=C(N1CCCC21CCNC2=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-6-Oxo-Octahydro-Pyrrolo[3,4-C]Pyridine-2-Carboxylicacidtert-Butylester, CAS:1251004-07-5, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2CNC(=O)C[C@@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Tert-Butyl4-Oxohexahydro-1H-Pyrrolo[3,4-C]Pyridine-2(3H-Carboxylate, CAS:1273568-51-6, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2CCNC(=O)[C@@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Tert-Butyl-5-Oxooctahydro-1H-Pyrrolo[3,2-B]Pyridine-1-Carboxylate, CAS:1251010-54-4, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC[C@H]2NC(=O)CC[C@@H]12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 1-Oxo-2,6-Diazaspiro[3.5]Nonane-6-Carboxylate, CAS:1160246-71-8, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCCC2(CNC2=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 1-Oxo-2,7-Diazaspiro[3.5]Nonane-7-Carboxylate, CAS:1032158-48-7, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CNC2=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2-Oxo-1,7-Diazaspiro[3.5]Nonane-7-Carboxylate, CAS:392331-78-1, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(=O)N2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2-Oxo-1,7-Diazaspiro[4.4]Nonane-7-Carboxylate, CAS:1160246-72-9, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CCC(=O)N2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 3-((diMethylaMino)Methylene)-4-oxopyrrolidine-1-carboxylate, CAS:157327-42-9, Molecular Weight: 240.2988, C12H20N2O3, Purity:99, SMILES: CN(C)C=C1CN(CC1=O)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-(2-Oxopyrrolidin-3-YlAzetidine-1-Carboxylate, CAS:1330765-33-7, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC(C1)C1CCNC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-Cyano-4-(HydroxymethylPiperidine-1-Carboxylate, CAS:614730-96-0, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CO)(CC1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 6-Oxo-1,7-Diazaspiro[4.4]Nonane-1-Carboxylate, CAS:1221818-45-6, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCCC11CCNC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 6-Oxo-2,7-Diazaspiro[4.4]Nonane-2-Carboxylate, CAS:1194376-44-7, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CCNC2=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 6-oxo-2,7-diazaspiro[4.4]nonane-2-carboxylate, CAS:1194376-44-7, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: O=C(N1CCC2(C1)CCNC2=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 7-Oxo-3,6-Diazabicyclo[3.2.2]Nonane-3-Carboxylate, CAS:1784807-21-1, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CCC(C1)C(=O)N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 8-Oxo-2,7-Diazaspiro[4.4]Nonane-2-Carboxylate, CAS:1251009-03-6, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CNC(=O)C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-Tert-Butyl-4-Oxohexahydro-1H-Pyrrolo[3,4-C]Pyridine-2(3H-Carboxylate, CAS:1251012-56-2, Molecular Weight: 240.2988, C12H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2CCNC(=O)[C@@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl (1-[methoxy(methyl)amino]-1-oxopent-4-yn-2-yl)carbamate, CAS:1172623-95-8, Molecular Weight: 256.2982, C12H20N2O4, Purity:96, SMILES: CON(C)C(=O)C(CC#C)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2-Oxo-1-Oxa-3,8-Diazaspiro[4.5]Decane-8-Carboxylate, CAS:169206-55-7, Molecular Weight: 256.2982, C12H20N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CNC(=O)O2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 7-Oxo-9-Oxa-2,6-Diazaspiro[4.5]Decane-2-Carboxylate, CAS:1251020-94-6, Molecular Weight: 256.2982, C12H20N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)COCC(=O)N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Boc-Gly-Pro-OH, CAS:14296-92-5, Molecular Weight: 272.2976, C12H20N2O5, Purity:98, SMILES: [H][C@]1(CCCN1C(=O)CNC(=O)OC(C)(C)C)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(3aS,7R,8aS-tert-butyl hexahydro-3a,7-epoxyisothiazolo[4,5-c]azepine-5(4H-carboxylate 1,1-dioxide, CAS:1250995-87-9, Molecular Weight: 304.363, C12H20N2O5S, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2C[C@H]3[C@@](CNS3(=O)=O)(C1)O2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Oxa-6-Azaspiro[3.3]Heptane Hemioxalate, CAS:1045709-32-7, Molecular Weight: 288.297, C12H20N2O6, Purity:95, SMILES: OC(=O)C(O)=O.C1NCC11COC1.C1NCC11COC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Oxa-6-azaspiro[3.3]heptane, ethanedioate (2:1), CAS:1045709-32-7, Molecular Weight: 288.297, C12H20N2O6, Purity:95, SMILES: OC(=O)C(O)=O.C1NCC11COC1.C1NCC11COC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2,6-Diazaspiro[3.3]Heptane-2-Carboxylate Oxalate, CAS:1227382-01-5, Molecular Weight: 288.297, C12H20N2O6, Purity:95, SMILES: OC(=O)C(O)=O.CC(C)(C)OC(=O)N1CC2(CNC2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2,6-diazaspiro[3.3]heptane-2-carboxylate oxalate, CAS:1227382-01-5, Molecular Weight: 288.297, C12H20N2O6, Purity:98, SMILES: OC(=O)C(O)=O.CC(C)(C)OC(=O)N1CC2(CNC2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-((4-Ethylpiperazin-1-yl)methyl)pyridin-2-amine, CAS:1180132-17-5, Molecular Weight: 220.314, C12H20N4, Purity:98, SMILES: CCN1CCN(CC1)Cc1ccc(nc1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,1'-(Azodicarbonyl)dipiperidine, CAS:10465-81-3, Molecular Weight: 252.3128, C12H20N4O2, Purity:98, SMILES: O=C(N1CCCCC1)/N=N/C(=O)N1CCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Amino-5-Boc-6,6-dimethyl-2,6-dihydro-4H-pyrrolo[3,4-c]pyrazole, CAS:718632-44-1, Molecular Weight: 252.3128, C12H20N4O2, Purity:97, SMILES: O=C(N1Cc2c(C1(C)C)n[nH]c2N)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrrolo[3,4-C]Pyrazole-5(4H-Carboxylic Acid, 3-Amino-2,6-Dihydro-6,6-Dimethyl-, 1,1-Dimethylethyl Ester, CAS:398491-61-7, Molecular Weight: 252.3128, C12H20N4O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2=C(NNC2=N)C1(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-Amino-6,6-Dimethylpyrrolo[3,4-C]Pyrazole-5(1H,4H,6H-Carboxylate, CAS:398491-61-7, Molecular Weight: 252.3128, C12H20N4O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2=C(NNC2=N)C1(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl (3-(Hydroxymethyl-4,5,6,7-Tetrahydro-[1,2,3]Triazolo[1,5-A]Pyridin-6-YlCarbamate, CAS:0, Molecular Weight: 268.3122, C12H20N4O3, Purity:95, SMILES: CC(C)(C)OC(=O)NC1CCC2=C(CO)N=NN2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-(Hydroxymethyl-8-Methyl-5,6-Dihydro-[1,2,4]Triazolo[4,3-A]Pyrazine-7(8H-Carboxylate, CAS:0, Molecular Weight: 268.3122, C12H20N4O3, Purity:95, SMILES: CC1N(CCN2C(CO)=NN=C12)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Relebactam, CAS:1174018-99-5, Molecular Weight: 348.3754, C12H20N4O6S, Purity:98, SMILES: O=S(ON1[C@]2([H])CC[C@@H](C(NC3CCNCC3)=O)[N@@](C2)C1=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Zanamivir, CAS:139110-80-8, Molecular Weight: 332.3098, C12H20N4O7, Purity:98, SMILES: NC(N[C@@H]1[C@H]([C@@]([H])(OC(C(O)=O)=C1)[C@@H]([C@@H](CO)O)O)NC(C)=O)=N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gly6, CAS:3887-13-6, Molecular Weight: 360.3232, C12H20N6O7, Purity:98, SMILES: O=C(O)CNC(CNC(CNC(CNC(CNC(CN)=O)=O)=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD-1-IN-1, CAS:1673534-76-3, Molecular Weight: 360.3232, C12H20N6O7, Purity:98, SMILES: C[C@@H](O)[C@@H](C(O)=O)NC(N[C@H](C1=NC([C@@H](N)CO)=NO1)CC(N)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,5-Dimethyl-1-adamantanol, CAS:707-37-9, Molecular Weight: 180.2866, C12H20O, Purity:95, SMILES: CC12CC3CC(C)(C1)CC(O)(C3)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [3-(hydroxymethyl)adamantan-1-yl]methanol, CAS:17071-62-4, Molecular Weight: 196.286, C12H20O2, Purity:95, SMILES: OCC12CC3CC(C1)CC(C2)(C3)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Methoxy-1-hydroxymethyladamantane, CAS:36964-32-6, Molecular Weight: 196.286, C12H20O2, Purity:95, SMILES: OCC12CC3CC(C1)CC(C2)(C3)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-Ethyl 3-(4-MethylcyclohexylAcrylate, CAS:324795-73-5, Molecular Weight: 196.286, C12H20O2, Purity:95, SMILES: CCOC(=O)\C=C\[C@H]1CC[C@H](C)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Di-tert-butyl maleate, CAS:18305-60-7, Molecular Weight: 228.2848, C12H20O4, Purity:95, SMILES: O=C(OC(C)(C)C)/C=C\C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 2-(1,4-dioxaspiro[4.5]decan-8-yl)acetate, CAS:62141-26-8, Molecular Weight: 228.2848, C12H20O4, Purity:90, SMILES: CCOC(=O)CC1CCC2(CC1)OCCO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(2-ethylhexyl)thiophene, CAS:121134-38-1, Molecular Weight: 196.352, C12H20S, Purity:95, SMILES: CCCCC(Cc1cscc1)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-n-Octylthiophene, CAS:65016-62-8, Molecular Weight: 196.352, C12H20S, Purity:95, SMILES: CCCCCCCCc1ccsc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Octylthiophene, CAS:65016-62-8, Molecular Weight: 196.352, C12H20S, Purity:95, SMILES: CCCCCCCCC1=CSC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tin(IV) hexamethanide thieno[3,2-b]thiophene-2,5-diide, CAS:469912-82-1, Molecular Weight: 465.837, C12H20S2Sn2, Purity:95, SMILES: [CH3-].[CH3-].[CH3-].[CH3-].[CH3-].[CH3-].[Sn+4].[Sn+4].c1[c-]sc2c[c-]sc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,3,5-Trimethyl-1H-pyrazole-4-boronic acid pinacol ester, CAS:844891-04-9, Molecular Weight: 236.118, C12H21BN2O2, Purity:95, SMILES: Cc1nn(c(c1B1OC(C(O1)(C)C)(C)C)C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-ISOPROPYL-1H-PYRAZOLE-4-BORONIC ACID PINACOL ESTER, CAS:879487-10-2, Molecular Weight: 236.118, C12H21BN2O2, Purity:95, SMILES: CC(C)N1C=C(C=N1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Isopropyl-1H-pyrazole-5-boronic acid, pinacol ester, CAS:1282518-60-8, Molecular Weight: 236.118, C12H21BN2O2, Purity:97, SMILES: CC(n1nccc1B1OC(C(O1)(C)C)(C)C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Isopropyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole, CAS:1071496-88-2, Molecular Weight: 236.118, C12H21BN2O2, Purity:95, SMILES: CC(C)n1ccc(n1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Isopropyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole, CAS:879487-10-2, Molecular Weight: 236.118, C12H21BN2O2, Purity:98, SMILES: CC(C)n1cc(cn1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Propyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole, CAS:827614-69-7, Molecular Weight: 236.118, C12H21BN2O2, Purity:95, SMILES: CCCn1ncc(c1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-Methoxyethyl)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole, CAS:847818-71-7, Molecular Weight: 252.118, C12H21BN2O3, Purity:95, SMILES: COCCn1cc(cn1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(3-OXETANYL)-1H-PYRAZOLE-4-BORONICACIDPINACOLESTER, CAS:1339890-99-1, Molecular Weight: 268.117, C12H21BN2O4, Purity:95, SMILES: CC(C)(O)C(C)(C)OB(O)C1=CN(N=C1)C1COC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Cyclohex-1-en-1-yl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:141091-37-4, Molecular Weight: 208.105, C12H21BO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(tert-Butyldimethylsilyloxy)phenylboronic acid, CAS:159191-56-7, Molecular Weight: 252.19, C12H21BO3Si, Purity:95, SMILES: OB(c1ccc(cc1)O[Si](C(C)(C)C)(C)C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Ethylpiperazin-1-YlAniline Dihydrochloride, CAS:1172518-57-8, Molecular Weight: 278.221, C12H21Cl2N3, Purity:95, SMILES: Cl.Cl.CCN1CCN(CC1)C1=CC=C(N)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Adamantan-1-Yl-2-Aminoacetic Acid, CAS:60256-21-5, Molecular Weight: 282.207, C12H21Cl2NO2, Purity:95, SMILES: Cl.Cl.NC(C(O)=O)C12CC3CC(CC(C3)C1)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sotalol (hydrochloride), CAS:959-24-0, Molecular Weight: 308.8247, C12H21ClN2O3S, Purity:98, SMILES: OC(C1=CC=C(NS(C)(=O)=O)C=C1)CNC(C)C.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(1,1-difluoro-2-hydroxyethyl)piperidine-1-carboxylate, CAS:1258639-21-2, Molecular Weight: 265.2968, C12H21F2NO3, Purity:95, SMILES: OCC(C1CCN(CC1)C(=O)OC(C)(C)C)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3,3-difluoro-4-((methylsulfonyloxy)methyl)piperidine-1-carboxylate, CAS:, Molecular Weight: 329.361, C12H21F2NO5S, Purity:95, SMILES: O=C(N1CCC(C(C1)(F)F)COS(=O)(=O)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-Fluoro-4-((hydroxyimino)methyl)-4-ethylpiperidine-1-carboxylate, CAS:1400765-53-8, Molecular Weight: 260.3051, C12H21FN2O3, Purity:95, SMILES: O/N=C/C1(C)CCN(CC1F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rimantadine, CAS:13392-28-4, Molecular Weight: 179.3018, C12H21N, Purity:98, SMILES: CC(C1(C[C@H](C2)C3)C[C@H]3C[C@H]2C1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diazinon, CAS:333-41-5, Molecular Weight: 304.3455, C12H21N2O3PS, Purity:98, SMILES: S=P(OCC)(OCC)OC1=NC(C(C)C)=NC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-OAU, CAS:83797-69-7, Molecular Weight: 239.314, C12H21N3O2, Purity:98, SMILES: O=C1NC(C=C(NCCCCCCCC)N1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9-Oxo-Octahydro-Pyrazino[1,2-A]Pyrazine-2-Carboxylic Acid Tert-Butyl Ester, CAS:1250994-01-4, Molecular Weight: 255.3134, C12H21N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2CCNC(=O)C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Brinzolamide, CAS:138890-62-7, Molecular Weight: 383.5072, C12H21N3O5S3, Purity:98, SMILES: O=S(C(S1)=CC2=C1S(N(CCCOC)C[C@@H]2NCC)(=O)=O)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Aminomethyl-6,7-Dihydro-5H,9H-[1,2,4]Triazolo[4,3-A][1,4]Diazepine-8-Carboxylic Acid Tert-Butyl Ester, CAS:1251000-46-0, Molecular Weight: 267.3274, C12H21N5O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCCN2C(CN)=NN=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nizatidine, CAS:76963-41-2, Molecular Weight: 331.45744, C12H21N5O2S2, Purity:98, SMILES: CN/C(NCCSCC1=CSC(CN(C)C)=N1)=C\[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g.
EOS Med Chem, Medchem is Big
執大象，天下往，往而無害，安平泰
2018. 4.18 Janpan CPHI, Attend
2018. 5.15 Israel Biomed, Attend
2018. 6. 20 China CPHI, W4E82
2018. 8. 28 Korea CPHI, Attend
2018. 10. 9 Spain World CPHI, Attend
郵箱: info@eosmedchem.com ; eosmedchem@gmail.com
辦公室: 0086-531-69905422-806(直通)
攜帶番號 & WhatsApp & Wechat: +8618653174435
住所: Diaozhen Chemical Industrial Park, Jinan City, China
Skype: willgutian
QQ: 2393923585
|
