| 8-(Tert-Butoxycarbonyl-8-Azaspiro[4.5]Decane-2-Carboxylic Acid, CAS:1160247-17-5, Molecular Weight: 283.3633, C15H25NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CCC(C2)C(O)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-butyl 4-(2-ethoxy-2-oxoethylideneazepane-1-carboxylate, CAS:473836-97-4, Molecular Weight: 283.3633, C15H25NO4, Purity:95, SMILES: CCOC(=O)\C=C1\CCCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Boc-4-(2-Ethoxycarbonyl-acetyl)piperidine, CAS:479630-08-5, Molecular Weight: 299.3627, C15H25NO5, Purity:95, SMILES: CCOC(=O)CC(=O)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(8-(Tert-Butoxycarbonyl-1-Oxa-8-Azaspiro[4.5]Decan-3-YlAcetic Acid, CAS:1160246-87-6, Molecular Weight: 299.3627, C15H25NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(CC(O)=O)CO2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1S,3S,4S,5R-2-Tert-Butyl 3-Ethyl 5-Hydroxy-2-Azabicyclo[2.2.2]Octane-2,3-Dicarboxylate, CAS:1272756-98-5, Molecular Weight: 299.3627, C15H25NO5, Purity:95, SMILES: CCOC(=O)[C@@H]1C2CCC(C[C@H]2O)N1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(4aS,6R,7aS-4-tert-butyl 6-ethyl hexahydrocyclopenta[b][1,4]oxazine-4,6(4aH-dicarboxylate, CAS:1290627-68-7, Molecular Weight: 299.3627, C15H25NO5, Purity:95, SMILES: CCOC(=O)[C@H]1C[C@@H]2OCCN([C@H]2C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 3-(3-ethoxy-3-oxopropanoyl)piperidine-1-carboxylate, CAS:877173-80-3, Molecular Weight: 299.3627, C15H25NO5, Purity:95, SMILES: CCOC(=O)CC(=O)C1CCCN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-(PYRROLIDIN-1-YL)ETHYL)-4-(4,4,5,5-TETRAMETHYL-1,3,2-DIOXABOROLAN-2-YL)-1H-PYRAZOLE, CAS:1000802-52-7, Molecular Weight: 291.197, C15H26BN3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CN(CCN2CCCC2)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2,5-dihydro-1H-pyrrole-1-carboxylate, CAS:212127-83-8, Molecular Weight: 295.182, C15H26BNO4, Purity:98, SMILES: CC(C)(C)OC(=O)N1CC=C(C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| O-desmethyl Mebeverine alcohol (hydrochloride), CAS:856620-39-8, Molecular Weight: 287.82544, C15H26ClNO2, Purity:98, SMILES: OCCCCN(CC)C(C)CC1=CC=C(O)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (7R,7aR,14R,14aS)-tetradecahydro-7,14-methanodipyrido[1,2-a:1',2'-e][1,5]diazocine, CAS:492-08-0, Molecular Weight: 234.3803, C15H26N2, Purity:95, SMILES: C1CCN2C[C@H]3C[C@H](CN4CCCC[C@H]34)[C@@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (-)-Sparteine (sulfate pentahydrate), CAS:6160-12-9, Molecular Weight: 422.54, C15H26N2 . H2SO4 .5H2O, Purity:98, SMILES: O=S(O)(O)=O.[H][C@]12C[C@](CN3[C@]2([H])CCCC3)([H])[C@@](CCCC4)([H])N4C1.O.O.O.O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl Allyl(3-Oxo-3-(Pyrrolidin-1-YlPropylCarbamate, CAS:0, Molecular Weight: 282.3785, C15H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N(CCC(=O)N1CCCC1)CC=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Di-Tert-Butyl 1-(Bicyclo[1.1.1]Pentan-1-YlHydrazine-1,2-Dicarboxylate, CAS:1326242-72-1, Molecular Weight: 298.3779, C15H26N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)NN(C(=O)OC(C)(C)C)C12CC(C1)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Di-Tert-Butyl 6-Oxo-1,4-Diazepane-1,4-Dicarboxylate, CAS:459417-40-4, Molecular Weight: 314.3773, C15H26N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC(=O)C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-1,4-(DI-BOC)-PIPERAZINE-2-CARBOXYLIC ACID, CAS:788799-69-9, Molecular Weight: 330.3767, C15H26N2O6, Purity:90, SMILES: O=C(N1CCN([C@@H](C1)C(=O)O)C(=O)OC(C)(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,4-BIS(N-BOCPIPERAZINE-2-CARBOXYLIC ACID, CAS:181955-79-3, Molecular Weight: 330.3767, C15H26N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(C(C1)C(O)=O)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl3-Amino-1-Oxa-8-Azaspiro[4.5]Decane-8-Carboxylate Oxalate, CAS:0, Molecular Weight: 346.3761, C15H26N2O7, Purity:95, SMILES: OC(=O)C(O)=O.CC(C)(C)OC(=O)N1CCC2(CC(N)CO2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Doripenem (monohydrate), CAS:364622-82-2, Molecular Weight: 438.5195, C15H26N4O7S2, Purity:98, SMILES: O=C(C(N12)=C(S[C@@H]3CN[C@H](CNS(=O)(N)=O)C3)[C@H](C)[C@]2([H])[C@@H]([C@H](O)C)C1=O)O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Alismoxide, CAS:87701-68-6, Molecular Weight: 238.3657, C15H26O2, Purity:98, SMILES: O[C@@]1(C)CC[C@@]2([H])[C@@](O)(C)CCC(C(C)C)=C[C@]12[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl (4R-cis)-6-[(acetyloxy)methyl]-2,2-dimethyl-1,3-dioxane-4-acetate, CAS:154026-95-6, Molecular Weight: 302.3633, C15H26O6, Purity:95, SMILES: O=C(OC(C)(C)C)C[C@H]1C[C@@H](COC(=O)C)OC(O1)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Di-Tert-Butyl 6-Fluoro-1,4-Diazepane-1,4-Dicarboxylate, CAS:0, Molecular Weight: 318.3843, C15H27FN2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC(F)C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-[(Piperidin-4-YlCarbonyl]Piperazine-1-Carboxylate, CAS:203520-03-0, Molecular Weight: 297.3932, C15H27N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC1)C(=O)C1CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-di-tert-butyl 2-carbamoylpiperazine-1,4-dicarboxylate, CAS:, Molecular Weight: 329.392, C15H27N3O5, Purity:95, SMILES: O=C(N1[C@@H](C(N)=O)CN(C(OC(C)(C)C)=O)CC1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-di-tert-butyl 2-carbamoylpiperazine-1,4-dicarboxylate, CAS:, Molecular Weight: 329.392, C15H27N3O5, Purity:95, SMILES: O=C(N1[C@H](C(N)=O)CN(C(OC(C)(C)C)=O)CC1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Primaquine (Diphosphate), CAS:63-45-6, Molecular Weight: 455.3371, C15H27N3O9P2, Purity:98, SMILES: CC(NC1=C2N=CC=CC2=CC(OC)=C1)CCCN.O=P(O)(O)O.O=P(O)(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| E-64, CAS:66701-25-5, Molecular Weight: 357.4054, C15H27N5O5, Purity:98, SMILES: O=C([C@H]1O[C@@H]1C(N[C@H](C(NCCCCNC(N)=N)=O)CC(C)C)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Arg-Gly-Asp-Cys, CAS:, Molecular Weight: 449.48, C15H27N7O7S1, Purity:98, SMILES: [RGDC], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Arg-Gly-Asp-Ser, CAS:91037-65-9, Molecular Weight: 433.417, C15H27N7O8, Purity:98, SMILES: O=C(N[C@@H](CO)C(O)=O)[C@H](CC(O)=O)NC(CNC([C@@H](N)CCCNC(N)=N)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-Pentanoylpiperidine-1-carboxylate, CAS:1198286-46-2, Molecular Weight: 269.3798, C15H27NO3, Purity:95, SMILES: CCCCC(=O)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R-N-Boc-3-Piperidinecarboxylic Acid T-Butyl Ester, CAS:0, Molecular Weight: 285.3792, C15H27NO4, Purity:95, SMILES: CC(C)(C)OC(=O)[C@@H]1CCCN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 3-(N-BOC-piperidin-4-yl)propioate, CAS:301232-45-1, Molecular Weight: 285.3792, C15H27NO4, Purity:95, SMILES: CCOC(=O)CCC1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-(2-Hydroxyethyl-1-Oxa-8-Azaspiro[4.5]Decane-8-Carboxylate, CAS:1824023-95-1, Molecular Weight: 285.3792, C15H27NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)OCCC2CCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-(3-Ethoxy-3-OxopropylPiperidine-1-Carboxylate, CAS:301232-45-1, Molecular Weight: 285.3792, C15H27NO4, Purity:95, SMILES: CCOC(=O)CCC1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-isopropyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-5-(trimethylsilyl)isoxazole, CAS:, Molecular Weight: 309.284, C15H28BNO3Si, Purity:95, SMILES: CC(C)c1noc(c1B1OC(C)(C)C(C)(C)O1)[Si](C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2,4'-Bipiperidine-1'-Carboxylate, CAS:1251019-19-8, Molecular Weight: 268.395, C15H28N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C1CCCCN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Piperidin-4-Yloxy-Piperidine-1-Carboxylic Acid Tert-Butyl Ester, CAS:845305-83-1, Molecular Weight: 284.3944, C15H28N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)OC1CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3-(Aminomethyl-2-Oxa-9-Azaspiro[5.5]Undecane-9-Carboxylate, CAS:1160246-99-0, Molecular Weight: 284.3944, C15H28N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CCC(CN)OC2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S,E-tert-butyl 4-(((tert-butylsulfinyliminomethylpiperidine-1-carboxylate, CAS:0, Molecular Weight: 316.459, C15H28N2O3S, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)\C=N\[S@@](=O)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Di-Tert-Butyl 6-Hydroxy-1,4-Diazepane-1,4-Dicarboxylate, CAS:1823301-45-6, Molecular Weight: 316.3932, C15H28N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC(O)C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Peramivir, CAS:330600-85-6, Molecular Weight: 328.4072, C15H28N4O4, Purity:98, SMILES: O[C@H]1[C@]([C@H](C(CC)CC)NC(C)=O)([H])[C@H](NC(N)=N)C[C@@H]1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl3-(Aminomethyl-2-Oxa-9-Azaspiro[5.5]Undecane-9-Carboxylate Hydrochloride, CAS:0, Molecular Weight: 320.855, C15H29ClN2O3, Purity:95, SMILES: Cl.CC(C)(C)OC(=O)N1CCC2(CCC(CN)OC2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-(4-Aminopiperidin-1-YlPiperidine-1-Carboxylate, CAS:959237-16-2, Molecular Weight: 283.4097, C15H29N3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)N1CCC(N)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ro 31-9790, CAS:145337-55-9, Molecular Weight: 315.40846, C15H29N3O4, Purity:98, SMILES: O=C(N[C@H](C(NC)=O)C(C)(C)C)[C@H](CC(C)C)CC(NO)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Marimastat, CAS:154039-60-8, Molecular Weight: 331.4079, C15H29N3O5, Purity:98, SMILES: O=C(NO)[C@@H](O)[C@@H](CC(C)C)C(N[C@H](C(NC)=O)C(C)(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-563, CAS:140686-92-6, Molecular Weight: 359.4213, C15H29N5O5, Purity:98, SMILES: O=C(NCCC(O)=O)CC(O)CNC(CCCCCCNC(N)=N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Nonylpiperidine-4-carboxylic acid, CAS:1156807-77-0, Molecular Weight: 255.3963, C15H29NO2, Purity:95, SMILES: CCCCCCCCCN1CCC(CC1)C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pentadecanal, CAS:316249, Molecular Weight: 226.3981, C15H30O, Purity:95, SMILES: CCCCCCCCCCCCCCC=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isopropyl dodecanoate, CAS:10233-13-3, Molecular Weight: 242.3975, C15H30O2, Purity:97, SMILES: CCCCCCCCCCCC(=O)OC(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl tetradecanoate, CAS:124-10-7, Molecular Weight: 242.3975, C15H30O2, Purity:95, SMILES: CCCCCCCCCCCCCC(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pentadecanoic acid, CAS:1002-84-2, Molecular Weight: 242.3975, C15H30O2, Purity:95, SMILES: CCCCCCCCCCCCCCC(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Propyl dodecanoate, CAS:3681-78-5, Molecular Weight: 242.3975, C15H30O2, Purity:97, SMILES: CCCCCCCCCCCC(=O)OCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl (3-(2-(2-(3-aminopropoxy)ethoxy)ethoxy)propyl)carbamate, CAS:194920-62-2, Molecular Weight: 320.425, C15H32N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)NCCCOCCOCCOCCCN, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-((bis(diisopropylamino)phosphino)oxy)propanenitrile, CAS:102691-36-1, Molecular Weight: 301.4078, C15H32N3OP, Purity:95, SMILES: CC(C)N(C(C)C)P(OCCC#N)N(C(C)C)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| pentadecan-1-ol, CAS:629-76-5, Molecular Weight: 228.414, C15H32O, Purity:95, SMILES: CCCCCCCCCCCCCCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Peramivir (trihydrate), CAS:1041434-82-5, Molecular Weight: 382.4531, C15H34N4O7, Purity:98, SMILES: O[C@H]1[C@]([C@H](C(CC)CC)NC(C)=O)([H])[C@H](NC(N)=N)C[C@@H]1C(O)=O.[H]O.[H]O.[H]O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phenindione D5, CAS:70711-53-4, Molecular Weight: 227.2695, C15H5D5O2, Purity:98, SMILES: O=C1C(C2=C([2H])C([2H])=C([2H])C([2H])=C2[2H])C(C3=CC=CC=C31)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Nitrotryptanthrin, CAS:77603-42-0, Molecular Weight: 293.23378, C15H7N3O4, Purity:98, SMILES: O=C1N2C(C(C3=C2C=CC([N+]([O-])=O)=C3)=O)=NC4=CC=CC=C41, HPLC, NMR, LCMS is ok, stock more than 10g. |
| INO5042, CAS:14782-19-5, Molecular Weight: 281.28598, C15H7NO3S, Purity:98, SMILES: O=C(C1=C2SC(C3=CC=CO3)=N1)C4=C(C=CC=C4)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GW 5074, CAS:220904-83-6, Molecular Weight: 520.942, C15H8Br2INO2, Purity:98, SMILES: O=C1NC2=C(/C1=C/C3=CC(Br)=C(C(Br)=C3)O)C=C(C=C2)I, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IMD-0354, CAS:978-62-1, Molecular Weight: 383.6729, C15H8ClF6NO2, Purity:98, SMILES: O=C(NC1=CC(C(F)(F)F)=CC(C(F)(F)F)=C1)C2=CC(Cl)=CC=C2O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IMIRESTAT, CAS:89391-50-4, Molecular Weight: 286.233, C15H8F2N2O2, Purity:98, SMILES: O=C1NC2(C(N1)=O)C3=C(C4=C2C=C(F)C=C4)C=CC(F)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NS-1619, CAS:153587-01-0, Molecular Weight: 362.2267, C15H8F6N2O2, Purity:98, SMILES: O=C1NC2=CC(C(F)(F)F)=CC=C2N1C3=CC(C(F)(F)F)=CC=C3O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Coumestrol, CAS:479-13-0, Molecular Weight: 268.22102, C15H8O5, Purity:98, SMILES: O=C1C2=C(OC3=CC(O)=CC=C32)C4=CC=C(O)C=C4O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rhein, CAS:478-43-3, Molecular Weight: 284.2204, C15H8O6, Purity:98, SMILES: O=C(C(C=C1C2=O)=CC(O)=C1C(C3=C2C=CC=C3O)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bromindione, CAS:1146-98-1, Molecular Weight: 301.1348, C15H9BrO2, Purity:98, SMILES: O=C1C(C2=CC=C(Br)C=C2)C(C3=C1C=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Apoptosis Activator 2, CAS:79183-19-0, Molecular Weight: 306.1435, C15H9Cl2NO2, Purity:98, SMILES: O=C1N(CC2=CC=C(Cl)C(Cl)=C2)C3=C(C=CC=C3)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-chloro-N-(5-(4-fluorophenyl)-1,3,4-oxadiazol-2-yl)benzamide, CAS:865285-29-6, Molecular Weight: 317.702, C15H9ClFN3O2, Purity:95, SMILES: FC1=CC=C(C2=NN=C(NC(C(C=C3)=CC=C3Cl)=O)O2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KKL-35, CAS:865285-29-6, Molecular Weight: 317.7022632, C15H9ClFN3O2, Purity:98, SMILES: O=C(NC1=NN=C(C2=CC=C(F)C=C2)O1)C3=CC=C(Cl)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chlorindione, CAS:1146-99-2, Molecular Weight: 256.6837, C15H9ClO2, Purity:98, SMILES: O=C1C(C2=CC=C(Cl)C=C2)C(C3=C1C=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nepafenac D5, CAS:1246814-53-8, Molecular Weight: 259.3147, C15H9D5N2O2, Purity:98, SMILES: O=C(C1=C([2H])C([2H])=C([2H])C([2H])=C1[2H])C2=CC=CC(CC(N)=O)=C2N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML216, CAS:1430213-30-1, Molecular Weight: 383.3234728, C15H9F4N5OS, Purity:98, SMILES: O=C(NC1=CC=C(F)C(C(F)(F)F)=C1)NC2=NN=C(S2)C3=CC=NC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| YM-58483, CAS:223499-30-7, Molecular Weight: 421.3203, C15H9F6N5OS, Purity:98, SMILES: O=C(C1=C(C)N=NS1)NC2=CC=C(N3N=C(C(F)(F)F)C=C3C(F)(F)F)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PTC124, CAS:775304-57-9, Molecular Weight: 284.242, C15H9FN2O3, Purity:98, SMILES: O=C(C1=CC=CC(C2=NOC(C3=CC=CC=C3F)=N2)=C1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IQ-1S (free acid), CAS:23146-22-7, Molecular Weight: 247.2515, C15H9N3O, Purity:98, SMILES: O/N=C1C2=C(C3=NC4=CC=CC=C4N=C3\1)C=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DUBs-IN-2, CAS:924296-19-5, Molecular Weight: 275.2649, C15H9N5O, Purity:98, SMILES: N#CC1=C(C#N)N=C2C(/C(C3=C2C=CC=C3)=N/OCC)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PRT4165, CAS:31083-55-3, Molecular Weight: 235.2375, C15H9NO2, Purity:98, SMILES: O=C1/C(C(C2=C1C=CC=C2)=O)=C/C3=CC=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Astressin, CAS:170809-51-5, Molecular Weight: 3563.16166, C161H269N49O42, Purity:98, SMILES: O=C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(NC(CCCC)C(N[C@@H](CCC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@H](C(N)=O)[C@@H](C)CC)=O)=O)=O)=O)=O)=O)=O)=O)CCCCNC(CC1)=O)=O)CC2=CNC=N2)=O)C)[C@H]1NC([C@H](CCC(N)=O)NC([C@H](C)NC([C@H](CC(C)C)NC([C@H](CCC(N)=O)NC([C@H](CCC(O)=O)NC([C@H](C)NC([C@H](CCCNC(N)=N)NC([C@H](C)NC([C@H](CCCC)NC([C@H](CCC(O)=O)NC([C@H](CC(C)C)NC([C@H](C(C)C)NC([C@H](CCC(O)=O)NC([C@H](CCCNC(N)=N)NC([C@H](CC(C)C)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](N)CC3=CC=CC=C3)=O)CC4=CNC=N4)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BIO, CAS:667463-62-9, Molecular Weight: 356.1735, C16H10BrN3O2, Purity:98, SMILES: O/N=C(C1=CC=CC=C1N2)/C2=C3C(NC4=C/3C=CC(Br)=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB 415286, CAS:264218-23-7, Molecular Weight: 359.7207, C16H10ClN3O5, Purity:98, SMILES: O=C(C(NC1=CC=C(O)C(Cl)=C1)=C2C3=CC=CC=C3[N+]([O-])=O)NC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Piribedil D8, CAS:1398044-45-5, Molecular Weight: 306.389, C16H10D8N4O2, Purity:98, SMILES: [2H]C1([2H])C([2H])([2H])N(C2=NC=CC=N2)C([2H])([2H])C([2H])([2H])N1CC3=CC(OCO4)=C4C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| T807, CAS:1415379-56-4, Molecular Weight: 263.2691032, C16H10FN3, Purity:98, SMILES: FC1=CC=C(C2=CC3=C(C=C2)C(C=NC=C4)=C4N3)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Magnesium monoperoxyphthalate,hexahydrate, CAS:84665-66-7, Molecular Weight: 386.5496, C16H10MgO10, Purity:95, SMILES: [O-]OC(=O)c1ccccc1C(=O)[O-].O.O.O.O.O.O.[Mg+2], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sunset Yellow FCF, CAS:2783-94-0, Molecular Weight: 452.3693, C16H10N2Na2O7S2, Purity:98, SMILES: O=S(C1=CC=C2C(/N=N/C3=CC=C(S(=O)([O-])=O)C=C3)=C(O)C=CC2=C1)([O-])=O.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Hydroxy(4-PhenoxyphenylMethyleneMalononitrile, CAS:330792-68-2, Molecular Weight: 262.2628, C16H10N2O2, Purity:95, SMILES: OC(=C(C#N)C#N)C1=CC=C(OC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Indirubin, CAS:479-41-4, Molecular Weight: 262.2628, C16H10N2O2, Purity:98, SMILES: O=C1NC2=C(C=CC=C2)/C1=C3NC4=C(C=CC=C4)C\3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-HYDROXYPYRENE, CAS:5315-79-7, Molecular Weight: 218.25, C16H10O, Purity:95, SMILES: OC1=C2C=CC3=CC=CC4=C3C2=C(C=C1)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4'-(1,2-Ethynediyl)dibenzoic Acid, CAS:16819-43-5, Molecular Weight: 266.2482, C16H10O4, Purity:95, SMILES: OC(=O)c1ccc(cc1)C#Cc1ccc(cc1)C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [1,1'-biphenyl]-3,3',5,5'-tetracarboxylic acid, CAS:4371-28-2, Molecular Weight: 330.2458, C16H10O8, Purity:95, SMILES: OC(=O)c1cc(cc(c1)-c1cc(cc(c1)C(O)=O)C(O)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyren-1-ylboronic acid, CAS:164461-18-1, Molecular Weight: 246.068, C16H11BO2, Purity:95, SMILES: OB(O)c1ccc2ccc3cccc4ccc1c2c34, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Bromo-4-Phenylnaphthalene, CAS:59951-65-4, Molecular Weight: 283.163, C16H11Br, Purity:95, SMILES: BrC1=CC=C(C2=CC=CC=C2)C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Kenpaullone, CAS:142273-20-9, Molecular Weight: 327.1754, C16H11BrN2O, Purity:98, SMILES: O=C1NC2=CC=CC=C2C(NC3=C4C=C(Br)C=C3)=C4C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Anle138b, CAS:882697-00-9, Molecular Weight: 343.17474, C16H11BrN2O2, Purity:98, SMILES: BrC1=CC(C2=CC(C3=CC=C(OCO4)C4=C3)=NN2)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CHF5074, CAS:749269-83-8, Molecular Weight: 325.1617, C16H11Cl2FO2, Purity:98, SMILES: OC(C1(CC1)C(C=C2)=CC(F)=C2C3=CC=C(Cl)C(Cl)=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(o-Methoxyphenoxy)-4,6-dichloro-2-(4-pyridyl)pyrimidine, CAS:150727-72-3, Molecular Weight: 348.183, C16H11Cl2N3O2, Purity:90, SMILES: COc1ccccc1Oc1c(Cl)nc(nc1Cl)c1ccncc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(2-chloro-6-fluorobenzyl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]thiazine-6-carboxylic acid, CAS:688760-38-5, Molecular Weight: 351.78, C16H11ClFNO3S, Purity:98, SMILES: ClC(C=CC=C1F)=C1CN2C3=CC(C(O)=O)=CC=C3SCC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Chloro-2,3-diphenylpyrazine, CAS:41270-66-0, Molecular Weight: 266.725, C16H11ClN2, Purity:98, SMILES: Clc1cnc(-c2ccccc2)c(n1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phenol, 3-(4-chloro-2-quinazolinyl)-, 1-acetate, CAS:911417-24-8, Molecular Weight: 298.724, C16H11ClN2O2, Purity:90, SMILES: CC(=O)Oc1cccc(c1)c1nc(Cl)c2c(n1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4-Fluoro-phenyl)-1-phenyl-1H-pyrazole-4-carbaldehyde, CAS:36640-40-1, Molecular Weight: 266.2697, C16H11FN2O, Purity:95, SMILES: O=Cc1cn(nc1c1ccc(cc1)F)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(5-fluoroquinoline-8-sulfonamido)benzoic acid, CAS:1628431-07-1, Molecular Weight: 346.333, C16H11FN2O4S, Purity:95, SMILES: OC(=O)c1ccc(NS(=O)(=O)c2ccc(F)c3cccnc23)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SC144, CAS:895158-95-9, Molecular Weight: 322.2965, C16H11FN6O, Purity:98, SMILES: O=C(C1=NC=CN=C1)NNC2=NC3=C(N4C2=CC=C4)C=CC(F)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Paprotrain, CAS:57046-73-8, Molecular Weight: 245.27864, C16H11N3, Purity:98, SMILES: N#C/C(C1=CNC2=CC=CC=C21)=C\C3=CN=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ipsalazide, CAS:82101-17-5, Molecular Weight: 387.25457856, C16H11N3Na2O6, Purity:98, SMILES: O=C([O-])C1=CC(/N=N/C2=CC=C(C(NCC([O-])=O)=O)C=C2)=CC=C1O.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| [2,2':6',2''-Terpyridine]-4'-carboxylic acid, CAS:148332-36-9, Molecular Weight: 277.2774, C16H11N3O2, Purity:95, SMILES: OC(=O)c1cc(nc(c1)c1ccccn1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-((6-Nitro-1H-Indol-1-YlMethylBenzonitrile, CAS:116450-83-0, Molecular Weight: 277.2774, C16H11N3O2, Purity:95, SMILES: [O-][N+](=O)C1=CC2=C(C=CN2CC2=CC=C(C=C2)C#N)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Indirubin-3'-monoxime, CAS:160807-49-8, Molecular Weight: 277.2774, C16H11N3O2, Purity:98, SMILES: O=C1NC2=C(C=CC=C2)/C1=C3NC4=C(C=CC=C4)C\3=N/O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| STAT5-IN-1, CAS:285986-31-4, Molecular Weight: 293.27684, C16H11N3O3, Purity:98, SMILES: O=C(C1=CC=CN=C1)N/N=C/C2=COC3=CC=CC=C3C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sodium formononetin-3'-sulfonate, CAS:949021-68-5, Molecular Weight: 370.30910928, C16H11NaO7S, Purity:98, SMILES: [O-]S(C1=C(OC)C=CC(C2=COC3=CC(O)=CC=C3C2=O)=C1)(=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-PHENYL-QUINOLINE-7-CARBALDEHYDE, CAS:867162-43-4, Molecular Weight: 233.2646, C16H11NO, Purity:95, SMILES: O=Cc1ccc2c(c1)nc(cc2)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Phenylquinoline-7-carboxylic acid, CAS:841297-69-6, Molecular Weight: 249.264, C16H11NO2, Purity:90, SMILES: OC(=O)c1ccc2c(c1)nc(cc2)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cinchophen, CAS:132-60-5, Molecular Weight: 249.264, C16H11NO2, Purity:98, SMILES: O=C(C1=CC(C2=CC=CC=C2)=NC3=CC=CC=C13)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Benzyloxy-3-Bromoquinolin-2-Ol, CAS:868145-21-5, Molecular Weight: 330.176, C16H12BrNO2, Purity:95, SMILES: OC1=NC2=CC=CC=C2C(OCC2=CC=CC=C2)=C1Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9,10-BIS(CHLOROMETHYL)ANTHRACENE, CAS:10387-13-0, Molecular Weight: 275.172, C16H12Cl2, Purity:95, SMILES: ClCc1c2ccccc2c(c2c1cccc2)CCl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diclazepam, CAS:2894-68-0, Molecular Weight: 319.1853, C16H12Cl2N2O, Purity:98, SMILES: O=C1N(C)C2=CC=C(Cl)C=C2C(C3=CC=CC=C3Cl)=NC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SC144 (hydrochloride), CAS:917497-70-2, Molecular Weight: 358.7575, C16H12ClFN6O, Purity:98, SMILES: O=C(C1=NC=CN=C1)NNC2=NC3=C(N4C2=CC=C4)C=CC(F)=C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-[4-(AminosulfonylPhenyl]-5-(4-Chlorophenyl-1H-Pyrazole-3-Carboxylic Acid, CAS:170571-19-4, Molecular Weight: 377.802, C16H12ClN3O4S, Purity:95, SMILES: NS(=O)(=O)C1=CC=C(C=C1)N1N=C(C=C1C1=CC=C(Cl)C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cresyl Violet perchlorate, CAS:41830-80-2, Molecular Weight: 361.73658, C16H12ClN3O5, Purity:98, SMILES: NC1=CC2=[O+]C3=C(C4=CC=CC=C4C(N)=C3)N=C2C=C1.O=Cl(=O)([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oncrasin-1, CAS:75629-57-1, Molecular Weight: 269.7256, C16H12ClNO, Purity:98, SMILES: O=CC1=CN(CC(C=C2)=CC=C2Cl)C3=CC=CC=C31, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SL327, CAS:305350-87-2, Molecular Weight: 335.3467896, C16H12F3N3S, Purity:98, SMILES: FC(F)(F)C1=C(/C(C#N)=C(N)/SC2=CC=C(N)C=C2)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NS6180, CAS:353262-04-1, Molecular Weight: 323.3328, C16H12F3NOS, Purity:98, SMILES: O=C1CSC2=CC=CC=C2N1CC3=CC=CC(C(F)(F)F)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dipraglurant, CAS:872363-17-2, Molecular Weight: 265.285, C16H12FN3, Purity:98, SMILES: FC1=CN2C(C=C1)=NC(CCC#CC3=NC=CC=C3)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Flubendazole, CAS:31430-15-6, Molecular Weight: 313.2832, C16H12FN3O3, Purity:98, SMILES: O=C(OC)NC1=NC2=CC=C(C(C3=CC=C(F)C=C3)=O)C=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SKF-86002, CAS:72873-74-6, Molecular Weight: 297.35, C16H12FN3S, Purity:98, SMILES: FC1=CC=C(C2=C(C3=CC=NC=C3)N4C(SCC4)=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-fluorobenzyl)-4-(furan-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-6-amine, CAS:443103-97-7, Molecular Weight: 309.2978, C16H12FN5O, Purity:95, SMILES: Nc1nc(-c2ccco2)c2cnn(Cc3ccccc3F)c2n1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CPI-444, CAS:443103-97-7, Molecular Weight: 309.2978, C16H12FN5O, Purity:98, SMILES: Nc1nc(-c2ccco2)c2cnn(Cc3ccccc3F)c2n1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY3177833, CAS:1627696-51-8, Molecular Weight: 309.2978, C16H12FN5O, Purity:98, SMILES: O=C1N[C@@](C)(C2=NC=NC=C2F)C3=C1C=C(C4=CNN=C4)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cyhalofop, CAS:122008-78-0, Molecular Weight: 301.2692, C16H12FNO4, Purity:98, SMILES: C[C@@H](OC1=CC=C(OC2=CC=C(C#N)C=C2F)C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sudan I, CAS:842-07-9, Molecular Weight: 248.2793, C16H12N2O, Purity:98, SMILES: OC1=CC=C2C=CC=CC2=C1/N=N/C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML329, CAS:19992-50-8, Molecular Weight: 328.34248, C16H12N2O4S, Purity:98, SMILES: O=S(C1=CC=C(NC(C2=O)=CC(C3=C2C=CC=C3)=O)C=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Pyrazole-4-carbonitrile, 3-amino-5-(4-phenoxyphenyl)-, CAS:330792-70-6, Molecular Weight: 276.2927, C16H12N4O, Purity:95, SMILES: N#Cc1c(N)n[nH]c1c1ccc(cc1)Oc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,2'-(OxydimethanediylBis(5-Nitro-1H-Benzimidazole, CAS:1222810-74-3, Molecular Weight: 368.3037, C16H12N6O5, Purity:95, SMILES: [O-][N+](=O)C1=CC2=C(C=C1)N=C(COCC1=NC3=C(N1)C=C(C=C3)[N+]([O-])=O)N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Anthracen-1-yl)ethanone, CAS:7396-21-6, Molecular Weight: 220.2659, C16H12O, Purity:95, SMILES: CC(=O)c1cccc2c1cc1ccccc1c2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Hydroxy-1,2:5,6-Dibenzocyclooct-7-Yne, CAS:1027338-06-2, Molecular Weight: 220.2659, C16H12O, Purity:95, SMILES: OC1CC2=CC=CC=C2C#CC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9-Acetylanthracene, CAS:784-04-3, Molecular Weight: 220.2659, C16H12O, Purity:95, SMILES: CC(=O)c1c2ccccc2cc2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Anisindione, CAS:117-37-3, Molecular Weight: 252.2647, C16H12O3, Purity:98, SMILES: O=C1C(C2=CC=C(OC)C=C2)C(C3=C1C=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tiopinac, CAS:61220-69-7, Molecular Weight: 284.32968, C16H12O3S, Purity:98, SMILES: O=C(O)CC1=CC=C2C(SCC3=CC=CC=C3C2=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4-Stilbenedicarboxylic Acid, CAS:74299-91-5, Molecular Weight: 268.2641, C16H12O4, Purity:95, SMILES: OC(=O)C1=CC=C(C=C1)\C=C\C1=CC=C(C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Formononetin, CAS:485-72-3, Molecular Weight: 268.2641, C16H12O4, Purity:98, SMILES: O=C1C(C2=CC=C(OC)C=C2)=COC3=CC(O)=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acacetin, CAS:480-44-4, Molecular Weight: 284.2635, C16H12O5, Purity:98, SMILES: O=C1C=C(C2=CC=C(OC)C=C2)OC3=CC(O)=CC(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Biochanin A, CAS:491-80-5, Molecular Weight: 284.2635, C16H12O5, Purity:98, SMILES: OC1=C2C(OC=C(C3=CC=C(OC)C=C3)C2=O)=CC(O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Calycosin, CAS:20575-57-9, Molecular Weight: 284.2635, C16H12O5, Purity:98, SMILES: O=C1C(C2=CC=C(OC)C(O)=C2)=COC3=CC(O)=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glycitein, CAS:40957-83-3, Molecular Weight: 284.2635, C16H12O5, Purity:98, SMILES: O=C(C(C1=CC=C(O)C=C1)=CO2)C3=C2C=C(O)C(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oroxylin A, CAS:480-11-5, Molecular Weight: 284.2635, C16H12O5, Purity:98, SMILES: O=C1C=C(C2=CC=CC=C2)OC3=CC(O)=C(OC)C(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Wogonin, CAS:632-85-9, Molecular Weight: 284.2635, C16H12O5, Purity:98, SMILES: O=C1C=C(C2=CC=CC=C2)OC3=C(OC)C(O)=CC(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diosmetin, CAS:520-34-3, Molecular Weight: 300.2629, C16H12O6, Purity:98, SMILES: O=C1C=C(C2=CC=C(OC)C(O)=C2)OC3=CC(O)=CC(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hispidulin, CAS:1447-88-7, Molecular Weight: 300.2629, C16H12O6, Purity:98, SMILES: O=C1C=C(C2=CC=C(O)C=C2)OC3=CC(O)=C(OC)C(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Kaempferide, CAS:491-54-3, Molecular Weight: 300.2629, C16H12O6, Purity:98, SMILES: O=C1C(O)=C(C2=CC=C(OC)C=C2)OC3=CC(O)=CC(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isorhamnetin, CAS:480-19-3, Molecular Weight: 316.2623, C16H12O7, Purity:98, SMILES: O=C1C(O)=C(C2=CC=C(O)C(OC)=C2)OC3=CC(O)=CC(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(1-Naphthyl)benzeneboronic acid, CAS:881913-20-8, Molecular Weight: 248.084, C16H13BO2, Purity:95, SMILES: OB(c1cccc(c1)c1cccc2c1cccc2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(1-Naphthyl)benzeneboronic acid, CAS:870774-25-7, Molecular Weight: 248.084, C16H13BO2, Purity:95, SMILES: OB(c1ccc(cc1)c1cccc2c1cccc2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(2-Naphthyl)benzeneboronic acid, CAS:918655-03-5, Molecular Weight: 248.084, C16H13BO2, Purity:95, SMILES: OB(c1ccc(cc1)c1ccc2c(c1)cccc2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Phenylnaphthalene-1-boronic acid, CAS:372521-91-0, Molecular Weight: 248.084, C16H13BO2, Purity:95, SMILES: OB(c1ccc(c2c1cccc2)c1ccccc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WHI-P97, CAS:211555-05-4, Molecular Weight: 455.1007, C16H13Br2N3O3, Purity:98, SMILES: BrC1=CC(NC2=NC=NC3=CC(OC)=C(OC)C=C32)=CC(Br)=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(4-Bromo-2-chlorophenyl)-8-ethyl-2-methylsulfanylpyrido[2,3-d]pyrimidin-7-one, CAS:1286738-66-6, Molecular Weight: 410.716, C16H13BrClN3OS, Purity:99, SMILES: CCn1c2nc(SC)ncc2cc(-c2ccc(Br)cc2Cl)c1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD318088, CAS:391210-00-7, Molecular Weight: 561.0891, C16H13BrF3IN2O4, Purity:98, SMILES: BrC1=CC(C(NOCC(CO)O)=O)=C(C(F)=C1F)NC2=CC=C(C=C2F)I, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-[5-BROMO-1-[(4-METHYLPHENYL)SULFONYL]-1H-PYRROLO[2,3-B]PYRIDIN-3-YL]-ETHANONE, CAS:1052633-38-1, Molecular Weight: 393.255, C16H13BrN2O3S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)n1cc(c2c1ncc(c2)Br)C(=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 2-(2,4-Dichlorophenyl-3,4-Dihydro-2H-Benzo[B][1,4]Oxazine-6-Carboxylate, CAS:0, Molecular Weight: 338.185, C16H13Cl2NO3, Purity:95, SMILES: COC(=O)C1=CC2=C(OC(CN2)C2=C(Cl)C=C(Cl)C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Aceclofenac, CAS:89796-99-6, Molecular Weight: 354.1847, C16H13Cl2NO4, Purity:98, SMILES: O=C(OCC(O)=O)CC1=CC=CC=C1NC2=C(Cl)C=CC=C2Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tioconazole, CAS:65899-73-2, Molecular Weight: 387.7112, C16H13Cl3N2OS, Purity:98, SMILES: ClC1=CC=C(C(OCC2=C(Cl)SC=C2)CN3C=CN=C3)C(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZM 306416, CAS:690206-97-4, Molecular Weight: 333.7447, C16H13ClFN3O2, Purity:98, SMILES: COC1=CC2=NC=NC(NC3=C(F)C=C(Cl)C=C3)=C2C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9B-(4-Chlorophenyl-2,3-Dihydro-1H-Imidazo[2,1-A]Isoindol-5(9Bh-One, CAS:6038-49-9, Molecular Weight: 284.74, C16H13ClN2O, Purity:95, SMILES: ClC1=CC=C(C=C1)C12NCCN1C(=O)C1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clobazam, CAS:22316-47-8, Molecular Weight: 300.7396, C16H13ClN2O2, Purity:98, SMILES: O=C(C1)N(C)C2=CC=C(Cl)C=C2N(C3=CC=CC=C3)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FR-188582, CAS:189699-82-9, Molecular Weight: 332.80462, C16H13ClN2O2S, Purity:98, SMILES: O=S(C1=CC=C(C2=CC(Cl)=NN2C3=CC=CC=C3)C=C1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Suclofenide, CAS:30279-49-3, Molecular Weight: 364.80342, C16H13ClN2O4S, Purity:98, SMILES: O=S(C1=CC=C(N2C(C(C3=CC=CC=C3)CC2=O)=O)C(Cl)=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LH846, CAS:639052-78-1, Molecular Weight: 316.8052, C16H13ClN2OS, Purity:98, SMILES: O=C(NC1=NC2=CC(Cl)=C(C)C=C2S1)CC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((1-(2-chlorophenyl)ethoxy)carbonyl)benzoic acid, CAS:, Molecular Weight: 304.725, C16H13ClO4, Purity:95, SMILES: O=C(O)C1=CC=CC=C1C(OC(C2=CC=CC=C2Cl)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Recilisib, CAS:334969-03-8, Molecular Weight: 336.79002, C16H13ClO4S, Purity:98, SMILES: O=C(O)C1=CC=C(/C=C/S(=O)(CC2=CC=C(Cl)C=C2)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| L-745337, CAS:158205-05-1, Molecular Weight: 369.4061, C16H13F2NO3S2, Purity:98, SMILES: CS(=O)(NC1=CC2=C(C(CC2)=O)C=C1SC3=CC=C(F)C=C3F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 3-(2,6-difluorophenylcarbamoyl)-4-methoxybenzoate, CAS:1089278-51-2, Molecular Weight: 321.2755, C16H13F2NO4, Purity:95, SMILES: COC(=O)c1ccc(c(c1)C(=O)Nc1c(F)cccc1F)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Flosulide, CAS:80937-31-1, Molecular Weight: 353.3405264, C16H13F2NO4S, Purity:98, SMILES: CS(=O)(NC1=CC2=C(C(CC2)=O)C=C1OC3=CC=C(F)C=C3F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lansoprazole (sodium), CAS:226904-00-3, Molecular Weight: 391.3433, C16H13F3N3NaO2S, Purity:98, SMILES: O=S(C1=NC2=CC=CC=C2[N-]1)CC3=NC=CC(OCC(F)(F)F)=C3C.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| BQU57, CAS:1637739-82-2, Molecular Weight: 334.2958296, C16H13F3N4O, Purity:98, SMILES: NC1=C(C#N)C(C(C(C)=NN2C)=C2O1)C3=CC=C(C(F)(F)F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (Z)-isopropyl 3-(3-(3,5-bis(trifluoromethyl)phenyl)-1H-1,2,4-triazol-1-yl)acrylate, CAS:1333152-22-9, Molecular Weight: 393.2837, C16H13F6N3O2, Purity:95, SMILES: CC(C)OC(=O)\C=C/n1cnc(n1)-c1cc(cc(c1)C(F)(F)F)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-CYCLOPROPYL-3-(2-FLUOROPHENYL)-1H-PYRROLO[3,2-B]PYRIDINE-2,7(4H,7AH)-DIONE, CAS:1464091-49-3, Molecular Weight: 284.285, C16H13FN2O2, Purity:95, SMILES: Fc1ccccc1C1=C2NC(=CC(=O)C2NC1=O)C1CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KX1-004, CAS:518058-84-9, Molecular Weight: 284.285, C16H13FN2O2, Purity:98, SMILES: O=C(C(N1)=CC2=C1C=CC(F)=C2)NCC3=CC=CC(O)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| R112, CAS:575474-82-7, Molecular Weight: 312.2984, C16H13FN4O2, Purity:98, SMILES: FC1=CN=C(NC2=CC(O)=CC=C2)N=C1NC3=CC(O)=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fosphenytoin (disodium), CAS:92134-98-0, Molecular Weight: 406.23752056, C16H13N2Na2O6P, Purity:98, SMILES: O=C1N(COP([O-])([O-])=O)C(C(C2=CC=CC=C2)(C3=CC=CC=C3)N1)=O.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| WZ4141, CAS:1222776-76-2, Molecular Weight: 279.29332, C16H13N3O2, Purity:98, SMILES: O=C(C=C)NC1=CC(OC2=C3C(NC=C3)=NC=C2)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mebendazole, CAS:31431-39-7, Molecular Weight: 295.2927, C16H13N3O3, Purity:98, SMILES: O=C(OC)NC1=NC2=CC=C(C(C3=CC=CC=C3)=O)C=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Icilin, CAS:36945-98-9, Molecular Weight: 311.2921, C16H13N3O4, Purity:98, SMILES: O=C1N(C2=CC=CC=C2O)CC=C(C3=CC=CC([N+]([O-])=O)=C3)N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GJ103 (sodium salt), CAS:1459687-96-7, Molecular Weight: 364.35418928, C16H13N4NaO3S, Purity:98, SMILES: O=C([O-])CSC1=NN=C(C2=NC=CC=C2)N1C3=CC=CC(OC)=C3.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2-Phenylquinolin-7-yl)methanol, CAS:361457-37-6, Molecular Weight: 235.2805, C16H13NO, Purity:90, SMILES: OCc1ccc2c(c1)nc(cc2)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Citenamide, CAS:10423-37-7, Molecular Weight: 235.28052, C16H13NO, Purity:98, SMILES: O=C(C1C2=CC=CC=C2C=CC3=CC=CC=C13)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,1'-(9H-carbazole-3,6-diyldiethanone, CAS:0, Molecular Weight: 251.2799, C16H13NO2, Purity:95, SMILES: CC(=O)C1=CC2=C(NC3=C2C=C(C=C3)C(C)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-(BenzyloxyQuinolin-2(1H-One, CAS:63404-84-2, Molecular Weight: 251.2799, C16H13NO2, Purity:95, SMILES: OC1=NC2=C(C=CC=C2OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| D-64131, CAS:74588-78-6, Molecular Weight: 251.2799, C16H13NO2, Purity:98, SMILES: O=C(C(N1)=CC2=C1C=CC(OC)=C2)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 4-(1H-indol-2-yl)benzoate, CAS:485321-10-6, Molecular Weight: 251.2799, C16H13NO2, Purity:95, SMILES: COC(=O)c1ccc(cc1)-c1cc2ccccc2[nH]1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-Amino-3-Methoxyphenyl-4H-Chromen-4-One, CAS:167869-21-8, Molecular Weight: 267.2793, C16H13NO3, Purity:95, SMILES: COC1=CC=CC(C2=CC(=O)C3=C(O2)C=CC=C3)=C1N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Benzyl-5-Methoxyisoindoline-1,3-Dione, CAS:1007455-12-0, Molecular Weight: 267.2793, C16H13NO3, Purity:95, SMILES: COC1=CC2=C(C=C1)C(=O)N(CC1=CC=CC=C1)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-Methoxyquinolin-2-yl)benzene-1,2-diol, CAS:1313738-83-8, Molecular Weight: 267.2793, C16H13NO3, Purity:95, SMILES: COc1cc(nc2c1cccc2)c1ccc(c(c1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-hydroxy-1-methyl-7-phenoxyquinolin-2(1H)-one, CAS:, Molecular Weight: 267.2793, C16H13NO3, Purity:95, SMILES: OC(C1=CC=C(OC2=CC=CC=C2)C=C1N3C)=CC3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD98059, CAS:167869-21-8, Molecular Weight: 267.2793, C16H13NO3, Purity:98, SMILES: O=C1C=C(OC2=CC=CC=C21)C3=CC=CC(OC)=C3N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BENZOIC ACID, 3-METHOXY-4-NITRO-, 2-ACETYLPHENYL ESTER, CAS:145370-32-7, Molecular Weight: 315.2775, C16H13NO6, Purity:95, SMILES: COc1cc(ccc1[N+]([O-])=O)C(=O)Oc1ccccc1C(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cercosporamide, CAS:131436-22-1, Molecular Weight: 331.2769, C16H13NO7, Purity:98, SMILES: O=C(C1=C(C([C@@]23C)=C(O)C=C1O)OC2=CC(O)=C(C(C)=O)C3=O)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9,10-Dimethylanthracene, CAS:781-43-1, Molecular Weight: 206.2824, C16H14, Purity:95, SMILES: Cc1c2ccccc2c(c2c1cccc2)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| L67, CAS:325970-71-6, Molecular Weight: 486.11476, C16H14Br2N4O4, Purity:98, SMILES: BrC1=CC(NCC(N/N=C/C2=CC([N+]([O-])=O)=CC=C2O)=O)=CC(Br)=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ACT-132577, CAS:1103522-45-7, Molecular Weight: 546.1932, C16H14Br2N6O4S, Purity:98, SMILES: O=S(N)(NC1=NC=NC(OCCOC2=NC=C(Br)C=N2)=C1C3=CC=C(Br)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD153035, CAS:153436-54-5, Molecular Weight: 360.2053, C16H14BrN3O2, Purity:98, SMILES: COC1=C(C=C(C2=C1)N=CN=C2NC3=CC(Br)=CC=C3)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WHI-P154, CAS:211555-04-3, Molecular Weight: 376.2047, C16H14BrN3O3, Purity:98, SMILES: OC1=CC=C(NC2=C3C=C(OC)C(OC)=CC3=NC=N2)C=C1Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NT157, CAS:1384426-12-3, Molecular Weight: 412.2551, C16H14BrNO5S, Purity:98, SMILES: S=C(NCC1=CC(O)=C(O)C(O)=C1)/C=C/C2=CC(O)=C(O)C(Br)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [N,N 0-Disalicylidene-1,2-ethanediaminato-(2-)]manganese(III) Chloride, CAS:53177-12-1, Molecular Weight: 356.686, C16H14ClMnN2O2, Purity:95, SMILES: [O-]c1ccccc1/C=[N-]/CC/[N-]=C\c1ccccc1[O-].[Cl-].[Mn+5], HPLC, NMR, LCMS is ok, stock more than 10g. |
| AG-1478, CAS:153436-53-4, Molecular Weight: 315.7543, C16H14ClN3O2, Purity:98, SMILES: COC1=CC2=NC=NC(NC3=CC=CC(Cl)=C3)=C2C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-([1,2,4]triazolo[1,5-a]pyridin-2-yl)ethyl)-7-chloro-5-methyl-2,3-dihydro-1H-pyrrolo[3,4-c]pyridine-1,6(5H)-dione, CAS:1628618-35-8, Molecular Weight: 343.768, C16H14ClN5O2, Purity:95, SMILES: Cn1cc2CN(CCc3nc4ccccn4n3)C(=O)c2c(Cl)c1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB-366791, CAS:472981-92-3, Molecular Weight: 287.7409, C16H14ClNO2, Purity:98, SMILES: O=C(NC1=CC=CC(OC)=C1)/C=C/C2=CC=C(Cl)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SMER18, CAS:944153-47-3, Molecular Weight: 287.7409, C16H14ClNO2, Purity:98, SMILES: C/C(NC1=CC=CC(O)=C1)=C/C(C2=CC=C(Cl)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pantoprazole (sodium), CAS:138786-67-1, Molecular Weight: 405.3516, C16H14F2N3NaO4S, Purity:98, SMILES: O=S(C1=NC2=CC=C(OC(F)F)C=C2[N-]1)CC3=NC=CC(OC)=C3OC.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD0325901, CAS:391210-10-9, Molecular Weight: 482.1931, C16H14F3IN2O4, Purity:98, SMILES: O=C(C1=CC=C(C(F)=C1NC2=CC=C(I)C=C2F)F)NOC[C@H](O)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-Lansoprazole, CAS:138530-94-6, Molecular Weight: 369.3615, C16H14F3N3O2S, Purity:98, SMILES: O=[S@@](C1=NC2=CC=CC=C2N1)CC3=NC=CC(OCC(F)(F)F)=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Piperidinecarbonitrile, 1-[[5-[4-methyl-5-(trifluoromethyl)-3-isoxazolyl]-2-thienyl]carbonyl]-, CAS:1124198-17-9, Molecular Weight: 369.3614696, C16H14F3N3O2S, Purity:98, SMILES: N#CC1CCN(C(C2=CC=C(C3=NOC(C(F)(F)F)=C3C)S2)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lansoprazole, CAS:103577-45-3, Molecular Weight: 369.3615, C16H14F3N3O2S, Purity:98, SMILES: O=S(C1=NC2=CC=CC=C2N1)CC3=NC=CC(OCC(F)(F)F)=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Voriconazole, CAS:137234-62-9, Molecular Weight: 349.3105, C16H14F3N5O, Purity:98, SMILES: O[C@@]([C@@H](C)C1=NC=NC=C1F)(CN2N=CN=C2)C(C(F)=C3)=CC=C3F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tolrestat, CAS:82964-04-3, Molecular Weight: 357.3475, C16H14F3NO3S, Purity:98, SMILES: O=C(O)CN(C(C1=C2C=CC(OC)=C(C(F)(F)F)C2=CC=C1)=S)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GDC-0623, CAS:1168091-68-6, Molecular Weight: 456.2102, C16H14FIN4O3, Purity:98, SMILES: FC(C=C(I)C=C1)=C1NC2=C(C(NOCCO)=O)C=CC3=CN=CN23, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Afloqualone, CAS:56287-74-2, Molecular Weight: 283.3003, C16H14FN3O, Purity:98, SMILES: O=C1N(C2=CC=CC=C2C)C(CF)=NC3=C1C=C(N)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-2-Benzamido-3-(4-FluorophenylPropanoic Acid, CAS:143120-37-0, Molecular Weight: 287.2857, C16H14FNO3, Purity:95, SMILES: OC(=O)[C@H](CC1=CC=C(F)C=C1)NC(=O)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2,4-Dimethylphenyl)phthalazin-1(2H)-one, CAS:, Molecular Weight: 250.2952, C16H14N2O, Purity:95, SMILES: Cc1ccc(c(c1)C)n1ncc2c(c1=O)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RG13022, CAS:136831-48-6, Molecular Weight: 266.29456, C16H14N2O2, Purity:98, SMILES: N#C/C(C1=CC=CN=C1)=C/C2=CC=C(OC)C(OC)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TTP 22, CAS:329907-28-0, Molecular Weight: 330.4246, C16H14N2O2S2, Purity:98, SMILES: O=C(O)CCSC1=C(C(C2=CC=C(C)C=C2)=CS3)C3=NC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Valdecoxib, CAS:181695-72-7, Molecular Weight: 314.3589, C16H14N2O3S, Purity:98, SMILES: O=S(C1=CC=C(C2=C(C)ON=C2C3=CC=CC=C3)C=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amlexanox, CAS:68302-57-8, Molecular Weight: 298.2934, C16H14N2O4, Purity:98, SMILES: O=C(C1=C(N)N=C2C(C(C3=CC(C(C)C)=CC=C3O2)=O)=C1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ID-8, CAS:147591-46-6, Molecular Weight: 298.29336, C16H14N2O4, Purity:98, SMILES: OC1=CC2=C(C=C1)C([N+]([O-])=O)=C(C)N2C3=CC=C(OC)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phthalylsulfacetamide, CAS:131-69-1, Molecular Weight: 362.3571, C16H14N2O6S, Purity:98, SMILES: O=C(O)C1=CC=CC=C1C(NC2=CC=C(S(=O)(NC(C)=O)=O)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CPI-455, CAS:1628208-23-0, Molecular Weight: 278.3086, C16H14N4O, Purity:98, SMILES: N#CC1=C2NC(C3=CC=CC=C3)=C(C(C)C)C(N2N=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RKI-1447, CAS:1342278-01-6, Molecular Weight: 326.373, C16H14N4O2S, Purity:98, SMILES: O=C(NC1=NC(C2=CC=NC=C2)=CS1)NCC3=CC=CC(O)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| VU 0240551, CAS:893990-34-6, Molecular Weight: 342.4386, C16H14N4OS2, Purity:98, SMILES: O=C(CSC1=NN=C(C2=CC=CC=C2)C=C1)NC3=NC(C)=CS3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-(Benzyloxy-2,3-Dihydro-1H-Inden-1-One, CAS:25083-80-1, Molecular Weight: 238.2812, C16H14O2, Purity:95, SMILES: O=C1CCC2=C1C=C(OCC1=CC=CC=C1)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fenbufen, CAS:36330-85-5, Molecular Weight: 254.2806, C16H14O3, Purity:98, SMILES: O=C(O)CCC(C1=CC=C(C2=CC=CC=C2)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ketoprofen, CAS:22071-15-4, Molecular Weight: 254.28056, C16H14O3, Purity:98, SMILES: O=C(C1=CC=CC=C1)C2=CC=CC(C(C(O)=O)C)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ketoprofen, CAS:22071-15-4, Molecular Weight: 254.2806, C16H14O3, Purity:99, SMILES: CC(C(O)=O)c1cccc(c1)C(=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,2-Benzenedicarboxylic acid, mono(1-phenylethyl) ester, CAS:33533-53-8, Molecular Weight: 270.28, C16H14O4, Purity:95, SMILES: CC(c1ccccc1)OC(=O)c1ccccc1C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4'-Dimethoxybenzil, CAS:1226-42-2, Molecular Weight: 270.27996, C16H14O4, Purity:98, SMILES: O=C(C1=CC=C(OC)C=C1)C(C2=CC=C(OC)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cardamonin, CAS:19309-14-9, Molecular Weight: 270.28, C16H14O4, Purity:98, SMILES: O=C(C1=C(OC)C=C(O)C=C1O)/C=C/C2=CC=CC=C2.[E], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Imperatorin, CAS:482-44-0, Molecular Weight: 270.28, C16H14O4, Purity:98, SMILES: O=C1C=CC2=CC3=C(OC=C3)C(OC/C=C(C)/C)=C2O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isoimperatorin, CAS:482-45-1, Molecular Weight: 270.28, C16H14O4, Purity:98, SMILES: O=C1C=CC2=C(OC/C=C(C)/C)C3=C(OC=C3)C=C2O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 4-(2-Formylphenoxymethyl)benzoate, CAS:351335-29-0, Molecular Weight: 270.28, C16H14O4, Purity:99, SMILES: COC(=O)c1ccc(cc1)COc1ccccc1C=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R-8-Hydroxy-3-(3-Hydroxy-4-MethoxyphenylIsochroman-1-One, CAS:21499-23-0, Molecular Weight: 286.2794, C16H14O5, Purity:95, SMILES: COC1=C(O)C=C(C=C1)[C@H]1CC2=C(C(=O)O1)C(O)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-8-Hydroxy-3-(3-Hydroxy-4-MethoxyphenylIsochroman-1-One, CAS:0, Molecular Weight: 286.2794, C16H14O5, Purity:95, SMILES: COC1=C(O)C=C(C=C1)[C@@H]1CC2=C(C(=O)O1)C(O)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Hematoxylin, CAS:517-28-2, Molecular Weight: 302.2787, C16H14O6, Purity:98, SMILES: OC1=CC=C([C@]2([H])[C@](CC3=C2C=C(O)C(O)=C3)(O)CO4)C4=C1O yBw4y7IpI7IuI72X, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hesperetin, CAS:520-33-2, Molecular Weight: 302.2787, C16H14O6, Purity:98, SMILES: O=C1C[C@@H](C2=CC=C(OC)C(O)=C2)OC3=CC(O)=CC(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD153035 (Hydrochloride), CAS:183322-45-4, Molecular Weight: 396.6662, C16H15BrClN3O2, Purity:98, SMILES: COC1=C(C=C(C2=C1)N=CN=C2NC3=CC(Br)=CC=C3)OC.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PIK-75, CAS:372196-77-5, Molecular Weight: 488.7434, C16H15BrClN5O4S, Purity:98, SMILES: BrC(C=C1)=CN2C1=NC=C2/C=N/N(S(=O)(C3=C(C=CC([N+]([O-])=O)=C3)C)=O)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (5-Bromo-2-Methoxyphenyl(3,5-DimethoxyphenylMethanone, CAS:1094749-23-1, Molecular Weight: 351.192, C16H15BrO4, Purity:95, SMILES: COC1=CC(=CC(OC)=C1)C(=O)C1=C(OC)C=CC(Br)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-1,3-bis(4-chlorophenylsulfonyl)pyrrolidine, CAS:, Molecular Weight: 420.331, C16H15Cl2NO4S2, Purity:95, SMILES: O=S([C@@H]1CN(S(=O)(C2=CC=C(Cl)C=C2)=O)CC1)(C3=CC=C(Cl)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-chloro-3,5-dimethyl-1-tosyl-1H-indazole, CAS:1421252-92-7, Molecular Weight: 334.821, C16H15ClN2O2S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)n1nc(c2c1ccc(c2Cl)C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clotiazepam, CAS:33671-46-4, Molecular Weight: 318.8211, C16H15ClN2OS, Purity:98, SMILES: O=C1CN=C(C2=CC=CC=C2Cl)C(C=C(CC)S3)=C3N1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ESI-09, CAS:263707-16-0, Molecular Weight: 330.7689, C16H15ClN4O2, Purity:98, SMILES: O=C(C1=NOC(C(C)(C)C)=C1)/C(C#N)=N/NC2=CC(Cl)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Norzopiclone, CAS:59878-63-6, Molecular Weight: 374.7817, C16H15ClN6O3, Purity:98, SMILES: O=C(N1CCNCC1)OC2N(C3=NC=C(Cl)C=C3)C(C4=NC=CN=C42)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RS4317, CAS:91431-42-4, Molecular Weight: 338.7397, C16H15ClO6, Purity:98, SMILES: COC1=C(OC)C(OC(C)=O)=C2C=CC(Cl)=CC2=C1OC(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pantoprazole, CAS:102625-70-7, Molecular Weight: 383.3698, C16H15F2N3O4S, Purity:98, SMILES: O=S(C1=NC2=CC=C(OC(F)F)C=C2N1)CC3=NC=CC(OC)=C3OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pantoprazole (sodium hydrate), CAS:164579-32-2, Molecular Weight: 433.38, C16H15F2N3O4S . 3/2H2 O . Na, Purity:98, SMILES: O=S(C1=NC2=CC=C(OC(F)F)C=C2N1)CC3=NC=CC(OC)=C3OC.[1.5H2O].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bay-K-8644 ((R)-(+)-), CAS:98791-67-4, Molecular Weight: 356.2965, C16H15F3N2O4, Purity:98, SMILES: CC1=C([N+]([O-])=O)[C@H](C2=C(C(F)(F)F)C=CC=C2)C(C(OC)=O)=C(C)N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bay-K-8644 ((S)-(-)-), CAS:98625-26-4, Molecular Weight: 356.2965096, C16H15F3N2O4, Purity:98, SMILES: CC1=C([N+]([O-])=O)[C@@H](C2=C(C(F)(F)F)C=CC=C2)C(C(OC)=O)=C(C)N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sitagliptin, CAS:486460-32-6, Molecular Weight: 407.3136, C16H15F6N5O, Purity:98, SMILES: O=C(N1CC2=NN=C(C(F)(F)F)N2CC1)C[C@H](N)CC3=CC(F)=C(F)C=C3F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Urea, N-[3-[5-[(4-fluorophenyl)methyl]-2-thienyl]-1-methyl-2-propyn-1-yl]-N-hydroxy-, CAS:154355-75-6, Molecular Weight: 318.3659032, C16H15FN2O2S, Purity:98, SMILES: O=C(N)N(C(C)C#CC1=CC=C(CC2=CC=C(F)C=C2)S1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-CyclopentapyriMidine-1-acetic acid, 2-[[(4-fluorophenyl)Methyl]thio]-4,5,6,7-tetrahydro-4-oxo-, CAS:356058-42-9, Molecular Weight: 334.365, C16H15FN2O3S, Purity:95, SMILES: OC(=O)Cn1c(SCc2ccc(cc2)F)nc(=O)c2c1CCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pazufloxacin, CAS:127045-41-4, Molecular Weight: 318.2997, C16H15FN2O4, Purity:98, SMILES: O=C(C(C1=O)=CN2[C@@H](C)COC3=C(C4(N)CC4)C(F)=CC1=C23)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2,5-Dimethoxyphenyl-2-(4-FluorophenylEthanone, CAS:1097164-22-1, Molecular Weight: 274.2869, C16H15FO3, Purity:95, SMILES: COC1=CC(C(=O)CC2=CC=C(F)C=C2)=C(OC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| F16, CAS:36098-33-6, Molecular Weight: 362.2082, C16H15IN2, Purity:98, SMILES: C[N+]1=CC=C(/C=C/C2=CNC3=C2C=CC=C3)C=C1.[I-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cephalothin (sodium), CAS:58-71-9, Molecular Weight: 418.4199, C16H15N2NaO6S2, Purity:98, SMILES: O=C(C(N12)=C(COC(C)=O)CS[C@]2([H])[C@H](NC(CC3=CC=CS3)=O)C1=O)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Epinastine, CAS:80012-43-7, Molecular Weight: 249.3104, C16H15N3, Purity:98, SMILES: NC1=NCC2N1C3=CC=CC=C3CC4=CC=CC=C24, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-AMINO-1-METHYL-5-PHENYL-1H-BENZO[E][1,4]DIAZEPIN-2(3H)-ONE, CAS:103421-61-0, Molecular Weight: 265.3098, C16H15N3O, Purity:95, SMILES: CN1c2ccccc2C(=NC(N)C1=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Compound 401, CAS:168425-64-7, Molecular Weight: 281.3092, C16H15N3O2, Purity:98, SMILES: O=C1C=C(N2CCOCC2)N=C3N1C=CC4=C3C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WZ4141R, CAS:, Molecular Weight: 281.3092, C16H15N3O2, Purity:98, SMILES: O=C(CC)NC1=CC(OC2=C3C(NC=C3)=NC=C2)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JANEX-1, CAS:202475-60-3, Molecular Weight: 297.3086, C16H15N3O3, Purity:98, SMILES: OC1=CC=C(NC2=C3C=C(OC)C(OC)=CC3=NC=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WHI-P180, CAS:211555-08-7, Molecular Weight: 297.3086, C16H15N3O3, Purity:98, SMILES: COC1=CC2=NC=NC(NC3=CC=CC(O)=C3)=C2C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tanaproget, CAS:304853-42-7, Molecular Weight: 297.3748, C16H15N3OS, Purity:98, SMILES: N#CC1=CC=C(C2=CC=C(NC(OC3(C)C)=S)C3=C2)N1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefuroxime (sodium), CAS:56238-63-2, Molecular Weight: 446.3671, C16H15N4NaO8S, Purity:98, SMILES: O=C(C(N12)=C(COC(N)=O)CS[C@]2([H])[C@H](NC(/C(C3=CC=CO3)=N\OC)=O)C1=O)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefetrizole, CAS:65307-12-2, Molecular Weight: 437.5164, C16H15N5O4S3, Purity:98, SMILES: OC(C1=C(CSC2=NN=CN2)CS[C@@]([C@@H]3NC(CC4=CC=CS4)=O)([H])N1C3=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefixime, CAS:79350-37-1, Molecular Weight: 453.4496, C16H15N5O7S2, Purity:98, SMILES: O=C(C(N12)=C(C=C)CS[C@]2([H])[C@H](NC(/C(C3=CSC(N)=N3)=N\OCC(O)=O)=O)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vipadenant, CAS:442908-10-3, Molecular Weight: 321.3366, C16H15N7O, Purity:98, SMILES: NC1=NC2=C(N=NN2CC3=CC=C(N)C(C)=C3)C(C4=CC=CO4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZM241385, CAS:139180-30-6, Molecular Weight: 337.336, C16H15N7O2, Purity:98, SMILES: OC1=CC=C(CCNC2=NC3=NC(C4=CC=CO4)=NN3C(N)=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzhydrylazetidin-3-One, CAS:40320-60-3, Molecular Weight: 237.2964, C16H15NO, Purity:95, SMILES: O=C1CN(C1)C(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzhydrylazetidin-3-one, CAS:40320-60-3, Molecular Weight: 237.2964, C16H15NO, Purity:97, SMILES: O=C1CN(C1)C(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(4-Methylphenyl-3-Phenylacrylamide, CAS:134430-88-9, Molecular Weight: 237.2964, C16H15NO, Purity:95, SMILES: CC1=CC=C(NC(=O)\C=C\C2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (5R,6S)-5,6-Diphenyl-2-morpholinone, CAS:282735-66-4, Molecular Weight: 253.2958, C16H15NO2, Purity:97, SMILES: O=C1CN[C@@H]([C@@H](O1)c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (5S,6R)-5,6-Diphenyl-2-morpholinone, CAS:144538-22-7, Molecular Weight: 253.2958, C16H15NO2, Purity:97, SMILES: O=C1CN[C@H]([C@H](O1)c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 2-((diphenylmethylene)amino)acetate, CAS:81167-39-7, Molecular Weight: 253.2958, C16H15NO2, Purity:95, SMILES: COC(=O)CN=C(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| O4I1, CAS:175135-47-4, Molecular Weight: 253.2958, C16H15NO2, Purity:98, SMILES: N#CCC1=CC=C(OCC2=CC=C(OC)C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-amino-3-(4-benzoylphenyl)propanoic acid, CAS:104504-45-2, Molecular Weight: 269.2952, C16H15NO3, Purity:95, SMILES: N[C@@H](Cc1ccc(cc1)C(=O)c1ccccc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ftaxilide, CAS:19368-18-4, Molecular Weight: 269.2952, C16H15NO3, Purity:98, SMILES: O=C(O)C1=CC=CC=C1C(NC2=C(C)C=CC=C2C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| C29, CAS:363600-92-4, Molecular Weight: 285.2946, C16H15NO4, Purity:98, SMILES: OC1=C(/C=N/C2=C(C)C(C(O)=O)=CC=C2)C=CC=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AKR1C3-IN-1, CAS:327092-81-9, Molecular Weight: 317.3596, C16H15NO4S, Purity:98, SMILES: O=S(N1CC2=CC=CC=C2CC1)(C3=CC(C(O)=O)=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl(E)-3-(3-(N-phenylsulfamoyl)phenyl)acrylate, CAS:866323-86-6, Molecular Weight: 317.36, C16H15NO4S, Purity:95, SMILES: COC(=O)\C=C\C1=CC=CC(=C1)S(=O)(=O)NC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-[[4-NITRO-2-(PHENYLMETHOXYPHENOXY]METHYL]OXIRANE, CAS:1064662-53-8, Molecular Weight: 301.294, C16H15NO5, Purity:95, SMILES: [O-][N+](=O)C1=CC=C(OCC2CO2)C(OCC2=CC=CC=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 4-(Benzyloxy-5-Methoxy-2-Nitrobenzoate, CAS:61032-41-5, Molecular Weight: 317.2934, C16H15NO6, Purity:95, SMILES: COC(=O)C1=CC(OC)=C(OCC2=CC=CC=C2)C=C1[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 5-Benzyloxy-4-methoxy-2-nitrobenzoate, CAS:164161-49-3, Molecular Weight: 317.2934, C16H15NO6, Purity:95, SMILES: COC(=O)c1cc(OCc2ccccc2)c(cc1[N+](=O)[O-])OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NSC 74859, CAS:501919-59-1, Molecular Weight: 365.3578, C16H15NO7S, Purity:98, SMILES: OC1=CC(NC(COS(=O)(C2=CC=C(C=C2)C)=O)=O)=CC=C1C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tricyclo[8,2,2,24,7]hexadeca-4,6,1,12,13,15-hexaene, CAS:1633-22-3, Molecular Weight: 208.2982, C16H16, Purity:99, SMILES: C1Cc2ccc(CCc3ccc1cc3)cc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-(Benzyloxy-5-Bromo-3-Methoxypyridin-2-YlMethyl Acetate, CAS:895134-16-4, Molecular Weight: 366.207, C16H16BrNO4, Purity:95, SMILES: COC1=C(COC(C)=O)N=CC(Br)=C1OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dasotraline (hydrochloride), CAS:675126-08-6, Molecular Weight: 328.6639, C16H16Cl3N, Purity:98, SMILES: N[C@@H]1CC[C@@H](C2=CC=C(Cl)C(Cl)=C2)C3=CC=CC=C31.Cl[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| KC7F2, CAS:927822-86-4, Molecular Weight: 570.3812, C16H16Cl4N2O4S4, Purity:98, SMILES: O=S(C1=CC(Cl)=CC=C1Cl)(NCCSSCCNS(C2=CC(Cl)=CC=C2Cl)(=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Chloro-2-Cyclohexyl-3H-Imidazo[4,5-C]Quinoline, CAS:890087-03-3, Molecular Weight: 285.771, C16H16ClN3, Purity:95, SMILES: ClC1=NC2=CC=CC=C2C2=C1NC(=N2)C1CCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 4-Chloro-5,6,8,9-Tetrahydropyrimido[4,5-D]Azepine-7-Carboxylate, CAS:1251001-37-2, Molecular Weight: 317.77, C16H16ClN3O2, Purity:95, SMILES: ClC1=C2CCN(CCC2=NC=N1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WHI-P180 (hydrochloride), CAS:153437-55-9, Molecular Weight: 333.7695, C16H16ClN3O3, Purity:98, SMILES: COC1=CC2=NC=NC(NC3=CC=CC(O)=C3)=C2C=C1OC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Indapamide, CAS:26807-65-8, Molecular Weight: 365.8345, C16H16ClN3O3S, Purity:98, SMILES: O=C(NN1C(C)CC2=C1C=CC=C2)C3=CC=C(Cl)C(S(=O)(N)=O)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Metolazone, CAS:17560-51-9, Molecular Weight: 365.8345, C16H16ClN3O3S, Purity:98, SMILES: O=S(C1=CC2=C(NC(C)N(C3=CC=CC=C3C)C2=O)C=C1Cl)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clopidogrel, CAS:113665-84-2, Molecular Weight: 321.8217, C16H16ClNO2S, Purity:98, SMILES: ClC1=C(C=CC=C1)[C@H](N2CCC3=C(C2)C=CS3)C(OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fenoldopam, CAS:67227-56-9, Molecular Weight: 305.7561, C16H16ClNO3, Purity:98, SMILES: OC1=C(O)C=C2C(C3=CC=C(O)C=C3)CNCCC2=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clopidogrel thiolactone, CAS:1147350-75-1, Molecular Weight: 337.82114, C16H16ClNO3S, Purity:98, SMILES: O=C(OC)[C@@H](N1CCC(S2)C(C1)=CC2=O)C3=C(Cl)C=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PEPA, CAS:141286-78-4, Molecular Weight: 402.436, C16H16F2N2O4S2, Purity:98, SMILES: FC1=CC(SCCNS(C2=CC=CC=C2)(=O)=O)=CC(F)=C1OCC(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CCT245737, CAS:1489389-18-5, Molecular Weight: 379.3397496, C16H16F3N7O, Purity:98, SMILES: FC(F)(F)C(C=NC(NC1=CN=C(C#N)C=N1)=C2)=C2NC[C@H]3CNCCO3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl (1-oxo-1-(2,4,5-trifluorophenyl)pent-4-yn-2-yl)carbamate, CAS:, Molecular Weight: 327.2983, C16H16F3NO3, Purity:95, SMILES: CC(C)(C)OC(=O)NC(CC#C)C(=O)c1cc(F)c(F)cc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,4,7,8-Tetramethyl-1,10-phenanthroline, CAS:1660-93-1, Molecular Weight: 236.3116, C16H16N2, Purity:95, SMILES: CC1=C(C)C2=C(N=C1)C1=C(C=C2)C(C)=C(C)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,4,7,8-Tetramethyl-1,10-phenanthroline, CAS:1660-93-1, Molecular Weight: 236.3116, C16H16N2, Purity:95, SMILES: Cc1c(C)cnc2c1ccc1c2ncc(c1C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| salcomine, CAS:94-93-9, Molecular Weight: 268.3104, C16H16N2O2, Purity:95, SMILES: Oc1ccccc1/C=N/CC/N=C/c1ccccc1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BRD73954, CAS:1440209-96-0, Molecular Weight: 284.3098, C16H16N2O3, Purity:98, SMILES: O=C(C1=CC=CC(C(NCCC2=CC=CC=C2)=O)=C1)NO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(3,5-dimethylphenyl)-2-(4-nitrophenyl)acetamide, CAS:346693-66-1, Molecular Weight: 284.3098, C16H16N2O3, Purity:96, SMILES: O=C(CC1=CC=C([N+]([O-])=O)C=C1)NC2=CC(C)=CC(C)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Febuxostat, CAS:144060-53-7, Molecular Weight: 316.3748, C16H16N2O3S, Purity:98, SMILES: CC(COC1=CC=C(C=C1C#N)C2=NC(C)=C(S2)C(O)=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [2,2'-Bipyridine]-4,4'-dicarboxylic acid, 6,6'-dimethyl-, dimethyl ester, CAS:117330-40-2, Molecular Weight: 300.3092, C16H16N2O4, Purity:95, SMILES: COC(=O)c1cc(C)nc(c1)c1nc(C)cc(c1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(5-(((benzyloxy)carbonyl)amino)pyridin-3-yl)propanoic acid, CAS:, Molecular Weight: 300.3092, C16H16N2O4, Purity:95, SMILES: OC(=O)CCc1cncc(c1)NC(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-allyl-3-(4-phenoxyphenyl)thiourea, CAS:433253-68-0, Molecular Weight: 284.376, C16H16N2OS, Purity:95, SMILES: C=CCNC(=S)Nc1ccc(cc1)Oc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CK-636, CAS:442632-72-6, Molecular Weight: 284.376, C16H16N2OS, Purity:98, SMILES: O=C(C1=CC=CS1)NCCC2=C(C)NC3=C2C=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pifithrin-β, CAS:60477-34-1, Molecular Weight: 268.3766, C16H16N2S, Purity:98, SMILES: CC1=CC=C(C2=CN3C(SC4=C3CCCC4)=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefoxitin (sodium), CAS:33564-30-6, Molecular Weight: 449.4339, C16H16N3NaO7S2, Purity:98, SMILES: O=C(C(N12)=C(COC(N)=O)CS[C@]2([H])[C@@](NC(CC3=CC=CS3)=O)(OC)C1=O)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Stilbamidine, CAS:122-06-5, Molecular Weight: 264.32504, C16H16N4, Purity:98, SMILES: N=C(C1=CC=C(/C=C/C2=CC=C(C(N)=N)C=C2)C=C1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Y-33075, CAS:199433-58-4, Molecular Weight: 280.3244, C16H16N4O, Purity:98, SMILES: O=C(NC1=C2C(NC=C2)=NC=C1)C3=CC=C(C=C3)[C@H](N)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefotaxime (sodium salt), CAS:64485-93-4, Molecular Weight: 477.4473, C16H16N5NaO7S2, Purity:98, SMILES: O=C(C(N12)=C(COC(C)=O)CS[C@]2([H])[C@H](NC(/C(C3=CSC(N)=N3)=N\OC)=O)C1=O)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| CHR-6494, CAS:1333377-65-3, Molecular Weight: 292.3384, C16H16N6, Purity:98, SMILES: CCCNC(C=C1)=NN2C1=NC=C2C3=CC(C=NN4)=C4C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MSX-122, CAS:897657-95-3, Molecular Weight: 292.3384, C16H16N6, Purity:98, SMILES: C1(CNC2=NC=CC=N2)=CC=C(CNC3=NC=CC=N3)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PP 242, CAS:1092351-67-1, Molecular Weight: 308.3378, C16H16N6O, Purity:98, SMILES: NC1=C2C(N(N=C2C3=CC4=C(N3)C=CC(O)=C4)C(C)C)=NC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CC-115, CAS:1228013-15-7, Molecular Weight: 336.3512, C16H16N8O, Purity:98, SMILES: O=C1CN=C2C(N1CC)=NC(C3=C(C)N=C(C4=NN=CN4)C=C3)=CN2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pterostilbene, CAS:537-42-8, Molecular Weight: 256.2964, C16H16O3, Purity:97, SMILES: COc1cc(OC)cc(c1)\C=C\c1ccc(O)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3,4-Dimethoxyphenyl(4-MethoxyphenylMethanone, CAS:2898-54-6, Molecular Weight: 272.2958, C16H16O4, Purity:95, SMILES: COC1=CC=C(C=C1)C(=O)C1=CC(OC)=C(OC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-methoxyphenoxy)-1-(4-methoxyphenyl)ethanone, CAS:19513-80-5, Molecular Weight: 272.2958, C16H16O4, Purity:95, SMILES: COc1ccc(cc1)C(=O)COc1ccccc1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(BENZYLOXY)-3,5-DIMETHOXYBENZALDEHYDE, CAS:6527-32-8, Molecular Weight: 272.2958, C16H16O4, Purity:95, SMILES: COc1cc(C=O)cc(OC)c1OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(Benzyloxy-4-Methoxy-2-Methylbenzoic Acid, CAS:883846-97-7, Molecular Weight: 272.2958, C16H16O4, Purity:95, SMILES: COC1=C(OCC2=CC=CC=C2)C=C(C(O)=O)C(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 2',4'-Dimethoxy-[1,1'-Biphenyl]-4-Carboxylate, CAS:0, Molecular Weight: 272.2958, C16H16O4, Purity:95, SMILES: COC(=O)C1=CC=C(C=C1)C1=C(OC)C=C(OC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Shikonin, CAS:517-89-5, Molecular Weight: 288.2952, C16H16O5, Purity:98, SMILES: O=C1C([C@H](O)C/C=C(C)/C)=CC(C2=C1C(O)=CC=C2O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl 1,4-dihydroxynaphthalene-2,3-dicarboxylate, CAS:59883-07-7, Molecular Weight: 304.2946, C16H16O6, Purity:95, SMILES: CCOC(=O)c1c(C(=O)OCC)c(O)c2c(c1O)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Halofuginone, CAS:55837-20-2, Molecular Weight: 414.6815, C16H17BrClN3O3, Purity:98, SMILES: O=C1N(CC(C[C@@H]2NCCC[C@H]2O)=O)C=NC3=C1C=C(Cl)C(Br)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pifithrin-β (hydrobromide), CAS:511296-88-1, Molecular Weight: 349.2886, C16H17BrN2S, Purity:98, SMILES: CC1=CC=C(C2=CN3C(SC4=C3CCCC4)=N2)C=C1.Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DAPI (dihydrochloride), CAS:28718-90-3, Molecular Weight: 350.24568, C16H17Cl2N5, Purity:98, SMILES: N=C(C1=CC2=C(C=C1)C=C(C3=CC=C(C(N)=N)C=C3)N2)N.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AT7519, CAS:844442-38-2, Molecular Weight: 382.2445, C16H17Cl2N5O2, Purity:98, SMILES: O=C(NC1=CNN=C1C(NC2CCNCC2)=O)C3=C(Cl)C=CC=C3Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Benzyl-2-Chloro-4-Methyl-5,6,7,8-Tetrahydro-1,6-Naphthyridine, CAS:1421309-97-8, Molecular Weight: 272.773, C16H17ClN2, Purity:95, SMILES: CC1=C2CN(CC3=CC=CC=C3)CCC2=NC(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetrazepam, CAS:10379-14-3, Molecular Weight: 288.77198, C16H17ClN2O, Purity:98, SMILES: O=C1N(C)C2=CC=C(Cl)C=C2C(C3=CCCCC3)=NC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| EVP-6124, CAS:550999-75-2, Molecular Weight: 320.837, C16H17ClN2OS, Purity:98, SMILES: O=C(C1=CC2=C(C(Cl)=CC=C2)S1)N[C@H]3CN4CCC3CC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CC-115 (hydrochloride), CAS:1300118-55-1, Molecular Weight: 372.8122, C16H17ClN8O, Purity:98, SMILES: [H]Cl.O=C1CN=C2C(N1CC)=NC(C3=C(C)N=C(C4=NN=CN4)C=C3)=CN2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SDZ 220-581, CAS:174575-17-8, Molecular Weight: 369.736642, C16H17ClNO5P, Purity:98, SMILES: ClC1=CC=CC=C1C2=CC(C[C@@H](C(O)=O)N)=CC(CP(O)(O)=O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bendamustine D4, CAS:, Molecular Weight: 362.2875, C16H17D4Cl2N3O2, Purity:98, SMILES: O=C(O)CCCC1=NC2=CC(N(CCCl)C([2H])([2H])C([2H])([2H])Cl)=CC=C2N1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl [1-(2,5-difluorophenyl)-1-oxopent-4-yn-2-yl]carbamate, CAS:1172623-96-9, Molecular Weight: 309.3079, C16H17F2NO3, Purity:98, SMILES: CC(C)(C)OC(=O)NC(CC#C)C(=O)c1cc(F)ccc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD8330, CAS:869357-68-6, Molecular Weight: 461.2267, C16H17FIN3O4, Purity:98, SMILES: IC1=CC(F)=C(C=C1)NC(N2C)=C(C=C(C2=O)C)C(NOCCO)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-fluoro-N-(4-methoxybenzyl)-7-(methoxymethyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine, CAS:2089291-61-0, Molecular Weight: 316.3302, C16H17FN4O2, Purity:95, SMILES: COCn1cc(F)c2c(NCc3ccc(OC)cc3)ncnc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Penicillin G (potassium), CAS:113-98-4, Molecular Weight: 372.4805, C16H17KN2O4S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC(CC3=CC=CC=C3)=O)N1C2=O)[O-].[K+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Penicillin V (Potassium), CAS:132-98-9, Molecular Weight: 388.4799, C16H17KN2O5S, Purity:98, SMILES: [O-]C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC(COC3=CC=CC=C3)=O)N1C2=O)=O.[K+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| (10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-ylmethanamine, CAS:7351-49-7, Molecular Weight: 223.3129, C16H17N, Purity:95, SMILES: NCC1C2=CC=CC=C2CCC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sulfo-SMCC (sodium), CAS:92921-24-9, Molecular Weight: 436.36894928, C16H17N2NaO9S, Purity:98, SMILES: O=C(C1CCC(CN2C(C=CC2=O)=O)CC1)ON3C(C(S(=O)([O-])=O)CC3=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amonafide, CAS:69408-81-7, Molecular Weight: 283.3251, C16H17N3O2, Purity:98, SMILES: O=C1N(C(C2=CC(N)=CC3=CC=CC1=C23)=O)CCN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Brevianamide F, CAS:38136-70-8, Molecular Weight: 283.3251, C16H17N3O2, Purity:98, SMILES: O=C(N[C@H]1CC2=CNC3=C2C=CC=C3)[C@@](CCC4)([H])N4C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cephalexin, CAS:15686-71-2, Molecular Weight: 347.3889, C16H17N3O4S, Purity:98, SMILES: O=C(C(N12)=C(C)CS[C@]2([H])[C@H](NC([C@H](N)C3=CC=CC=C3)=O)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PFI-1, CAS:1403764-72-6, Molecular Weight: 347.3889, C16H17N3O4S, Purity:98, SMILES: O=S(C1=CC=CC=C1OC)(NC2=CC3=C(NC(N(C)C3)=O)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefadroxil, CAS:50370-12-2, Molecular Weight: 363.3883, C16H17N3O5S, Purity:98, SMILES: O=C(C(N12)=C(C)CS[C@]2([H])[C@H](NC([C@H](N)C3=CC=C(O)C=C3)=O)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Win 58237, CAS:158001-76-4, Molecular Weight: 295.33908, C16H17N5O, Purity:98, SMILES: O=C1C2=C(N(C3CCCC3)N=C2C)NC(C4=CC=NC=C4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Madrasin, CAS:374913-63-0, Molecular Weight: 311.3385, C16H17N5O2, Purity:98, SMILES: O=C1N=C(NC2=NC(C)=C3C=CC(OC)=CC3=N2)NC(C)=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Baricitinib, CAS:1187594-09-7, Molecular Weight: 371.4169, C16H17N7O2S, Purity:98, SMILES: N#CCC1(N2N=CC(C3=C4C(NC=C4)=NC=N3)=C2)CN(S(=O)(CC)=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefmenoxime (hydrochloride), CAS:75738-58-8, Molecular Weight: 529.79, C16H17N9O5S3 . 1/2 HCl, Purity:98, SMILES: O=C(C(N12)=C(CSC3=NN=NN3C)CS[C@]2([H])[C@H](NC(/C(C4=CSC(N)=N4)=N\OC)=O)C1=O)O.[0.5HCl], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzhydrylazetidin-3-ol, CAS:18621-17-5, Molecular Weight: 239.3123, C16H17NO, Purity:98, SMILES: OC1CN(C1)C(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3'-isopropyl-2-methyl-3-nitro-1,1'-biphenyl, CAS:0, Molecular Weight: 255.3117, C16H17NO2, Purity:95, SMILES: CC(C)C1=CC(=CC=C1)C1=C(C)C(=CC=C1)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 2-(4-(AminomethylPhenylAcetate, CAS:175662-70-1, Molecular Weight: 255.3117, C16H17NO2, Purity:95, SMILES: NCC1=CC=C(CC(=O)OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-Amino-4-(benzyloxy)-5-methoxyphenyl)ethanone, CAS:75665-73-5, Molecular Weight: 271.3111, C16H17NO3, Purity:90, SMILES: COc1cc(C(=O)C)c(cc1OCc1ccccc1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Pyrrole-2-carboxylic acid, 1-[(4-methylphenyl)sulfonyl]-4-(1-oxopropyl)-, methyl ester, CAS:1191272-69-1, Molecular Weight: 335.375, C16H17NO5S, Purity:96, SMILES: COC(=O)c1cc(cn1S(=O)(=O)c1ccc(cc1)C)C(=O)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dimethyl 1-benzoyl-5-oxopiperidine-2,4-dicarboxylate, CAS:1255663-98-9, Molecular Weight: 319.3093, C16H17NO6, Purity:95, SMILES: COC(=O)C1CC(C(=O)OC)C(=O)CN1C(=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzene, 1,1'-(1-methyl-1,3-propanediyl)bis-, CAS:1520-44-1, Molecular Weight: 210.3141, C16H18, Purity:95, SMILES: CC(C1=CC=CC=C1)CCC2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,3-Butanediamine, 2,3-bis(4-chlorophenyl)-, (2R,3S)-rel-, CAS:939983-16-1, Molecular Weight: 309.234, C16H18Cl2N2, Purity:90, SMILES: C[C@H]([C@@H](c1ccc(cc1)Cl)C)c1ccc(cc1)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| EVP-6124 (hydrochloride), CAS:550999-74-1, Molecular Weight: 357.2979, C16H18Cl2N2OS, Purity:98, SMILES: O=C(C1=CC2=C(C(Cl)=CC=C2)S1)N[C@H]3CN4CCC3CC4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SDZ 220-581 (hydrochloride), CAS:179411-93-9, Molecular Weight: 406.197582, C16H18Cl2NO5P, Purity:98, SMILES: ClC1=CC=CC=C1C2=CC(C[C@@H](C(O)=O)N)=CC(CP(O)(O)=O)=C2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AT7519 (Hydrochloride), CAS:902135-91-5, Molecular Weight: 418.7054, C16H18Cl3N5O2, Purity:98, SMILES: O=C(C(C(Cl)=CC=C1)=C1Cl)NC2=CNN=C2C(NC3CCNCC3)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cephalexin (hydrochloride), CAS:59695-59-9, Molecular Weight: 383.8498, C16H18ClN3O4S, Purity:98, SMILES: O=C(C(N12)=C(C)CS[C@]2([H])[C@H](NC([C@H](N)C3=CC=CC=C3)=O)C1=O)O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methylene Blue, CAS:61-73-4, Molecular Weight: 319.8522, C16H18ClN3S, Purity:98, SMILES: CN(C)C1=CC=C2C(SC(C(C=C/3)=N2)=CC3=[N+](C)/C)=C1.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9H-Purin-6-amine, 2-chloro-N-[(4-methoxyphenyl)methyl]-9-(1-methylethyl)-, CAS:203436-13-9, Molecular Weight: 331.8, C16H18ClN5O, Purity:95, SMILES: COc1ccc(cc1)CNc1nc(Cl)nc2c1ncn2C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Diphenylmethyl-3-Hydroxyazetidine Hydrochloride, CAS:90604-02-7, Molecular Weight: 275.773, C16H18ClNO, Purity:95, SMILES: Cl.OC1CN(C1)C(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzhydryl-3-azetidinol hydrochloride, CAS:90604-02-7, Molecular Weight: 275.773, C16H18ClNO, Purity:95, SMILES: OC1CN(C1)C(c1ccccc1)c1ccccc1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-[Benzyl(MethylAmino]-2-Phenylacetic Acid Hydrochloride, CAS:0, Molecular Weight: 291.773, C16H18ClNO2, Purity:95, SMILES: Cl.CN(CC1=CC=CC=C1)C(C(O)=O)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| H-Phe-OBzl.HCl, CAS:2462-32-0, Molecular Weight: 291.773, C16H18ClNO2, Purity:97, SMILES: Cl.[H][C@](N)(Cc1ccccc1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SKF 38393 (hydrochloride), CAS:62717-42-4, Molecular Weight: 291.7726, C16H18ClNO2, Purity:98, SMILES: OC1=C(O)C=C2C(C3=CC=CC=C3)CNCCC2=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lycorine (hydrochloride), CAS:2188-68-3, Molecular Weight: 323.7714, C16H18ClNO4, Purity:98, SMILES: O[C@@H]1[C@@H](O)C=C(CC2)[C@@]3([H])N2CC4=C([C@@]31[H])C=C(OCO5)C5=C4.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clopidogrel (hydrogen sulfate), CAS:120202-66-6, Molecular Weight: 419.9002, C16H18ClNO6S2, Purity:98, SMILES: ClC1=C([C@@H](C(OC)=O)N2CCC3=C(C=CS3)C2)C=CC=C1.O=S(O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Carbamic acid, N-[(2R,3S)-tetrahydro-5-oxo-2-(2,4,5-trifluorophenyl)-2H-pyran-3-yl]-, 1,1-dimethylethyl ester, CAS:951127-24-5, Molecular Weight: 345.3136, C16H18F3NO4, Purity:95, SMILES: O=C1CO[C@@H]([C@H](C1)NC(=O)OC(C)(C)C)c1cc(F)c(cc1F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Spiro[Cyclohexane-1,3'-Indoline]-5'-Carboxylicacid Trifluoroacetate, CAS:0, Molecular Weight: 345.3136, C16H18F3NO4, Purity:95, SMILES: OC(=O)C(F)(F)F.OC(=O)C1=CC2=C(NCC22CCCCC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(1-Benzylpiperidin-4-yl)-2,2,2-trifluoroethanone oxalate, CAS:1198286-70-2, Molecular Weight: 361.313, C16H18F3NO5, Purity:95, SMILES: O=C(C(F)(F)F)C1CCN(CC1)Cc1ccccc1.OC(=O)C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sitagliptin (phosphate), CAS:654671-78-0, Molecular Weight: 505.3088, C16H18F6N5O5P, Purity:98, SMILES: O=C(N1CC2=NN=C(C(F)(F)F)N2CC1)C[C@H](N)CC3=CC(F)=C(F)C=C3F.O=P(O)(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Norfloxacin, CAS:70458-96-7, Molecular Weight: 319.3308, C16H18FN3O3, Purity:98, SMILES: O=C(C1=CN(CC)C2=C(C=C(F)C(N3CCNCC3)=C2)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DC260126, CAS:346692-04-4, Molecular Weight: 307.3830232, C16H18FNO2S, Purity:98, SMILES: O=S(C1=CC=C(F)C=C1)(NC2=CC=C(CCCC)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Tert-Butyl 4-Fluoro-8-Oxo-3,3A,8,8A-Tetrahydroindeno[1,2-C]Pyrrole-2(1H-Carboxylate, CAS:1341038-77-4, Molecular Weight: 291.3174, C16H18FNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2[C@@H](C1)C1=C(C=CC=C1F)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Amino-1-diphenylmethylazetidine, CAS:40432-52-8, Molecular Weight: 238.3275, C16H18N2, Purity:97, SMILES: NC1CN(C1)C(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nomifensine, CAS:24526-64-5, Molecular Weight: 238.3275, C16H18N2, Purity:98, SMILES: NC1=CC=CC2=C1CN(C)CC2C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,5S,6r-3-allyl-6-(3-aminophenyl-6-ethyl-3-azabicyclo[3.1.0]hexane-2,4-dione, CAS:0, Molecular Weight: 270.3263, C16H18N2O2, Purity:95, SMILES: CC[C@@]1([C@H]2[C@@H]1C(=O)N(CC=C)C2=O)C1=CC=CC(N)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ciproxifan, CAS:184025-18-1, Molecular Weight: 270.3263, C16H18N2O2, Purity:98, SMILES: O=C(C1CC1)C(C=C2)=CC=C2OCCCC3=CN=CN3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dimethylenastron, CAS:863774-58-7, Molecular Weight: 302.3913, C16H18N2O2S, Purity:98, SMILES: O=C1C2=C(NC(NC2C3=CC=CC(O)=C3)=S)CC(C)(C)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Levcromakalim, CAS:94535-50-9, Molecular Weight: 286.32572, C16H18N2O3, Purity:98, SMILES: CC(O1)(C)[C@@H](O)[C@H](N2CCCC2=O)C3=C1C=CC(C#N)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sulfaproxiline, CAS:116-42-7, Molecular Weight: 334.39012, C16H18N2O4S, Purity:98, SMILES: O=C(NS(=O)(C1=CC=C(N)C=C1)=O)C2=CC=C(OC(C)C)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(biphenyl-4-yl)-3-propylthiourea, CAS:851904-80-8, Molecular Weight: 270.393, C16H18N2S, Purity:95, SMILES: CCCNC(=S)Nc1ccc(cc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ampicillin (sodium), CAS:69-52-3, Molecular Weight: 371.3866, C16H18N3NaO4S, Purity:98, SMILES: [O-]C([C@@H]1N(C2=O)[C@]([C@@H]2NC([C@@H](C3=CC=CC=C3)N)=O)([H])SC1(C)C)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amoxicillin (sodium), CAS:34642-77-8, Molecular Weight: 387.386, C16H18N3NaO5S, Purity:98, SMILES: [O-]C([C@@H]1N(C2=O)[C@]([C@@H]2NC([C@@H](C3=CC=C(O)C=C3)N)=O)([H])SC1(C)C)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(indan-2-yl)-5,6,7,8-tetrahydropyrido[4,3-d]pyrimidin-2-amine, CAS:1619971-57-1, Molecular Weight: 266.3409, C16H18N4, Purity:95, SMILES: C1C(Cc2ccccc12)Nc1ncc2CNCCc2n1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tenatoprazole sodium, CAS:335299-59-7, Molecular Weight: 369.39388928, C16H18N4NaO3S, Purity:98, SMILES: CC(C(OC)=C(C)C=N1)=C1CS(C2=NC3=NC(OC)=CC=C3N2)=O.[Na], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nialamide, CAS:51-12-7, Molecular Weight: 298.3397, C16H18N4O2, Purity:98, SMILES: O=C(C1=CC=NC=C1)NNCCC(NCC2=CC=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SGC707, CAS:1687736-54-4, Molecular Weight: 298.3397, C16H18N4O2, Purity:98, SMILES: O=C(NCC(N1CCCC1)=O)NC2=CC=C3C=NC=CC3=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KP136, CAS:76239-32-2, Molecular Weight: 314.33912, C16H18N4O3, Purity:98, SMILES: O=C1C(C2=NNN=N2)=CC3=CC=CC(OCCCCCC)=C3O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrido[2,3-d]pyrimidin-7(8H)-one, 2-amino-8-cyclopentyl-4-methyl-6-(1H-pyrazol-4-yl)-, CAS:1013098-90-2, Molecular Weight: 310.35372, C16H18N6O, Purity:98, SMILES: O=C1C(C2=CNN=C2)=CC3=C(C)N=C(N)N=C3N1C4CCCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TYK2-IN-2, CAS:2098466-94-3, Molecular Weight: 310.35372, C16H18N6O, Purity:98, SMILES: CNC1=CC(NC2=CC(C)=CC(C)=C2)=NN3C1=NC=C3C(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3aR,6aR-tetramethyl 2,5-dihydroxy-1,3a,4,6a-tetrahydropentalene-1,3,4,6-tetracarboxylate, CAS:0, Molecular Weight: 370.3081, C16H18O10, Purity:95, SMILES: COC(=O)C1[C@H]2[C@H](C(C(=O)OC)C(O)=C2C(=O)OC)C(C(=O)OC)=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cimifugin, CAS:37921-38-3, Molecular Weight: 306.3105, C16H18O6, Purity:98, SMILES: O=C1C=C(CO)OC2=CC(O[C@H](C(C)(O)C)C3)=C3C(OC)=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chlorogenic acid, CAS:327-97-9, Molecular Weight: 354.3087, C16H18O9, Purity:98, SMILES: O=C([C@@]1(O)C[C@@H](OC(/C=C/C2=CC=C(O)C(O)=C2)=O)[C@H](O)[C@H](O)C1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cryptochlorogenic acid, CAS:905-99-7, Molecular Weight: 354.3087, C16H18O9, Purity:98, SMILES: O=C(/C=C/C1=CC(O)=C(O)C=C1)O[C@@H]([C@@H]2O)[C@@H](C[C@](C(O)=O)(O)C2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Neochlorogenic acid, CAS:906-33-2, Molecular Weight: 354.3087, C16H18O9, Purity:98, SMILES: O=C([C@]1(O)C[C@@H](OC(/C=C/C2=CC=C(O)C(O)=C2)=O)[C@@H](O)[C@H](O)C1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-fluoro-5-(2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzonitrile, CAS:, Molecular Weight: 287.137, C16H19BFNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1CC1c1cc(F)cc(c1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2H-Pyrido[3,4-b]indole-2-carboxylic acid, 6-bromo-1,3,4,9-tetrahydro-, 1,1-dimethylethyl ester, CAS:1173155-59-3, Molecular Weight: 351.238, C16H19BrN2O2, Purity:99, SMILES: CC(C)(C)OC(=O)N1CCc2c(C1)[nH]c1ccc(Br)cc21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pifithrin-α (hydrobromide), CAS:63208-82-2, Molecular Weight: 367.3039, C16H19BrN2OS, Purity:98, SMILES: N=C1SC2=C(CCCC2)N1CC(C3=CC=C(C)C=C3)=O.[H]Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DG5128, CAS:79689-25-1, Molecular Weight: 324.24816, C16H19Cl2N3, Purity:98, SMILES: C(C1=CC=CC=C1)(C2=CC=CC=N2)CC3=NCCN3.[2 HCl], HPLC, NMR, LCMS is ok, stock more than 10g. |
| CNS-5161 (hydrochloride), CAS:160756-38-7, Molecular Weight: 388.37816, C16H19Cl2N3S2, Purity:98, SMILES: N=C(NC1=CC(SC)=CC=C1Cl)N(C)C2=CC=CC(SC)=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SHP099, CAS:1801747-42-1, Molecular Weight: 352.2616, C16H19Cl2N5, Purity:98, SMILES: NC1=NC(N2CCC(C)(N)CC2)=CN=C1C3=CC=CC(Cl)=C3Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Norfloxacin (hydrochloride), CAS:68077-27-0, Molecular Weight: 355.7917, C16H19ClFN3O3, Purity:98, SMILES: O=C(C1=CN(CC)C2=C(C=C(F)C(N3CCNCC3)=C2)C1=O)O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NG 52, CAS:212779-48-1, Molecular Weight: 346.8147, C16H19ClN6O, Purity:98, SMILES: ClC1=CC(NC2=NC(NCCO)=NC3=C2N=CN3C(C)C)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bucloxic acid, CAS:32808-51-8, Molecular Weight: 294.77326, C16H19ClO3, Purity:98, SMILES: O=C(O)CCC(C1=CC=C(C2CCCCC2)C(Cl)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyldiphenylsilyl chloride, CAS:58479-61-1, Molecular Weight: 274.861, C16H19ClSi, Purity:98, SMILES: CC(C)(C)[Si](Cl)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PNU288034, CAS:383199-88-0, Molecular Weight: 403.4009664, C16H19F2N3O5S, Purity:98, SMILES: CC(NC[C@H]1CN(C2=CC(F)=C(N3CCS(CC3)(=O)=O)C(F)=C2)C(O1)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 2-(1-benzyl-3,3-difluoropiperidin-4-ylidene)acetate, CAS:1373510-82-7, Molecular Weight: 295.3244, C16H19F2NO2, Purity:95, SMILES: CCOC(=O)/C=C\1/CCN(CC1(F)F)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-butyl ((2R,3S)-2-(2,5-difluorophenyl)-3,4-dihydro-2H-pyran-3-yl)carbamate, CAS:1172623-98-1, Molecular Weight: 311.3238, C16H19F2NO3, Purity:98, SMILES: CC(C)(C)OC(=O)N[C@H]1CC=CO[C@@H]1c1cc(F)ccc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl ((2R,3S)-2-(2,5-difluorophenyl)-5-oxotetrahydro-2H-pyran-3-yl)carbamate, CAS:951127-25-6, Molecular Weight: 327.3232, C16H19F2NO4, Purity:96, SMILES: CC(C)(C)OC(=O)N[C@H]1CC(=O)CO[C@@H]1c1cc(F)ccc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JTE522, CAS:180200-68-4, Molecular Weight: 338.3970632, C16H19FN2O3S, Purity:98, SMILES: O=S(C1=CC=C(C2=C(C3CCCCC3)N=C(C)O2)C=C1F)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CMI977, CAS:175212-04-1, Molecular Weight: 322.3314632, C16H19FN2O4, Purity:98, SMILES: O=C(N)N(CCC#C[C@H]1O[C@H](COC2=CC=C(F)C=C2)CC1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-AMINO-1-METHYLETHYL)-N-(4-FLUOROBENZYL)-5-HYDROXY-1-METHYL-6-OXO-1,6-DIHYDROPYRIMIDINE-4-CARBOXAMIDE, CAS:518048-03-8, Molecular Weight: 334.3455, C16H19FN4O3, Purity:95, SMILES: Cn1c(nc(C(=O)NCc2ccc(F)cc2)c(O)c1=O)C(C)(C)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Win49375, CAS:86393-37-5, Molecular Weight: 334.3454632, C16H19FN4O3, Purity:98, SMILES: O=C(C1=CN(NC)C2=C(C=C(F)C(N3CCN(C)CC3)=C2)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NSC 31924, CAS:6319-84-2, Molecular Weight: 225.32876, C16H19N, Purity:98, SMILES: CN(C)C(C1=CC=CC=C1)CC2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-(4-aminophenyl)piperazin-1-yl)phenol, CAS:74853-08-0, Molecular Weight: 269.3416, C16H19N3O, Purity:95, SMILES: Nc1ccc(cc1)N1CCN(CC1)c1ccc(O)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ampicillin, CAS:69-53-4, Molecular Weight: 349.4048, C16H19N3O4S, Purity:98, SMILES: OC([C@@H]1N(C2=O)[C@]([C@@H]2NC([C@@H](C3=CC=CC=C3)N)=O)([H])SC1(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefradine, CAS:38821-53-3, Molecular Weight: 349.4048, C16H19N3O4S, Purity:98, SMILES: O=C(C(N12)=C(C)CS[C@]2([H])[C@H](NC([C@H](N)C3=CCC=CC3)=O)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Resminostat, CAS:864814-88-0, Molecular Weight: 349.4048, C16H19N3O4S, Purity:98, SMILES: O=C(NO)/C=C/C1=CN(S(=O)(C2=CC=C(CN(C)C)C=C2)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oglufanide, CAS:38101-59-6, Molecular Weight: 333.3392, C16H19N3O5, Purity:98, SMILES: O=C(O)[C@H](CC1=CNC2=CC=CC=C12)NC([C@H](CCC(O)=O)N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amoxicillin, CAS:26787-78-0, Molecular Weight: 365.4042, C16H19N3O5S, Purity:98, SMILES: OC([C@@H]1N(C2=O)[C@]([C@@H]2NC([C@@H](C3=CC=C(O)C=C3)N)=O)([H])SC1(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cephalexin (monohydrate), CAS:23325-78-2, Molecular Weight: 365.4042, C16H19N3O5S, Purity:98, SMILES: O=C(C(N12)=C(C)CS[C@]2([H])[C@H](NC([C@H](N)C3=CC=CC=C3)=O)C1=O)O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PP1, CAS:172889-26-8, Molecular Weight: 281.3556, C16H19N5, Purity:98, SMILES: NC1=C2C(N(C(C)(C)C)N=C2C3=CC=C(C)C=C3)=NC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2OH-BNPP1, CAS:833481-73-5, Molecular Weight: 297.35496, C16H19N5O, Purity:98, SMILES: OC1=CC=CC=C1CC2=NN(C(C)(C)C)C3=NC=NC(N)=C32, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pipofezine, CAS:24886-52-0, Molecular Weight: 297.355, C16H19N5O, Purity:95, SMILES: CN1CCN(CC1)c1nnc2c(c1)N(C)c1c(O2)cccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AKT Kinase Inhibitor, CAS:842148-40-7, Molecular Weight: 357.3672, C16H19N7O3, Purity:98, SMILES: OCC#CC1=NC=C(C2=C1N=C(N2CC)C3=NON=C3N)OCCCN, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bis(4-methoxybenzyl)amine, CAS:17061-62-0, Molecular Weight: 257.3276, C16H19NO2, Purity:97, SMILES: COc1ccc(cc1)CNCc1ccc(cc1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Tert-Butyl8-Oxo-3,3A,8,8A-Tetrahydroindeno[2,1-C]Pyrrole-2(1H-Carboxylate, CAS:1251003-85-6, Molecular Weight: 273.327, C16H19NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2[C@@H](C1)C1=CC=CC=C1C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK137647A, CAS:349085-82-1, Molecular Weight: 305.392, C16H19NO3S, Purity:98, SMILES: O=S(C1=CC=C(OC)C=C1)(NC2=C(C)C=C(C)C=C2C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-formyl-5-methoxy-7-methyl-1H-indole-1-carboxylate, CAS:1481631-51-9, Molecular Weight: 289.3264, C16H19NO4, Purity:95, SMILES: O=C(N1C=CC2=C1C(C)=CC(OC)=C2C=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl 2-(((4-(MethoxycarbonylPhenylAminoMethyleneMalonate, CAS:303120-71-0, Molecular Weight: 321.3252, C16H19NO6, Purity:95, SMILES: CCOC(=O)C(=CNC1=CC=C(C=C1)C(=O)OC)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-tetramethyl-2-((1R,2R)-2-(2-(trifluoromethyl)phenyl)cyclopropyl)-1,3,2-dioxaborolane, CAS:, Molecular Weight: 312.135, C16H20BF3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)[C@@H]1C[C@H]1c1ccccc1C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-tetramethyl-2-((1R,2R)-2-(3-(trifluoromethyl)phenyl)cyclopropyl)-1,3,2-dioxaborolane, CAS:, Molecular Weight: 312.135, C16H20BF3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)[C@@H]1C[C@H]1c1cccc(c1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-tetramethyl-2-((1R,2R)-2-(4-(trifluoromethyl)phenyl)cyclopropyl)-1,3,2-dioxaborolane, CAS:, Molecular Weight: 312.135, C16H20BF3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)[C@@H]1C[C@H]1c1ccc(cc1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-tetramethyl-2-(1-(2-(trifluoromethyl)phenyl)cyclopropyl)-1,3,2-dioxaborolane, CAS:, Molecular Weight: 312.135, C16H20BF3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1(CC1)c1ccccc1C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-tetramethyl-2-(1-(3-(trifluoromethyl)phenyl)cyclopropyl)-1,3,2-dioxaborolane, CAS:, Molecular Weight: 312.135, C16H20BF3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1(CC1)c1cccc(c1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4,5,5-tetramethyl-2-(1-(4-(trifluoromethyl)phenyl)cyclopropyl)-1,3,2-dioxaborolane, CAS:, Molecular Weight: 312.135, C16H20BF3O2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1(CC1)c1ccc(cc1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-[4-(4,4,5,5-TetraMethyl-[1,3,2]dioxaborolan-2-yl)-phenyl]-cyclopropanecarbonitrile, CAS:1206641-31-7, Molecular Weight: 269.147, C16H20BNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=C(C=C1)C1(CC1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Imidodicarbonic acid, 2-(2-bromo-4-fluoro-6-nitrophenyl)-, 1,3-bis(1,1-dimethylethyl) ester, CAS:880384-52-1, Molecular Weight: 435.242, C16H20BrFN2O6, Purity:90, SMILES: CC(C)(C)OC(=O)N(C(=O)OC(C)(C)C)c1c(Br)cc(F)cc1N(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Benzyl 2-(BromomethylHexahydrofuro[2,3-C]Pyridine-6(2H-Carboxylate, CAS:354155-03-6, Molecular Weight: 354.239, C16H20BrNO3, Purity:95, SMILES: BrCC1C[C@@H]2CCN(C[C@@H]2O1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-Benzyl 2-(BromomethylHexahydrofuro[2,3-C]Pyridine-6(2H-Carboxylate, CAS:354154-95-3, Molecular Weight: 354.239, C16H20BrNO3, Purity:95, SMILES: BrCC1C[C@H]2CCN(C[C@@H]2O1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SHP099 (hydrochloride), CAS:1801747-11-4, Molecular Weight: 388.7225, C16H20Cl3N5, Purity:98, SMILES: NC1=NC(N2CCC(C)(N)CC2)=CN=C1C3=CC=CC(Cl)=C3Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SDZ 220-581 (Ammonium salt), CAS:179411-94-0, Molecular Weight: 386.767162, C16H20ClN2O5P, Purity:98, SMILES: ClC1=CC=CC=C1C2=CC(C[C@@H](C(O)=O)N)=CC(CP(O)(O)=O)=C2.N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BVT-14225, CAS:376638-65-2, Molecular Weight: 401.9313, C16H20ClN3O3S2, Purity:98, SMILES: O=C(N(CC)CC)CC1=CSC(NS(=O)(C2=CC=CC(Cl)=C2C)=O)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Resminostat (hydrochloride), CAS:1187075-34-8, Molecular Weight: 385.8657, C16H20ClN3O4S, Purity:98, SMILES: O=C(NO)/C=C/C1=CN(S(=O)(C2=CC=C(CN(C)C)C=C2)=O)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-(2-Chloro-4-NitrobenzoylPiperazine-1-Carboxylate, CAS:927608-11-5, Molecular Weight: 369.8, C16H20ClN3O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC1)C(=O)C1=C(Cl)C=C(C=C1)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mebeverine acid D5, CAS:, Molecular Weight: 284.4054, C16H20D5NO3, Purity:98, SMILES: CC(N(C([2H])([2H])C([2H])([2H])[2H])CCCC(O)=O)CC1=CC=C(OC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TPPU, CAS:1222780-33-7, Molecular Weight: 359.3435096, C16H20F3N3O3, Purity:98, SMILES: O=C(NC1=CC=C(OC(F)(F)F)C=C1)NC2CCN(C(CC)=O)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Penthiopyrad, CAS:183675-82-3, Molecular Weight: 359.4097, C16H20F3N3OS, Purity:98, SMILES: O=C(C1=CN(C)N=C1C(F)(F)F)NC2=C(C(C)CC(C)C)SC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-methyl 2-((tert-butoxycarbonylamino-3-(4-(((trifluoromethylsulfonyloxyphenylpropanoate, CAS:0, Molecular Weight: 427.393, C16H20F3NO7S, Purity:95, SMILES: COC(=O)[C@H](CC1=CC=C(OS(=O)(=O)C(F)(F)F)C=C1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sitagliptin (phosphate monohydrate), CAS:654671-77-9, Molecular Weight: 523.3241, C16H20F6N5O6P, Purity:98, SMILES: [H]O[H].O=C(N1CC2=NN=C(C(F)(F)F)N2CC1)C[C@H](N)CC3=CC(F)=C(F)C=C3F.O=P(O)(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-N-((3-(3-fluoro-4-thiomorpholinophenyl-2-oxooxazolidin-5-ylmethylacetamide, CAS:168828-58-8, Molecular Weight: 353.412, C16H20FN3O3S, Purity:95, SMILES: CC(=O)NC[C@H]1CN(C(=O)O1)C1=CC(F)=C(C=C1)N1CCSCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sutezolid, CAS:168828-58-8, Molecular Weight: 353.4117, C16H20FN3O3S, Purity:98, SMILES: O=C(O[C@H]1CNC(C)=O)N(C1)C2=CC(F)=C(N3CCSCC3)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-N-((3-(3-Fluoro-4-morpholinophenyl)-2-oxooxazolidin-5-yl)methyl)acetamide, CAS:165800-03-3, Molecular Weight: 337.3461, C16H20FN3O4, Purity:95, SMILES: CC(=O)NC[C@H]1CN(C(=O)O1)c1ccc(N2CCOCC2)c(F)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl 3-ethyl 5-fluoropiperidine-1,3-dicarboxylate, CAS:, Molecular Weight: 309.3327, C16H20FNO4, Purity:95, SMILES: CCOC(=O)C1CC(F)CN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JSH-23, CAS:749886-87-1, Molecular Weight: 240.3434, C16H20N2, Purity:98, SMILES: NC1=CC(C)=CC=C1NCCCC2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TMB, CAS:54827-17-7, Molecular Weight: 240.3434, C16H20N2, Purity:98, SMILES: NC1=C(C)C=C(C2=CC(C)=C(N)C(C)=C2)C=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TMB (dihydrochloride), CAS:64285-73-0, Molecular Weight: 240.3434, C16H20N2, Purity:98, SMILES: NC1=C(C)C=C(C2=CC(C)=C(N)C(C)=C2)C=C1C.[2HCl], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9-Benzyl-3,9-Diazaspiro[5.5]Undecane-2,4-Dione, CAS:189333-48-0, Molecular Weight: 272.3422, C16H20N2O2, Purity:95, SMILES: O=C1CC2(CCN(CC3=CC=CC=C3)CC2)CC(=O)N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ST271, CAS:106392-48-7, Molecular Weight: 272.3422, C16H20N2O2, Purity:98, SMILES: O=C(N)/C(C#N)=C/C1=CC(C(C)C)=C(O)C(C(C)C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TERT-BUTYL 3,4-DIHYDRO-1H-PYRIDO[3,4-B]INDOLE-2(9H)-CARBOXYLATE, CAS:168824-94-0, Molecular Weight: 272.3422, C16H20N2O2, Purity:95, SMILES: O=C(N1CCc2c(C1)[nH]c1c2cccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 3,4-Dihydro-1H-Pyrido[3,4-B]Indole-2(9H-Carboxylate, CAS:168824-94-0, Molecular Weight: 272.3422, C16H20N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=C(C1)NC1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl N-[1-(4-cyanophenyl)cyclobutyl]carbamate, CAS:1032349-97-5, Molecular Weight: 272.3422, C16H20N2O2, Purity:95, SMILES: N#Cc1ccc(cc1)C1(CCC1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2-Oxospiro[Indoline-3,3'-Pyrrolidine]-1'-Carboxylate, CAS:205383-87-5, Molecular Weight: 288.3416, C16H20N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)C(=O)NC1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N(alpha)-Boc-D-tryptophan, CAS:5241-64-5, Molecular Weight: 304.341, C16H20N2O4, Purity:98, SMILES: O=C(OC(C)(C)C)N[C@@H](C(=O)O)Cc1c[nH]c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Boc-L-Tryptophan, CAS:13139-14-5, Molecular Weight: 304.341, C16H20N2O4, Purity:98, SMILES: O=C(OC(C)(C)C)N[C@H](C(=O)O)Cc1c[nH]c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N,N'-Bis(Toluenesulfonyl-1,2-Ethylenediamine, CAS:4403-78-5, Molecular Weight: 368.471, C16H20N2O4S2, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)NCCNS(=O)(=O)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrithioxin, CAS:1098-97-1, Molecular Weight: 368.471, C16H20N2O4S2, Purity:98, SMILES: OCC1=C(CSSCC2=C(CO)C(O)=C(C)N=C2)C=NC(C)=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Oxo-1,8-Dioxa-4,11-Diaza-Spiro[5.6]Dodecane-11-Carboxylic Acid Benzyl Ester, CAS:1251020-98-0, Molecular Weight: 320.3404, C16H20N2O5, Purity:95, SMILES: O=C(OCC1=CC=CC=C1)N1CCOCC2(CNC(=O)CO2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BIA 10-2474, CAS:1233855-46-3, Molecular Weight: 300.3556, C16H20N4O2, Purity:98, SMILES: O=C(N1C=C(C2=C[N+]([O-])=CC=C2)N=C1)N(C3CCCCC3)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Torsemide, CAS:56211-40-6, Molecular Weight: 348.42, C16H20N4O3S, Purity:98, SMILES: O=S(C1=C(NC2=CC=CC(C)=C2)C=CN=C1)(NC(NC(C)C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3R,4S)-Tofacitinib, CAS:1092578-46-5, Molecular Weight: 312.3696, C16H20N6O, Purity:98, SMILES: CN(C1=NC=NC2=C1C=CN2)[C@@H]3[C@@H](C)CCN(C(CC#N)=O)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3S,4R)-Tofacitinib, CAS:1092578-48-7, Molecular Weight: 312.3696, C16H20N6O, Purity:98, SMILES: CN(C1=NC=NC2=C1C=CN2)[C@H]3[C@H](C)CCN(C(CC#N)=O)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3S,4S)-Tofacitinib, CAS:1092578-47-6, Molecular Weight: 312.3696, C16H20N6O, Purity:98, SMILES: CN(C1=NC=NC2=C1C=CN2)[C@H]3[C@@H](C)CCN(C(CC#N)=O)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Baricitinib (phosphate), CAS:1187595-84-1, Molecular Weight: 469.412, C16H20N7O6PS, Purity:98, SMILES: N#CCC1(N2N=CC(C3=C4C(NC=C4)=NC=N3)=C2)CN(S(=O)(CC)=O)C1.O=P(O)(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acetic acid, 2-(4-phenylcyclohexylidene)-, ethyl ester, CAS:115880-04-1, Molecular Weight: 244.3288, C16H20O2, Purity:95, SMILES: CCOC(=O)C=C1CCC(CC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-3-(3-(cyclopentyloxy-4-methoxyphenyl-2-methylacrylic acid, CAS:168169-98-0, Molecular Weight: 276.3276, C16H20O4, Purity:95, SMILES: COC1=CC=C(C=C1OC1CCCC1)\C=C(/C)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ((3aR,5R,6S,6aR-6-Hydroxy-2,2-Dimethyltetrahydrofuro[2,3-D][1,3]Dioxol-5-YlMethyl 4-Methylbenzoate, CAS:75096-60-5, Molecular Weight: 308.3264, C16H20O6, Purity:95, SMILES: CC1=CC=C(C=C1)C(=O)OC[C@H]1O[C@@H]2OC(C)(C)O[C@@H]2[C@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Temephos, CAS:3383-96-8, Molecular Weight: 466.4689, C16H20O6P2S3, Purity:98, SMILES: COP(OC(C=C1)=CC=C1SC2=CC=C(OP(OC)(OC)=S)C=C2)(OC)=S, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,5-Bis(methoxycarbonyl)benzeneboronic acid pinacol ester, CAS:944392-68-1, Molecular Weight: 320.145, C16H21BO6, Purity:95, SMILES: COC(=O)c1cc(cc(c1)C(=O)OC)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| UNC-926, CAS:1184136-10-4, Molecular Weight: 337.2547, C16H21BrN2O, Purity:98, SMILES: O=C(C1=CC=CC(Br)=C1)N2CCC(N3CCCC3)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Tert-Butyl 8-Bromo-3,4,4A,5-Tetrahydro-1H-Pyrido[4,3-B]Indole-2(9Bh-Carboxylate, CAS:1251021-97-2, Molecular Weight: 353.254, C16H21BrN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC[C@@H]2NC3=C(C=C(Br)C=C3)[C@@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PDE1-IN-2, CAS:1904611-63-7, Molecular Weight: 381.26754, C16H21BrN4O2, Purity:98, SMILES: O=C1C2=NN=C(C3CCOCC3)N2C=C(Br)N1CC4CCCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-(6-Bromo-[1,2,4]Triazolo[1,5-A]Pyridin-2-YlPiperidine-1-Carboxylate, CAS:1422344-42-0, Molecular Weight: 381.268, C16H21BrN4O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C1=NN2C=C(Br)C=CC2=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Azaphen, CAS:24853-80-3, Molecular Weight: 370.2768, C16H21Cl2N5O, Purity:98, SMILES: [H]Cl.[H]Cl.CN1C2=CC=CC=C2OC3=C1C=C(N4CCN(C)CC4)N=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl4-(4-Chloro-3Ah-Imidazo[4,5-C]Pyridin-6-YlPiperidine-1-Carboxylate, CAS:1251021-83-6, Molecular Weight: 336.817, C16H21ClN4O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C1=CC2=C(NC=N2)C(Cl)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,4-Benzodioxin-5-carboxamide, 8-amino-7-chloro-N-[(2S)-1,4-diazabicyclo[2.2.2]oct-2-ylmethyl]-2,3-dihydro-, CAS:186348-68-5, Molecular Weight: 352.81594, C16H21ClN4O3, Purity:98, SMILES: O=C(C1=C2OCCOC2=C(N)C(Cl)=C1)NC[C@@H]3N(CC4)CCN4C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Piperidinecarboxylic acid, 4-(2,3-difluorophenyl)-4-hydroxy-, 1,1-dimethylethyl ester, CAS:1628430-28-3, Molecular Weight: 313.3396, C16H21F2NO3, Purity:94, SMILES: CC(C)(C)OC(=O)N1CCC(O)(CC1)c1cccc(F)c1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(Benzyloxy)-3,3-difluoropyrrolidine-1-carboxylate, CAS:, Molecular Weight: 313.3396, C16H21F2NO3, Purity:95, SMILES: O=C(N1CC(C(C1)(F)F)OCc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 3-(benzyl(2-ethoxy-2-oxoethyl)amino)-2,2-difluoropropanoate, CAS:, Molecular Weight: 329.339, C16H21F2NO4, Purity:95, SMILES: CCOC(=O)CN(CC(C(=O)OCC)(F)F)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Deriglidole, CAS:122830-14-2, Molecular Weight: 255.35804, C16H21N3, Purity:98, SMILES: CCCC1(C2=NCCN2)N3C4=C(C=CC=C4CC3)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Zolmitriptan, CAS:139264-17-8, Molecular Weight: 287.3568, C16H21N3O2, Purity:98, SMILES: O=C1OC[C@H](CC2=CC3=C(NC=C3CCN(C)C)C=C2)N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| H-1152, CAS:451462-58-1, Molecular Weight: 319.4218, C16H21N3O2S, Purity:98, SMILES: CC1=CN=CC2=C1C(S(=O)(N3[C@@H](C)CNCCC3)=O)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bamaquimast, CAS:135779-82-7, Molecular Weight: 303.35624, C16H21N3O3, Purity:98, SMILES: O=C1N(CCC)C2=C(C=CC=C2)N=C1CCCOC(NC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tebipenem, CAS:161715-21-5, Molecular Weight: 383.4856, C16H21N3O4S2, Purity:98, SMILES: O=C(C(N1C2=O)=C(SC3CN(C4=NCCS4)C3)[C@H](C)[C@]1([H])[C@@]2([H])[C@H](O)C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GP531, CAS:142344-87-4, Molecular Weight: 347.36904, C16H21N5O4, Purity:98, SMILES: O=C(C1=C(N)N([C@H]2[C@@H]([C@@H]([C@@H](CNCC3=CC=CC=C3)O2)O)O)C=N1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,5S,8r-methyl 3-benzyl-3-azabicyclo[3.2.1]octane-8-carboxylate, CAS:0, Molecular Weight: 259.3434, C16H21NO2, Purity:95, SMILES: COC(=O)C1C2CCC1CN(CC1=CC=CC=C1)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Anti-2-benzyl-2-azabicyclo[2.2.1]heptane-7-carboxylic acid ethyl ester rac, CAS:745836-32-2, Molecular Weight: 259.3434, C16H21NO2, Purity:95, SMILES: CCOC(=O)[C@@H]1[C@@H]2CC[C@H]1N(C2)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ETHYL (1-BENZYLPIPERIDIN-4-YLIDENE)ACETATE, CAS:40110-55-2, Molecular Weight: 259.3434, C16H21NO2, Purity:95, SMILES: CCOC(=O)C=C1CCN(CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 2-(1-benzyl-4-piperidinylidene)acetate, CAS:40110-55-2, Molecular Weight: 259.3434, C16H21NO2, Purity:95, SMILES: CCOC(=O)C=C1CCN(CC1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ramelteon, CAS:196597-26-9, Molecular Weight: 259.3434, C16H21NO2, Purity:98, SMILES: O=C(NCC[C@H]1C2=C(C=CC3=C2CCO3)CC1)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-phenyl-5,6-dihydropyridine-1(2H)-carboxylate, CAS:186347-72-8, Molecular Weight: 259.3434, C16H21NO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(=CC1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-(-)-Rolipram, CAS:85416-75-7, Molecular Weight: 275.3428, C16H21NO3, Purity:98, SMILES: O=C1NC[C@@H](C2=CC=C(OC)C(OC3CCCC3)=C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-(+)-Rolipram, CAS:85416-73-5, Molecular Weight: 275.3428, C16H21NO3, Purity:98, SMILES: O=C1NC[C@H](C2=CC=C(OC)C(OC3CCCC3)=C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Boc-2-Phenyl-4-piperidinone, CAS:849928-30-9, Molecular Weight: 275.3428, C16H21NO3, Purity:97, SMILES: CC(C)(C)OC(=O)N1CCC(=O)CC1c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Boc-6-Acetyl-1,2,3,4-Tetrahydroisoquinoline, CAS:1008518-35-1, Molecular Weight: 275.3428, C16H21NO3, Purity:95, SMILES: CC(=O)C1=CC=C2CN(CCC2=C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rolipram, CAS:61413-54-5, Molecular Weight: 275.3428, C16H21NO3, Purity:98, SMILES: O=C1NCC(C2=CC=C(OC)C(OC3CCCC3)=C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| benzyl 4-((Acetylthio)methyl)piperidine-1-carboxylate, CAS:1355455-38-7, Molecular Weight: 307.408, C16H21NO3S, Purity:95, SMILES: O=C(N1CCC(CC1)CSC(=O)C)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (±)-Befunolol, CAS:39552-01-7, Molecular Weight: 291.34224, C16H21NO4, Purity:98, SMILES: CC(C1=CC2=CC=CC(OCC(O)CNC(C)C)=C2O1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1r,2R,3R,4s,5s,6S,7S,8r)-methyl 4-((tert-butoxycarbonyl)(methyl)amino)cubane-1-carboxylate, CAS:1859134-48-7, Molecular Weight: 291.3422, C16H21NO4, Purity:98, SMILES: CN(C(OC(C)(C)C)=O)[C@]12[C@H]3[C@@H]4[C@H]1[C@@H]5[C@H]2[C@H]3[C@@]54C(OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,3R-3-(((BenzyloxyCarbonylAminoCyclohexyl Acetate, CAS:0, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: CC(=O)O[C@@H]1CCC[C@H](C1)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,3S-3-(((BenzyloxyCarbonylAminoCyclohexyl Acetate, CAS:0, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: CC(=O)O[C@@H]1CCC[C@@H](C1)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-(((Benzyloxy)carbonyl)amino)-2-cyclohexylacetic acid, CAS:69901-75-3, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: O=C(N[C@H](C(=O)O)C1CCCCC1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl 3-ethyl piperidine-1,3-dicarboxylate, CAS:310454-53-6, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: CCOC(=O)C1CCCN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl 3-Tert-Butyl Azetidine-1,3-Dicarboxylate, CAS:1236144-51-6, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: CC(C)(C)OC(=O)C1CN(C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-(Tert-Butoxycarbonyl-1,2,3,4-Tetrahydroisoquinolin-7-YlAcetic Acid, CAS:1158755-34-0, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=CC=C(CC(O)=O)C=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Phenyl-pyrrolidine-1,3-dicarboxylic acid 1-tert-butyl ester, CAS:455955-08-5, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: OC(=O)C1CCN(C1c1ccccc1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-tert-butyl 6-methyl 3,4-dihydroisoquinoline-2,6(1H)-dicarboxylate, CAS:170097-66-2, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: COC(=O)c1ccc2CN(CCc2c1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Tert-Butyl 6-Methyl 3,4-Dihydroisoquinoline-2,6(1H-Dicarboxylate, CAS:170097-66-2, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: COC(=O)C1=CC=C2CN(CCC2=C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Phenyl-1,3-pyrrolidinedicarboxylic acid 1-(tert-butyl) ester, CAS:939757-89-8, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC(C(C1)c1ccccc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(2R,3R-1-(Tert-Butoxycarbonyl-2-Phenylpyrrolidine-3-Carboxylic Acid, CAS:870721-53-2, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC[C@H]([C@@H]1C1=CC=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-4-(((BenzyloxyCarbonylAminoCyclohexyl Acetate, CAS:0, Molecular Weight: 291.3422, C16H21NO4, Purity:95, SMILES: CC(=O)O[C@H]1CC[C@@H](CC1)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RISARESTAT, CAS:79714-31-1, Molecular Weight: 323.4072, C16H21NO4S, Purity:98, SMILES: O=C(N1)SC(C2=CC=C(OCCCCC)C(OCC)=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl [(3aS,4R,6S,6aR)-6-hydroxy-2,2-dimethyltetrahydro-3aH-cyclopenta[d][1,3]dioxol-4-yl]carbamate, CAS:274693-53-7, Molecular Weight: 307.3416, C16H21NO5, Purity:99, SMILES: O=C(N[C@@H]1C[C@@H]([C@@H]2[C@H]1OC(O2)(C)C)O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Moguisteine, CAS:119637-67-1, Molecular Weight: 339.4066, C16H21NO5S, Purity:98, SMILES: COC1=CC=CC=C1OCC2N(C(CC(OCC)=O)=O)CCS2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Boc-Asp-Obzl, CAS:30925-18-9, Molecular Weight: 323.341, C16H21NO6, Purity:97, SMILES: CC(C)(C)OC(=O)N[C@@H](CC(O)=O)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Boc-D-Aspartic acid 4-benzyl ester, CAS:51186-58-4, Molecular Weight: 323.341, C16H21NO6, Purity:97, SMILES: O=C(C[C@H](C(=O)O)NC(=O)OC(C)(C)C)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Boc-D-Asp-OBzl, CAS:92828-64-3, Molecular Weight: 323.341, C16H21NO6, Purity:98, SMILES: CC(C)(C)OC(=O)N[C@H](CC(O)=O)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cbz-D-Asp(OtBu)-OH H2O , CAS:71449-08-6, Molecular Weight: 323.341, C16H21NO6, Purity:95, SMILES: CC(C)(C)OC(=O)C[C@@H](NC(=O)OCC1=CC=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Z-Asp(OtBu)-OH, CAS:554-59-0, Molecular Weight: 323.341, C16H21NO6, Purity:98, SMILES: CC(C)(C)OC(=O)C[C@H](NC(=O)OCc1ccccc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| METHYL 2-(N-(TERT-BUTOXYCARBONYL)-4-METHYLPHENYLSULFONAMIDO)ACRYLATE, CAS:219851-87-3, Molecular Weight: 355.406, C16H21NO6S, Purity:95, SMILES: COC(=O)C(=C)N(C(=O)OC(C)(C)C)S(=O)(=O)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SP-420, CAS:911714-45-9, Molecular Weight: 355.406, C16H21NO6S, Purity:98, SMILES: O=C([C@]1(C)N=C(C2=CC=C(OCCOCCOC)C=C2O)SC1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-tert-butyl 3-(4-bromophenylpiperidine-1-carboxylate, CAS:0, Molecular Weight: 340.255, C16H22BrNO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC[C@H](C1)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-N-Boc-4-(4-BromophenylPiperidine, CAS:769944-78-7, Molecular Weight: 340.255, C16H22BrNO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-(4-bromophenylpiperidine-1-carboxylate, CAS:769944-73-2, Molecular Weight: 340.255, C16H22BrNO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCCC(C1)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 4-(4-bromophenyl)piperidine-1-carboxylate, CAS:769944-78-7, Molecular Weight: 340.255, C16H22BrNO2, Purity:97, SMILES: O=C(N1CCC(CC1)c1ccc(cc1)Br)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Homatropine (Bromide), CAS:51-56-9, Molecular Weight: 356.2548, C16H22BrNO3, Purity:98, SMILES: O=C(C(C1=CC=CC=C1)O)O[C@H]2C[C@@H](CC3)N(C)[C@@H]3C2.Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl (1r,3r)-1-(4-bromophenyl)-3-hydroxy-3-methylcyclobutylcarbamate, CAS:, Molecular Weight: 356.255, C16H22BrNO3, Purity:95, SMILES: O=C(OC(C)(C)C)N[C@@]1(C2=CC=C(Br)C=C2)C[C@](C)(O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 3-(3-bromophenyl-2-(tert-butoxycarbonylamino-2-methylpropanoate, CAS:887969-56-4, Molecular Weight: 372.254, C16H22BrNO4, Purity:95, SMILES: COC(=O)C(C)(CC1=CC(Br)=CC=C1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-tert-butyl 3-(((4-bromophenyl)sulfonyl)oxy)piperidine-1-carboxylate, CAS:, Molecular Weight: 420.319, C16H22BrNO5S, Purity:95, SMILES: O=C(N1C[C@@H](OS(=O)(C2=CC=C(Br)C=C2)=O)CCC1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-(((4-bromophenyl)sulfonyl)oxy)piperidine-1-carboxylate, CAS:, Molecular Weight: 420.319, C16H22BrNO5S, Purity:95, SMILES: O=C(N1CC(OS(=O)(C2=CC=C(Br)C=C2)=O)CCC1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrithioxin (dihydrochloride), CAS:10049-83-9, Molecular Weight: 441.3929, C16H22Cl2N2O4S2, Purity:98, SMILES: OCC1=C(CSSCC2=C(CO)C(O)=C(C)N=C2)C=NC(C)=C1O.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bendamustine (hydrochloride), CAS:3543-75-7, Molecular Weight: 394.7238, C16H22Cl3N3O2, Purity:98, SMILES: CN1C(C=CC(N(CCCl)CCCl)=C2)=C2N=C1CCCC(O)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tripelennamine (hydrochloride), CAS:154-69-8, Molecular Weight: 291.819, C16H22ClN3, Purity:98, SMILES: CN(C)CCN(CC1=CC=CC=C1)C2=NC=CC=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Propranolol (hydrochloride), CAS:318-98-9, Molecular Weight: 295.8044, C16H22ClNO2, Purity:98, SMILES: OC(CNC(C)C)COC1=CC=CC2=CC=CC=C12.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mebeverine alcohol D5, CAS:, Molecular Weight: 270.4219, C16H22D5NO2, Purity:98, SMILES: CC(N(C([2H])([2H])C([2H])([2H])[2H])CCCCO)CC1=CC=C(OC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-Methyl 2-((Tert-ButoxycarbonylAmino-3-(3-Iodo-4-MethoxyphenylPropanoate, CAS:113850-71-8, Molecular Weight: 435.2541, C16H22INO5, Purity:95, SMILES: COC(=O)[C@H](CC1=CC(I)=C(OC)C=C1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-(4-amino-3-methylphenyl)piperidin-1-yl)(cyclopropyl)methanone, CAS:1852497-07-4, Molecular Weight: 258.3587, C16H22N2O, Purity:95, SMILES: Cc1cc(ccc1N)C1CCN(CC1)C(=O)C1CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9-Benzyl-3,9-Diazaspiro[5.5]Undecan-2-One, CAS:500360-86-1, Molecular Weight: 258.3587, C16H22N2O, Purity:95, SMILES: O=C1CC2(CCN1)CCN(CC1=CC=CC=C1)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl (5-Aminobicyclo[3.2.1]Octan-1-YlCarbamate, CAS:1383973-53-2, Molecular Weight: 274.3581, C16H22N2O2, Purity:95, SMILES: NC12CCC(C1)(CCC2)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Benzyl Octahydropyrrolo[3,4-D]Azepine-6(2H-Carboxylate, CAS:0, Molecular Weight: 274.3581, C16H22N2O2, Purity:95, SMILES: O=C(OCC1=CC=CC=C1)N1CC[C@@H]2CNC[C@@H]2CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Tert-Butyl 3,3A,4,5-Tetrahydro-1H-Pyrrolo[3,4-C]Quinoline-2(9Bh-Carboxylate, CAS:1422344-51-1, Molecular Weight: 274.3581, C16H22N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2CNC3=CC=CC=C3[C@@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-Tert-Butyl3,3A,4,5-Tetrahydro-1H-Pyrrolo[3,4-C]Quinoline-2(9Bh-Carboxylate, CAS:1251017-31-8, Molecular Weight: 274.3581, C16H22N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2CNC3=C(C=CC=C3)[C@@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-tert-Butyl 2-(3-amino-2-oxo-2,3,4,5-tetrahydro-1H-benzo[b]azepin-1-yl)acetate, CAS:109010-60-8, Molecular Weight: 290.3575, C16H22N2O3, Purity:97, SMILES: O=C(OC(C)(C)C)CN1C(=O)[C@@H](N)CCc2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Imidazolidinecarboxylic acid, 2-(1,1-dimethylethyl)-3-methyl-4-oxo-, phenylmethyl ester, CAS:111610-19-6, Molecular Weight: 290.3575, C16H22N2O3, Purity:95, SMILES: CN1C(N(CC1=O)C(=O)OCc1ccccc1)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Boc-Tryptophanol, CAS:82689-19-8, Molecular Weight: 290.3575, C16H22N2O3, Purity:98, SMILES: CC(C)(C)OC(=O)N[C@H](CO)Cc1c[nH]c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glyhexamide, CAS:451-71-8, Molecular Weight: 322.42248, C16H22N2O3S, Purity:98, SMILES: O=S(C1=CC2=C(CCC2)C=C1)(NC(NC3CCCCC3)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(5R,9S-Tert-Butyl 9-(Furan-2-Yl-6-Oxo-2,7-Diazaspiro[4.4]Nonane-2-Carboxylate, CAS:0, Molecular Weight: 306.3569, C16H22N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC[C@]2(C1)[C@@H](CNC2=O)C1=CC=CO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TMB (monosulfate), CAS:54827-18-8, Molecular Weight: 338.4219, C16H22N2O4S, Purity:98, SMILES: NC1=C(C)C=C(C2=CC(C)=C(N)C(C)=C2)C=C1C.O=S(O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-(((Benzyloxy)carbonyl)amino)-3-((tert-butoxycarbonyl)amino)propanoic acid, CAS:16947-84-5, Molecular Weight: 338.3557, C16H22N2O6, Purity:98, SMILES: O=C(N[C@H](C(=O)O)CNC(=O)OC(C)(C)C)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-3-Benzyloxycarbonylamino-2-(Boc-amino)propionic acid, CAS:65710-57-8, Molecular Weight: 338.3557, C16H22N2O6, Purity:95, SMILES: O=C(OCc1ccccc1)NC[C@@H](C(=O)O)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Boc-Dap(Z)-OH, CAS:65710-57-8, Molecular Weight: 338.3557, C16H22N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H](CNC(=O)OCC1=CC=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Morantel (tartrate), CAS:26155-31-7, Molecular Weight: 370.4207, C16H22N2O6S, Purity:98, SMILES: CC1=C(/C=C/C2=NCCCN2C)SC=C1.O=C(O)[C@H](O)[C@@H](O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(3-methyl-1-phenyl-1H-pyrazol-5-yl)piperazine acetate, CAS:906093-30-9, Molecular Weight: 302.3715, C16H22N4O2, Purity:99, SMILES: CC(O)=O.Cc1cc(N2CCNCC2)n(n1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KFM19, CAS:133058-72-7, Molecular Weight: 318.37088, C16H22N4O3, Purity:98, SMILES: O=C(N1CCC)N(CCC)C2=C(N=C(C3CC(CC3)=O)N2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Imidodicarbonic acid, 2-(3H-imidazo[4,5-c]pyridin-4-yl)-, 1,3-bis(1,1-dimethylethyl) ester, CAS:934816-44-1, Molecular Weight: 334.3703, C16H22N4O4, Purity:95, SMILES: O=C(N(c1nccc2c1nc[nH]2)C(=O)OC(C)(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Protirelin, CAS:24305-27-9, Molecular Weight: 362.3837, C16H22N6O4, Purity:98, SMILES: O=C(N)[C@H]1N(C([C@H](CC2=CNC=N2)NC([C@H](CC3)NC3=O)=O)=O)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Protirelin (Acetate), CAS:120876-23-5, Molecular Weight: 362.3837, C16H22N6O4, Purity:98, SMILES: O=C(N)[C@H]1N(C([C@H](CC2=CNC=N2)NC([C@H](CC3)NC3=O)=O)=O)CCC1.[1.5 CH3COOH], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Geniposidic acid, CAS:27741-01-1, Molecular Weight: 374.3399, C16H22O10, Purity:98, SMILES: O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O[C@@H]2OC=C(C(O)=O)[C@]3([H])[C@@]2([H])C(CO)=CC3)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl (trans-4-phenylcyclohexyl)acetate, CAS:1031336-66-9, Molecular Weight: 246.3447, C16H22O2, Purity:97, SMILES: CCOC(=O)CC1CCC(CC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 2-(4-phenylcyclohexyl)acetate, CAS:411238-92-1, Molecular Weight: 246.3447, C16H22O2, Purity:95, SMILES: CCOC(=O)CC1CCC(CC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Homosalate, CAS:118-56-9, Molecular Weight: 262.3441, C16H22O3, Purity:98, SMILES: O=C(OC1CC(C)(C)CC(C)C1)C2=CC=CC=C2O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dibutyl phthalate, CAS:84-74-2, Molecular Weight: 278.3435, C16H22O4, Purity:98, SMILES: CCCCOC(=O)c1ccccc1C(=O)OCCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| diethyl 2-(4-methylbenzylsuccinate, CAS:0, Molecular Weight: 278.3435, C16H22O4, Purity:95, SMILES: CCOC(=O)CC(CC1=CC=C(C)C=C1)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| diethyl 2-(3-methoxybenzylsuccinate, CAS:117823-72-0, Molecular Weight: 294.3429, C16H22O5, Purity:95, SMILES: CCOC(=O)CC(CC1=CC=CC(OC)=C1)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-(4-(tert-Butoxycarbonyl)piperazine-1-carbonyl)phenyl)boronic acid, CAS:1150114-76-3, Molecular Weight: 334.175, C16H23BN2O5, Purity:95, SMILES: OB(c1ccc(cc1)C(=O)N1CCN(CC1)C(=O)OC(C)(C)C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((1R,2R)-2-(2-methoxyphenyl)cyclopropyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:, Molecular Weight: 274.163, C16H23BO3, Purity:95, SMILES: COc1ccccc1[C@@H]1C[C@H]1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((1R,2R)-2-(3-methoxyphenyl)cyclopropyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:, Molecular Weight: 274.163, C16H23BO3, Purity:95, SMILES: COc1cccc(c1)[C@@H]1C[C@H]1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((1R,2R)-2-(4-methoxyphenyl)cyclopropyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:, Molecular Weight: 274.163, C16H23BO3, Purity:95, SMILES: COc1ccc(cc1)[C@@H]1C[C@H]1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-(2-methoxyphenyl)cyclopropyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:, Molecular Weight: 274.163, C16H23BO3, Purity:95, SMILES: COc1ccccc1C1(CC1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-(3-methoxyphenyl)cyclopropyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:, Molecular Weight: 274.163, C16H23BO3, Purity:95, SMILES: COc1cccc(c1)C1(CC1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-(4-methoxyphenyl)cyclopropyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, CAS:, Molecular Weight: 274.163, C16H23BO3, Purity:95, SMILES: COc1ccc(cc1)C1(CC1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)acetate, CAS:859169-20-3, Molecular Weight: 290.162, C16H23BO4, Purity:95, SMILES: CCOC(=O)Cc1ccc(cc1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Amino-4-(4-bromophenyl)-1-(N-boc)piperidine, CAS:917925-62-3, Molecular Weight: 355.27, C16H23BrN2O2, Purity:95, SMILES: O=C(N1CCC(CC1)(N)c1ccc(cc1)Br)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-AMINO-4-(4-BROMO-PHENYL)-PIPERIDINE-1-CARBOXYLIC ACID TERT-BUTYL ESTER, CAS:917925-62-3, Molecular Weight: 355.27, C16H23BrN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(N)(CC1)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| H-1152 (dihydrochloride), CAS:871543-07-6, Molecular Weight: 392.3437, C16H23Cl2N3O2S, Purity:98, SMILES: CC1=CN=CC2=C1C(S(=O)(N3[C@@H](C)CNCCC3)=O)=CC=C2.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Azaphen (dihydrochloride monohydrate), CAS:63302-99-8, Molecular Weight: 388.2921, C16H23Cl2N5O2, Purity:98, SMILES: [H]Cl.[H]Cl.CN1C2=CC=CC=C2OC3=C1C=C(N4CCN(C)CC4)N=N3.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 2-Amino-7-Azaspiro[3.5]Nonane-7-Carboxylate Hydrochloride, CAS:0, Molecular Weight: 310.819, C16H23ClN2O2, Purity:95, SMILES: Cl.NC1CC2(C1)CCN(CC2)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZK-90055 (hydrochloride), CAS:84638-81-3, Molecular Weight: 342.81782, C16H23ClN2O4, Purity:98, SMILES: O=C(C(N1)=CC2=C1C(O)=CC=C2C(O)CNC(C)(C)C)OC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PSI-352938, CAS:1231747-17-3, Molecular Weight: 431.3558852, C16H23FN5O6P, Purity:98, SMILES: O=P1(OC(C)C)OC[C@]2([H])[C@@]([C@@](C)(F)[C@H](N3C(N=C(N)N=C4OCC)=C4N=C3)O2)([H])O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Methyl-2-((Spiro[[1Lambda2]Pyrrolo[3,2-B]Pyridine-1,4'-Piperidine]-1'-YlCarbonyloxyPropylidyne, CAS:1251008-17-9, Molecular Weight: 289.3727, C16H23N3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CNC3=CC=CN=C23)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(((1H-Imidazol-4-yl)methyl)(4-methoxybenzyl)amino)propyl methanesulfonate, CAS:, Molecular Weight: 353.437, C16H23N3O4S, Purity:95, SMILES: COc1ccc(cc1)CN(C(COS(=O)(=O)C)C)Cc1c[nH]cn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N6-Cyclohexyladenosine, CAS:36396-99-3, Molecular Weight: 349.3849, C16H23N5O4, Purity:98, SMILES: OC[C@@H]1[C@H]([C@H]([C@H](N2C=NC3=C2N=CN=C3NC4CCCCC4)O1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| F 11440, CAS:179756-58-2, Molecular Weight: 345.3995, C16H23N7O2, Purity:98, SMILES: O=C(N1C)N(CCCCN2CCN(C3=NC=CC=N3)CC2)N=CC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrovalerone, CAS:3563-49-3, Molecular Weight: 245.35992, C16H23NO, Purity:98, SMILES: CCCC(N1CCCC1)C(C2=CC=C(C)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2S,3R,4R,5R,6R)-3-acetamido-6-(acetoxymethyl)tetrahydro-2H-pyran-2,4,5-triyl triacetate, CAS:3006-60-8, Molecular Weight: 389.3545, C16H23NO10, Purity:95, SMILES: CC(=O)N[C@H]1[C@H](OC(C)=O)O[C@H](COC(C)=O)[C@H](OC(C)=O)[C@@H]1OC(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-4-Cyano-4-Piperidinecarboxylic Acid Ethyl Ester, CAS:123730-67-6, Molecular Weight: 261.3593, C16H23NO2, Purity:95, SMILES: CCOC(=O)C1(C)CCN(CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(2-AcetylphenylOctanamide, CAS:1040310-65-3, Molecular Weight: 261.3593, C16H23NO2, Purity:95, SMILES: CCCCCCCC(=O)NC1=CC=CC=C1C(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 2-(1-benzyl-4-hydroxypiperidin-4-yl)acetate, CAS:67281-07-6, Molecular Weight: 277.3587, C16H23NO3, Purity:95, SMILES: CCOC(=O)CC1(O)CCN(CC1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-hydroxy-4-phenylpiperidine-1-carboxylate, CAS:1000931-04-3, Molecular Weight: 277.3587, C16H23NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(C(O)C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 3-hydroxy-4-phenylpiperidine-1-carboxylate, CAS:1000931-04-3, Molecular Weight: 277.3587, C16H23NO3, Purity:95, SMILES: OC1CN(CCC1c1ccccc1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-hydroxy-4-phenylpiperidine-1-carboxylate, CAS:172734-33-7, Molecular Weight: 277.3587, C16H23NO3, Purity:98, SMILES: CC(C)(C)OC(=O)N1CCC(O)(CC1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| L-Methionine, N-[2-(mercaptomethyl)-3-(2-methylphenyl)-1-oxopropyl]-, CAS:145775-14-0, Molecular Weight: 341.48872, C16H23NO3S2, Purity:98, SMILES: CSCC[C@@H](C(O)=O)NC(C(CS)CC1=CC=CC=C1C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(Benzyl-Ethoxycarbonylmethyl-Amino-Propionic Acid Ethyl Ester, CAS:795-18-6, Molecular Weight: 293.3581, C16H23NO4, Purity:95, SMILES: CCOC(=O)CCN(CC(=O)OCC)CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MHP, CAS:1104874-94-3, Molecular Weight: 293.35812, C16H23NO4, Purity:98, SMILES: OC(C=C1)=CC=C1C[C@@H](C(OC)=O)NC(CCCCC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RR6, CAS:1351758-37-6, Molecular Weight: 293.3581, C16H23NO4, Purity:98, SMILES: CC(C)(CO)[C@@H](O)C(NCCC(CC1=CC=CC=C1)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-ethyl 2-((tert-butoxycarbonylamino-3-(4-hydroxyphenylpropanoate, CAS:72594-77-5, Molecular Weight: 309.3575, C16H23NO5, Purity:95, SMILES: CCOC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BOC-O-Benzyl-L-threonine, CAS:15260-10-3, Molecular Weight: 309.3575, C16H23NO5, Purity:98, SMILES: C[C@H]([C@@H](C(=O)O)NC(=O)OC(C)(C)C)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Monocrotaline, CAS:315-22-0, Molecular Weight: 325.3569, C16H23NO6, Purity:98, SMILES: O=C(O[C@]1([H])CCN2[C@]1([H])C(CO3)=CC2)[C@H](C)[C@@](C)(O)[C@@](C)(O)C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,4-Benzenediboronic acid bis(neopentyl glycol) ester, CAS:5565-36-6, Molecular Weight: 301.981, C16H24B2O4, Purity:95, SMILES: CC1(C)COB(OC1)c1ccc(cc1)B1OCC(CO1)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)pyrrolidine, CAS:852227-90-8, Molecular Weight: 273.178, C16H24BNO2, Purity:99, SMILES: CC1(C)OB(OC1(C)C)c1ccc(cc1)N1CCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-[3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]morpholine, CAS:852227-95-3, Molecular Weight: 289.178, C16H24BNO3, Purity:99, SMILES: CC1(C)OB(OC1(C)C)c1cccc(c1)N1CCOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Bromo-4-chloro-1-(triisopropylsilanyl)-7-azaindole, CAS:685513-96-6, Molecular Weight: 387.818, C16H24BrClN2Si, Purity:95, SMILES: Brc1cnc2c(c1Cl)ccn2[Si](C(C)C)(C(C)C)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-bromo-4-fluoro-1-(triisopropylsilyl)-1H-pyrrolo[2,3-b]pyridine, CAS:685513-91-1, Molecular Weight: 371.363, C16H24BrFN2Si, Purity:98, SMILES: CC(C)[Si](C(C)C)(C(C)C)n1ccc2c(F)c(Br)cnc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1,5-Cyclooctadiene)rhodium chloride dimer, CAS:12092-47-6, Molecular Weight: 493.079, C16H24Cl2Rh2, Purity:98, SMILES: [Cl-].[Cl-].[Rh+].[Rh+].C1C\C=C/CC\C=C/1.C1C\C=C/CC\C=C/1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dichloro(1,5-cyclooctadien)ruthenium(II) polymer, CAS:50982-13-3, Molecular Weight: 489.41, C16H24Cl2Ru2, Purity:97, SMILES: [Cl-].[Cl-].[Ru++].[Ru++].C1C\C=C/CC\C=C/1.C1C\C=C/CC\C=C/1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Chloro-5-fluoro-1-(triiospropylsilyl)-7-azaindole, CAS:685513-94-4, Molecular Weight: 326.912, C16H24ClFN2Si, Purity:95, SMILES: Fc1cnc2c(c1Cl)ccn2[Si](C(C)C)(C(C)C)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| R-(+)-Mono-desmethylsibutramine, CAS:229639-54-7, Molecular Weight: 265.82146, C16H24ClN, Purity:98, SMILES: CC(C)C[C@H](C1(C2=CC=C(Cl)C=C2)CCC1)NC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tolperisone (hydrochloride), CAS:3644-61-9, Molecular Weight: 281.8209, C16H24ClNO, Purity:98, SMILES: O=C(C1=CC=C(C)C=C1)C(C)CN2CCCCC2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pargolol (hydrochloride), CAS:36902-82-6, Molecular Weight: 313.81966, C16H24ClNO3, Purity:98, SMILES: OC(COC1=CC=CC=C1OCC#C)CNC(C)(C)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-5-Benzyl 1-tert-butyl 2-aminopentanedioate hydrochloride, CAS:105590-97-4, Molecular Weight: 329.819, C16H24ClNO4, Purity:99, SMILES: Cl.CC(C)(C)OC(=O)[C@@H](N)CCC(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Pyrrolo[2,3-b]pyridine, 4,5-difluoro-1-[tris(1-methylethyl)silyl]-, CAS:685513-89-7, Molecular Weight: 310.4575, C16H24F2N2Si, Purity:90, SMILES: Fc1cnc2c(c1F)ccn2[Si](C(C)C)(C(C)C)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-octyl-3-methylimidazolium bis((trifluoromethyl)sulfonyl)imide, CAS:862731-66-6, Molecular Weight: 404.3711, C16H24F6N3O2, Purity:95, SMILES: FC(F)(F)C(=O)NC(=O)C(F)(F)F.CCCCCCCCN1C=C[N+](C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-[(4,4-DIMETHYLCYCLOHEXYL)OXY]-5-FLUORO-2-METHOXY-BENZENEMETHANAMINE, CAS:1224048-15-0, Molecular Weight: 281.3657, C16H24FNO2, Purity:95, SMILES: COc1cc(OC2CCC(C)(C)CC2)c(F)cc1CN, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Aminophylline, CAS:317-34-0, Molecular Weight: 420.4264, C16H24N10O4, Purity:98, SMILES: O=C(N1C)N(C)C2=C(N=CN2)C1=O.O=C(N3C)N(C)C4=C(N=CN4)C3=O.NCCN, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-tert-Butyl 2-benzylpiperazine-1-carboxylate, CAS:947684-78-8, Molecular Weight: 276.374, C16H24N2O2, Purity:97, SMILES: O=C(N1CCNC[C@H]1Cc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-tert-Butyl 2-benzylpiperazine-1-carboxylate, CAS:169447-86-3, Molecular Weight: 276.374, C16H24N2O2, Purity:98, SMILES: CC(C)(C)OC(=O)N1CCNC[C@@H]1Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-N-Boc-2-Benzylpiperazine, CAS:481038-63-5, Molecular Weight: 276.374, C16H24N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCNCC1CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Droxicainide, CAS:78289-26-6, Molecular Weight: 276.37396, C16H24N2O2, Purity:98, SMILES: O=C(C1N(CCO)CCCC1)NC2=C(C)C=CC=C2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-butyl 4-(4-aminophenyl)piperidine-1-carboxylate, CAS:170011-57-1, Molecular Weight: 276.374, C16H24N2O2, Purity:97, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)c1ccc(N)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(tert-butyldimethylsilanyloxymethyl)-5-phenylimidazolidine-2,4-dione, CAS:1401226-49-0, Molecular Weight: 320.4589, C16H24N2O3Si, Purity:99, SMILES: CC(C)(C)[Si](C)(C)OCC1(NC(=O)NC1=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-(tert-butyl)-3-methylimidazolidin-4-one (R)-2-hydroxy-2-phenylacetate, CAS:, Molecular Weight: 308.3728, C16H24N2O4, Purity:95, SMILES: O=C1N(C)[C@@H](C(C)(C)C)NC1.O=C(O)[C@H](O)C2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-ethyl 3-(4-aminophenyl)-2-(tert-butoxycarbonylamino)propanoate, CAS:67630-01-7, Molecular Weight: 308.3728, C16H24N2O4, Purity:95, SMILES: CCOC(=O)[C@H](Cc1ccc(N)cc1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Tert-Butyl 4-Ethyl 4,5-Dihydro-1H-Pyrrolo[1,2-A][1,4]Diazepine-2,4(3H-Dicarboxylate, CAS:0, Molecular Weight: 308.3728, C16H24N2O4, Purity:95, SMILES: CCOC(=O)C1CN2C=CC=C2CN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bestatin, CAS:58970-76-6, Molecular Weight: 308.3728, C16H24N2O4, Purity:98, SMILES: CC(C)C[C@@H](C(O)=O)NC([C@@H](O)[C@H](N)CC1=CC=CC=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DI-TERT-BUTYL 1,3-PHENYLENEDICARBAMATE, CAS:59255-77-5, Molecular Weight: 308.3728, C16H24N2O4, Purity:95, SMILES: O=C(Nc1cccc(c1)NC(=O)OC(C)(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 2-(1-(4-(ethoxycarbonyl)phenyl)ethyl)hydrazinecarboxylate, CAS:870822-88-1, Molecular Weight: 308.3728, C16H24N2O4, Purity:99, SMILES: CCOC(=O)c1ccc(cc1)C(NNC(=O)OC(C)(C)C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-1'-(Tert-Butoxycarbonyl-3A,4,5,6A-Tetrahydrospiro[Cyclopenta[D]Isoxazole-6,4'-Piperidine]-3-Carboxylic Acid, CAS:1273564-79-6, Molecular Weight: 324.3722, C16H24N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC[C@@H]3[C@H]2ON=C3C(O)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(3aR,6aR-1'-(tert-butoxycarbonyl-3a,5,6,6a-tetrahydrospiro[cyclopenta[d]isoxazole-4,4'-piperidine]-3-carboxylic acid, CAS:1263178-47-7, Molecular Weight: 324.3722, C16H24N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC[C@H]3ON=C([C@@H]23)C(O)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(4-Methoxycarbonyl-Thiazol-2-Yl,N-Carboxy-Carbamic Acid Di-Tert-Butyl Ester, CAS:0, Molecular Weight: 372.437, C16H24N2O6S, Purity:95, SMILES: CCOC(=O)C1=CSC(=N1)N(C(=O)OC(C)(C)C)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 10-Phenyldecanoic acid, CAS:18017-73-7, Molecular Weight: 248.3606, C16H24O2, Purity:95, SMILES: OC(=O)CCCCCCCCCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,5-DI-TERT-BUTYL-2-METHOXYBENZALDEHYDE, CAS:135546-15-5, Molecular Weight: 248.3606, C16H24O2, Purity:95, SMILES: COC1=C(C=C(C=C1C=O)C(C)(C)C)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,5-DI-TERT-BUTYL-2-METHOXYBENZALDEHYDE, CAS:135546-15-5, Molecular Weight: 248.3606, C16H24O2, Purity:95, SMILES: COc1c(C=O)cc(cc1C(C)(C)C)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Brefeldin A, CAS:20350-15-6, Molecular Weight: 280.3594, C16H24O4, Purity:98, SMILES: O[C@@H]1C[C@]2([H])[C@@](/C=C/CCC[C@H](C)OC(/C=C/[C@H]2O)=O)([H])C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl 3,3'-(2,2-dimethyl-4,6-dioxo-1,3-dioxane-5,5-diyl)dipropanoate, CAS:, Molecular Weight: 344.357, C16H24O8, Purity:95, SMILES: CCOC(=O)CCC1(CCC(=O)OCC)C(=O)OC(OC1=O)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzene, [[[2,2-dimethyl-4-(trimethylsilyl)-3-butyn-1-yl]oxy]methyl]-, CAS:1294504-65-6, Molecular Weight: 260.4467, C16H24OSi, Purity:95, SMILES: CC(C#C[Si](C)(C)C)(COCc1ccccc1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Bromo-1-(triisopropylsilyl)-1H-pyrrolo[2,3-b]pyridine, CAS:858116-66-2, Molecular Weight: 353.373, C16H25BrN2Si, Purity:95, SMILES: Brc1cnc2c(c1)ccn2[Si](C(C)C)(C(C)C)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Xylometazoline (hydrochloride), CAS:1218-35-5, Molecular Weight: 280.8361, C16H25ClN2, Purity:98, SMILES: CC1=C(CC2=NCCN2)C(C)=CC(C(C)(C)C)=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oxymetazoline (hydrochloride), CAS:2315-02-8, Molecular Weight: 296.8355, C16H25ClN2O, Purity:98, SMILES: OC1=C(C(C)(C)C)C=C(C)C(CC2=NCCN2)=C1C.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ropinirole (hydrochloride), CAS:91374-20-8, Molecular Weight: 296.8355, C16H25ClN2O, Purity:98, SMILES: O=C1NC2=C(C(CCN(CCC)CCC)=CC=C2)C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Molindone (hydrochloride), CAS:15622-65-8, Molecular Weight: 312.8349, C16H25ClN2O2, Purity:98, SMILES: O=C1C2=C(NC(C)=C2CC)CCC1CN3CCOCC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Carteolol (hydrochloride), CAS:51781-21-6, Molecular Weight: 328.8343, C16H25ClN2O3, Purity:98, SMILES: O=C1NC2=C(C(OCC(O)CNC(C)(C)C)=CC=C2)CC1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bestatin (hydrochloride), CAS:65391-42-6, Molecular Weight: 344.8337, C16H25ClN2O4, Purity:98, SMILES: CC(C)C[C@@H](C(O)=O)NC([C@@H](O)[C@H](N)CC1=CC=CC=C1)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BESTATINHYDROCHLORIDE, CAS:65391-42-6, Molecular Weight: 344.834, C16H25ClN2O4, Purity:95, SMILES: Cl.CC(C)C[C@H](NC(=O)[C@@H](O)[C@H](N)CC1=CC=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DBPR108, CAS:1186426-66-3, Molecular Weight: 324.3937, C16H25FN4O2, Purity:98, SMILES: N#C[C@H]1N(C(CNC(C)(C)CC(N2CCCC2)=O)=O)C[C@@H](F)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| M344, CAS:251456-60-7, Molecular Weight: 307.388, C16H25N3O3, Purity:98, SMILES: O=C(NCCCCCCC(NO)=O)C1=CC=C(N(C)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-1-Tert-Butyl 3-Ethyl 4-(1-Methyl-1H-Imidazol-4-YlPyrrolidine-1,3-Dicarboxylate, CAS:0, Molecular Weight: 323.3874, C16H25N3O4, Purity:95, SMILES: CCOC(=O)[C@@H]1CN(C[C@H]1C1=CN(C)C=N1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Xanomeline (oxalate), CAS:141064-23-5, Molecular Weight: 371.4518, C16H25N3O5S, Purity:98, SMILES: CN1CCC=C(C2=NSN=C2OCCCCCC)C1.O=C(O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amoxicillin (trihydrate), CAS:61336-70-7, Molecular Weight: 419.45, C16H25N3O8S, Purity:98, SMILES: OC([C@@H]1N(C2=O)[C@]([C@@H]2NC([C@@H](C3=CC=C(O)C=C3)N)=O)([H])SC1(C)C)=O.[3H2O], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Desvenlafaxine, CAS:93413-62-8, Molecular Weight: 263.3752, C16H25NO2, Purity:98, SMILES: OC1=CC=C(C(C2(O)CCCCC2)CN(C)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Emixustat, CAS:1141777-14-1, Molecular Weight: 263.3752, C16H25NO2, Purity:98, SMILES: O[C@H](CCN)C1=CC(OCC2CCCCC2)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tertatolol, CAS:83688-84-0, Molecular Weight: 295.4402, C16H25NO2S, Purity:98, SMILES: OC(CNC(C)(C)C)COC1=C2C(CCCS2)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mebeverine metabolite Mebeverine acid, CAS:475203-77-1, Molecular Weight: 279.3746, C16H25NO3, Purity:98, SMILES: O=C(O)CCCN(CC)C(C)CC1=CC=C(OC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Tert-Butyl 2-Methyl 8-Azaspiro[4.5]Dec-1-Ene-2,8-Dicarboxylate, CAS:1363210-32-5, Molecular Weight: 295.374, C16H25NO4, Purity:95, SMILES: COC(=O)C1=CC2(CC1)CCN(CC2)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Tert-Butyl 2-Methyl 1-Oxo-8-Azaspiro[4.5]Decane-2,8-Dicarboxylate, CAS:849203-09-4, Molecular Weight: 311.3734, C16H25NO5, Purity:95, SMILES: COC(=O)C1CCC2(CCN(CC2)C(=O)OC(C)(C)C)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3,4-Difluorophenyl)morpholine Hydrochloride, CAS:1251033-05-2, Molecular Weight: 218.3776, C16H26, Purity:95, SMILES: Cc1ccc(cc1C)C1CCCCC1.CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,5-Dibromo-3-dodecylthiophene, CAS:148256-63-7, Molecular Weight: 410.251, C16H26Br2S, Purity:95, SMILES: CCCCCCCCCCCCC1=C(Br)SC(Br)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| UAMC00039 (dihydrochloride), CAS:697797-51-6, Molecular Weight: 382.75614, C16H26Cl3N3O, Purity:98, SMILES: O=C(N1CCCCC1)[C@@H](N)CCNCC2=CC=C(Cl)C=C2.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Emixustat (hydrochloride), CAS:1141934-97-5, Molecular Weight: 299.8362, C16H26ClNO2, Purity:98, SMILES: O[C@H](CCN)C1=CC(OCC2CCCCC2)=CC=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Moxisylyte (hydrochloride), CAS:964-52-3, Molecular Weight: 315.8355, C16H26ClNO3, Purity:98, SMILES: CC(C1=C(OCCN(C)C)C=C(C)C(OC(C)=O)=C1)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Esmolol (hydrochloride), CAS:81161-17-3, Molecular Weight: 331.8349, C16H26ClNO4, Purity:98, SMILES: O=C(OC)CCC1=CC=C(OCC(O)CNC(C)C)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(4-Ethoxy-1,1,1-trifluoro-4-oxobutan-2-yloxy)piperidine-1-carboxylate, CAS:, Molecular Weight: 369.3765, C16H26F3NO5, Purity:95, SMILES: CCOC(=O)CC(C(F)(F)F)OC1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gadodiamide, CAS:131410-48-5, Molecular Weight: 573.6563, C16H26GdN5O8, Purity:98, SMILES: CNC1=O[Gd+3]([N]2(C3)CC4)([N]5(C6)CC2)(O=C(NC)C5)([O-]C7=O)([O-]C6=O)([O-]C3=O)[N]4(C7)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| A-836339, CAS:959746-77-1, Molecular Weight: 310.4548, C16H26N2O2S, Purity:98, SMILES: CC1=C(C)S/C(N1CCOC)=N\C(C2C(C)(C)C2(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pamatolol, CAS:59110-35-9, Molecular Weight: 310.38864, C16H26N2O4, Purity:98, SMILES: O=C(OC)NCCC1=CC=C(OCC(O)CNC(C)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Oxo-2,8-Diaza-Spiro[4.5]Decane-4,8-Dicarboxylic Acid 8-Tert-Butyl Ester 4-Ethyl Ester, CAS:1357352-07-8, Molecular Weight: 326.388, C16H26N2O5, Purity:95, SMILES: CCOC(=O)C1CNC(=O)C11CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Tert-Butyl 4-Ethyl 3-Oxo-2,8-Diazaspiro[4.5]Decane-4,8-Dicarboxylate, CAS:1445951-68-7, Molecular Weight: 326.388, C16H26N2O5, Purity:95, SMILES: CCOC(=O)C1C(=O)NCC11CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(TERT-BUTYL)-4-(1-METHYLCYCLOPROPYL)-6-(PIPERAZIN-1-YL)PYRIMIDINE, CAS:876028-69-2, Molecular Weight: 274.4044, C16H26N4, Purity:95, SMILES: CC(C)(C)c1nc(cc(n1)C1(C)CC1)N1CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| A-802715, CAS:107767-58-8, Molecular Weight: 322.40264, C16H26N4O3, Purity:98, SMILES: O=C(N1CCCCC(C)(O)C)N(C)C2=C(N(CCC)C=N2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Artemether, CAS:71963-77-4, Molecular Weight: 298.3746, C16H26O5, Purity:98, SMILES: C[C@H]1[C@@H](OC)O[C@@]2([H])[C@]34[C@@]([C@H](C)CC[C@]41[H])([H])CC[C@@](O2)(C)OO3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-BOC-3,5-DIMETHYLPYRAZOLE-4-BORONIC ACID PINACOLESTER, CAS:1073354-70-7, Molecular Weight: 322.208, C16H27BN2O4, Purity:95, SMILES: CC1=NN(C(=O)OC(C)(C)C)C(C)=C1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,5-Dibromo-3-Dodecylthiophene, CAS:139100-06-4, Molecular Weight: 331.355, C16H27BrS, Purity:95, SMILES: CCCCCCCCCCCCC1=C(Br)SC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Proparacaine (Hydrochloride), CAS:5875-06-9, Molecular Weight: 330.8502, C16H27ClN2O3, Purity:98, SMILES: O=C(OCCN(CC)CC)C1=CC=C(OCCC)C(N)=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Propoxycaine (hydrochloride), CAS:550-83-4, Molecular Weight: 330.8502, C16H27ClN2O3, Purity:98, SMILES: O=C(OCCN(CC)CC)C1=CC=C(N)C=C1OCCC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3'-O-(tert-butyldiMethylsilyl)-2'-deoxyadenosine, CAS:51549-31-6, Molecular Weight: 365.5028, C16H27N5O3Si, Purity:98, SMILES: CC(C)(C)[Si](C)(C)O[C@H]1C[C@@H](O[C@@H]1CO)n1cnc2c(N)ncnc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mebeverine metabolite Mebeverine alcohol, CAS:14367-47-6, Molecular Weight: 265.3911, C16H27NO2, Purity:98, SMILES: OCCCCN(CC)C(C)CC1=CC=C(OC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Piperidinecarboxylic acid, 4-(2-propen-1-yl)-4-(2-propen-1-yloxy)-, 1,1-dimethylethyl ester, CAS:374795-39-8, Molecular Weight: 281.3905, C16H27NO3, Purity:97, SMILES: C=CCC1(OCC=C)CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,5-dioxopyrrolidin-1-yl dodecanoate, CAS:14565-47-0, Molecular Weight: 297.3899, C16H27NO4, Purity:95, SMILES: CCCCCCCCCCCC(=O)ON1C(=O)CCC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pivalopril, CAS:81045-50-3, Molecular Weight: 329.45488, C16H27NO4S, Purity:98, SMILES: O=C(O)CN(C1CCCC1)C([C@H](C)CSC(C(C)(C)C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Tert-Butyl 2-Methyl 1-Hydroxy-8-Azaspiro[4.5]Decane-2,8-Dicarboxylate, CAS:1363210-51-8, Molecular Weight: 313.3893, C16H27NO5, Purity:95, SMILES: COC(=O)C1CCC2(CCN(CC2)C(=O)OC(C)(C)C)C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(4aR,8S,8aR-6-tert-butyl 8-ethyl hexahydro-2H-pyrano[3,2-c]pyridine-6,8(7H-dicarboxylate, CAS:1422344-50-0, Molecular Weight: 313.3893, C16H27NO5, Purity:95, SMILES: CCOC(=O)[C@H]1CN(C[C@H]2CCCO[C@@H]12)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gabapentin enacarbil, CAS:478296-72-9, Molecular Weight: 329.3887, C16H27NO6, Purity:98, SMILES: O=C(O)CC1(CNC(OC(OC(C(C)C)=O)C)=O)CCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-5,6-dihydropyridine-1(2H)-carboxylate, CAS:885693-20-9, Molecular Weight: 309.209, C16H28BNO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC=C(C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-5,6-dihydropyridine-1(2H)-carboxylate, CAS:286961-14-6, Molecular Weight: 309.209, C16H28BNO4, Purity:96, SMILES: O=C(N1CCC(=CC1)B1OC(C(O1)(C)C)(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gadodiamide (hydrate), CAS:122795-43-1, Molecular Weight: 591.6716, C16H28GdN5O9, Purity:98, SMILES: CNC1=O[Gd+3]([N]2(C3)CC4)([N]5(C6)CC2)(O=C(NC)C5)([O-]C7=O)([O-]C6=O)([O-]C3=O)[N]4(C7)C1.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tromantadine, CAS:53783-83-8, Molecular Weight: 280.40572, C16H28N2O2, Purity:98, SMILES: O=C(COCCN(C)C)NC1(C[C@H](C2)C3)C[C@H]3C[C@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Di-Tert-Butyl 6-Methylene-1,4-Diazepane-1,4-Dicarboxylate, CAS:1373029-10-7, Molecular Weight: 312.4045, C16H28N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC(=C)C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CMPDA, CAS:380607-77-2, Molecular Weight: 376.5345, C16H28N2O4S2, Purity:98, SMILES: O=S(NCCC1=CC=C(CCNS(=O)(C(C)C)=O)C=C1)(C(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-BOC-Amino-(4-N-BOC-piperidinyl)carboxylic acid, CAS:189321-65-1, Molecular Weight: 344.4033, C16H28N2O6, Purity:95, SMILES: O=C(NC1(CCN(CC1)C(=O)OC(C)(C)C)C(=O)O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl1,9-Diazaspiro[5.5]Undecane-9-Carboxylate Oxalate, CAS:0, Molecular Weight: 344.4033, C16H28N2O6, Purity:95, SMILES: OC(=O)C(O)=O.CC(C)(C)OC(=O)N1CCC2(CCCCN2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl2,9-Diazaspiro[5.5]Undecane-9-Carboxylate Oxalate, CAS:0, Molecular Weight: 344.4033, C16H28N2O6, Purity:95, SMILES: OC(=O)C(O)=O.CC(C)(C)OC(=O)N1CCC2(CCCNC2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Aminomethyl-2-Oxa-8-Aza-Spiro[4.5]Decane-8-Carboxylic Acid Tert-Butyl Ester Oxalate, CAS:0, Molecular Weight: 360.4027, C16H28N2O7, Purity:95, SMILES: OC(=O)C(O)=O.CC(C)(C)OC(=O)N1CCC2(COC(CN)C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Amino-1-Oxa-9-Aza-Spiro[5.5]Undecane-9-Carboxylicacidtert-Butylester Oxalate, CAS:0, Molecular Weight: 360.4027, C16H28N2O7, Purity:95, SMILES: OC(=O)C(O)=O.CC(C)(C)OC(=O)N1CCC2(CC1)CC(N)CCO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Biocytin, CAS:576-19-2, Molecular Weight: 372.48292, C16H28N4O4S, Purity:98, SMILES: N[C@@H](CCCCNC(CCCC[C@@H]1SC[C@]([C@]1([H])N2)([H])NC2=O)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Dodecylthiophene, CAS:104934-52-3, Molecular Weight: 252.459, C16H28S, Purity:95, SMILES: CCCCCCCCCCCCC1=CSC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Dodecylthiophene, CAS:104934-52-3, Molecular Weight: 252.459, C16H28S, Purity:95, SMILES: CCCCCCCCCCCCc1ccsc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethylcarbamazine (citrate), CAS:1642-54-2, Molecular Weight: 391.4167, C16H29N3O8, Purity:98, SMILES: O=C(N1CCN(C)CC1)N(CC)CC.O=C(CC(C(O)=O)(O)CC(O)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Biotin LC hydrazide, CAS:109276-34-8, Molecular Weight: 371.49816, C16H29N5O3S, Purity:98, SMILES: O=C(NN)CCCCCNC(CCCC[C@@H]1SC[C@]([C@]1([H])N2)([H])NC2=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Arg-Gly-Glu-Ser, CAS:, Molecular Weight: 447.45, C16H29N7O8, Purity:98, SMILES: [RGES], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(((3aR,4S,6R,6aS)-6-amino-2,2-dimethyltetrahydro-3aH-cyclopenta[d][1,3]dioxol-4-yl)oxy)ethanol (2R,3R,4S,5R)-2,3,4,5-tetrahydroxyhexanedioate, CAS:376608-65-0, Molecular Weight: 427.401, C16H29NO12, Purity:95, SMILES: O[C@@H]([C@@H](O)[C@@H](O)C(O)=O)[C@@H](O)C(O)=O.[H][C@@]12OC(C)(C)O[C@@H]1[C@H](C[C@H]2N)OCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(2-oxotetrahydrofuran-3-yldodecanamide, CAS:0, Molecular Weight: 283.4064, C16H29NO3, Purity:95, SMILES: CCCCCCCCCCCC(=O)NC1CCOC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-Methyl 2-Bi-((Tert-ButoxycarbonylAmino-5-Hydroxypentanoate, CAS:367968-06-7, Molecular Weight: 347.404, C16H29NO7, Purity:95, SMILES: COC(=O)[C@H](CCCO)N(C(=O)OC(C)(C)C)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)piperidine-1-carboxylate, CAS:1048970-17-7, Molecular Weight: 311.225, C16H30BNO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Piroctone olamine, CAS:68890-66-4, Molecular Weight: 298.421, C16H30N2O3, Purity:98, SMILES: O=C1C=C(C)C=C(CC(C)CC(C)(C)C)N1O.NCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2,6-bis((tert-butoxycarbonyl)amino)hexanoic acid, CAS:2483-46-7, Molecular Weight: 346.4192, C16H30N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)NCCCC[C@H](NC(=O)OC(C)(C)C)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-tert-butyl 2-((tert-butoxycarbonylamino-5-(methoxy(methylamino-5-oxopentanoate, CAS:0, Molecular Weight: 346.4192, C16H30N2O6, Purity:95, SMILES: CON(C)C(=O)CC[C@H](NC(=O)OC(C)(C)C)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Palmitelaidic Acid, CAS:10030-73-6, Molecular Weight: 254.4082, C16H30O2, Purity:98, SMILES: CCCCCC/C=C/CCCCCCCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hexadecanedioic acid, CAS:505-54-4, Molecular Weight: 286.407, C16H30O4, Purity:98, SMILES: OC(=O)CCCCCCCCCCCCCCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Tributylstannyl)thiophene, CAS:54663-78-4, Molecular Weight: 373.184, C16H30SSn, Purity:95, SMILES: CCCC[Sn](C1=CC=CS1)(CCCC)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oseltamivir (phosphate), CAS:204255-11-8, Molecular Weight: 410.3997, C16H31N2O8P, Purity:98, SMILES: O=C(OCC)C1=C[C@H]([C@@H]([C@H](C1)N)NC(C)=O)OC(CC)CC.OP(O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-((tert-butyldimethylsilyl)oxy)-5-oxopiperidine-1-carboxylate, CAS:2070015-35-7, Molecular Weight: 329.5071, C16H31NO4Si, Purity:97, SMILES: CC(C)(C)OC(=O)N1CC(CC(=O)C1)O[Si](C)(C)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PALMITALDEHYDE, CAS:629-80-1, Molecular Weight: 240.4247, C16H32O, Purity:95, SMILES: CCCCCCCCCCCCCCCC=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl Pentadecanoate, CAS:7132-64-1, Molecular Weight: 256.4241, C16H32O2, Purity:95, SMILES: CCCCCCCCCCCCCCC(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N,N-Bis(2-hydroxyethyl)dodecanamide, CAS:120-40-1, Molecular Weight: 287.4381, C16H33NO3, Purity:98, SMILES: CCCCCCCCCCCC(=O)N(CCO)CCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SP187, CAS:615253-61-7, Molecular Weight: 319.43692, C16H33NO5, Purity:98, SMILES: OC[C@H]1N(C[C@H](O)[C@@H](O)[C@@H]1O)CCCCCCCCCOC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Hexadecanol, CAS:36653-82-4, Molecular Weight: 242.4406, C16H34O, Purity:95, SMILES: CCCCCCCCCCCCCCCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Hexanol, 6,6'-oxybis[2,2-dimethyl-, CAS:300762-25-8, Molecular Weight: 274.43936, C16H34O3, Purity:98, SMILES: OCC(C)(C)CCCCOCCCCC(C)(C)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tributyl(1-ethoxyvinyl)tin, CAS:97674-02-7, Molecular Weight: 361.151, C16H34OSn, Purity:95, SMILES: CCO[C-]=C.[CH2-]CCC.[CH2-]CCC.[CH2-]CCC.[Sn+4], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bis(2-ethylhexyl) hydrogen phosphate, CAS:298-12-4, Molecular Weight: 322.4205, C16H35O4P, Purity:95, SMILES: CCCCC(CC)COP(O)(=O)OCC(CC)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetrabutylammonium bromide, CAS:1643-19-2, Molecular Weight: 322.368, C16H36BrN, Purity:95, SMILES: CCCC[N](Br)(CCCC)(CCCC)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetrabutylammonium hexafluorophosphate(V), CAS:3109-63-5, Molecular Weight: 387.4279, C16H36F6NP, Purity:98, SMILES: F[P-](F)(F)(F)(F)F.CCCC[N+](CCCC)(CCCC)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetrabutylammonium fluoride, CAS:429-41-4, Molecular Weight: 261.4621, C16H36FN, Purity:97, SMILES: [F-].CCCC[N+](CCCC)(CCCC)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tetrabutylammonium iodide, CAS:311-28-4, Molecular Weight: 369.3682, C16H36IN, Purity:95, SMILES: [I-].CCCC[N+](CCCC)(CCCC)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetrabutylammonium hydrosulfate, CAS:32503-27-8, Molecular Weight: 339.534, C16H37NO4S, Purity:95, SMILES: OS([O-])(=O)=O.CCCC[N+](CCCC)(CCCC)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Decamethonium (Bromide), CAS:541-22-0, Molecular Weight: 418.2943, C16H38Br2N2, Purity:98, SMILES: C[N+](C)(C)CCCCCCCCCC[N+](C)(C)C.[Br-].[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| tetrabutylammonium fluoride trihydrate, CAS:87749-50-6, Molecular Weight: 315.508, C16H42FNO3, Purity:95, SMILES: O.O.O.[F-].CCCC[N+](CCCC)(CCCC)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,3,6,8-tetrabromopyrene, CAS:128-63-2, Molecular Weight: 517.835, C16H6Br4, Purity:95, SMILES: Brc1cc(Br)c2ccc3c(Br)cc(Br)c4ccc1c2c34, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,3,3,4-biphenyl tetracarboxylic dianhydride, CAS:36978-41-3, Molecular Weight: 294.2152, C16H6O6, Purity:95, SMILES: O=C1OC(=O)C2=C(C=CC=C12)C1=CC2=C(C=C1)C(=O)OC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Quinolinecarbonitrile, 8-chloro-4-[(3-chloro-4-fluorophenyl)amino]-6-nitro-, CAS:915369-47-0, Molecular Weight: 377.157, C16H7Cl2FN4O2, Purity:95, SMILES: N#Cc1cnc2c(c1Nc1ccc(c(c1)Cl)F)cc(cc2Cl)[N+](=O)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Febuxostat D9, CAS:1246819-50-0, Molecular Weight: 325.430296002, C16H7D9N2O3S, Purity:98, SMILES: CC1=C(C(O)=O)SC(C2=CC=C(OC([2H])([2H])C(C([2H])([2H])[2H])([2H])C([2H])([2H])[2H])C(C#N)=C2)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyranine, CAS:6358-69-6, Molecular Weight: 524.3851, C16H7Na3O10S3, Purity:98, SMILES: O=S(C1=C(C2=C34)C=CC4=C(O)C=C(S(=O)([O-])=O)C3=CC=C2C(S(=O)([O-])=O)=C1)([O-])=O.[Na+].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,6-dibromopyrene, CAS:27973-29-1, Molecular Weight: 360.043, C16H8Br2, Purity:95, SMILES: Brc1ccc2ccc3c(Br)ccc4ccc1c2c34, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,7-dibromopyrene, CAS:102587-98-4, Molecular Weight: 360.043, C16H8Br2, Purity:95, SMILES: Brc1cc2ccc3cc(Br)cc4ccc(c1)c2c34, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzoic acid, 4-(3-cyano-5,6-difluoro-1H-indol-1-yl)-2-hydroxy-, CAS:1071970-13-2, Molecular Weight: 314.2431264, C16H8F2N2O3, Purity:98, SMILES: O=C(O)C1=CC=C(N2C=C(C#N)C3=C2C=C(F)C(F)=C3)C=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HIF-2α-IN-1, CAS:1799948-06-3, Molecular Weight: 405.2961, C16H8F5NO4S, Purity:98, SMILES: N#CC1=CC(F)=CC(OC2=CC=C3C([C@@H](O)C(F)(F)S3(=O)=O)=C2C(F)F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SJB3-019A, CAS:, Molecular Weight: 276.2463, C16H8N2O3, Purity:98, SMILES: O=C1C2=C(OC(C3=CC=CN=C3)=N2)C(C4=CC=CC=C41)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Bromopyrene, CAS:1714-29-0, Molecular Weight: 281.147, C16H9Br, Purity:95, SMILES: BrC1=C2C=CC3=CC=CC4=C3C2=C(C=C1)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Bromopyrene, CAS:1714-29-0, Molecular Weight: 281.147, C16H9Br, Purity:96, SMILES: Brc1ccc2c3c1ccc1c3c(cc2)ccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tartrazine, CAS:1934-21-0, Molecular Weight: 534.3633, C16H9N4Na3O9S2, Purity:98, SMILES: O=C(C(C1N=NC2=CC=C(S(=O)([O-])=O)C=C2)=NN(C3=CC=C(S(=O)([O-])=O)C=C3)C1=O)[O-].[Na+].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| DUBs-IN-3, CAS:924296-17-3, Molecular Weight: 287.27556, C16H9N5O, Purity:98, SMILES: C=CCO/N=C1C2=C(N=C(C#N)C(C#N)=N2)C3=CC=CC=C/13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Liraglutide, CAS:204656-20-2, Molecular Weight: 3751.202, C172H265N43O51, Purity:98, SMILES: [HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cecropin B, CAS:80451-05-4, Molecular Weight: 3834.67, C176H302N52O41S, Purity:98, SMILES: [Cecropin B], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-((4-CHLOROPHENYL)(CYANO)METHYL)-2,5-DIFLUORO-N-(THIAZOL-2-YL)BENZENESULFONAMIDE, CAS:1799412-44-4, Molecular Weight: 425.86, C17H10ClF2N3O2S2, Purity:95, SMILES: Fc1cc(c(F)cc1C(C#N)c1ccc(Cl)cc1)S(=O)(=O)Nc1nccs1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SD-208, CAS:627536-09-8, Molecular Weight: 352.7529, C17H10ClFN6, Purity:98, SMILES: FC1=CC=C(Cl)C=C1C2=NC3=NC=CN=C3C(NC4=CC=NC=C4)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Aldose reductase-IN-1, CAS:1355612-71-3, Molecular Weight: 421.3532, C17H10F3N5O3S, Purity:98, SMILES: O=C1C2=NC=CN=C2C(CC(O)=O)=NN1CC3=NC4=C(C=CC(C(F)(F)F)=C4)S3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KPT-8602, CAS:1642300-52-4, Molecular Weight: 428.2913, C17H10F6N6O, Purity:98, SMILES: FC(F)(F)C1=CC(C(F)(F)F)=CC(C2=NN(/C=C(C3=CN=CN=C3)/C(N)=O)C=N2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KPT-8602 (Z-isomer), CAS:1642300-78-4, Molecular Weight: 428.2913, C17H10F6N6O, Purity:98, SMILES: O=C(N)/C(C1=CN=CN=C1)=C\N2N=C(C3=CC(C(F)(F)F)=CC(C(F)(F)F)=C3)N=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SR1078, CAS:1246525-60-9, Molecular Weight: 431.2524288, C17H10F9NO2, Purity:98, SMILES: O=C(NC1=CC=C(C(C(F)(F)F)(C(F)(F)F)O)C=C1)C2=CC=C(C(F)(F)F)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SR178, CAS:124655-17-0, Molecular Weight: 431.2524, C17H10F9NO2, Purity:99, SMILES: OC(C(F)(F)F)(C(F)(F)F)c1ccc(cc1)NC(=O)c1ccc(cc1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fluorescamine, CAS:38183-12-9, Molecular Weight: 278.2589, C17H10O4, Purity:98, SMILES: O=C1C2(OC(C3=C2C=CC=C3)=O)OC=C1C4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzophenonetetracarboxylic acid, CAS:2479-49-4, Molecular Weight: 358.2559, C17H10O9, Purity:98, SMILES: O=C(C1=CC=C(C(O)=O)C(C(O)=O)=C1)C2=CC=C(C(O)=O)C(C(O)=O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Broxaldine, CAS:3684-46-6, Molecular Weight: 421.0827, C17H11Br2NO2, Purity:98, SMILES: CC1=NC2=C(OC(C3=CC=CC=C3)=O)C(Br)=CC(Br)=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ranirestat, CAS:147254-64-6, Molecular Weight: 420.1893, C17H11BrFN3O4, Purity:98, SMILES: O=C(N1CC2=CC=C(Br)C=C2F)C3=CC=CN3[C@]4(C(NC(C4)=O)=O)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LDN-57444, CAS:668467-91-2, Molecular Weight: 397.6398, C17H11Cl3N2O3, Purity:98, SMILES: O=C1N(CC2=CC(Cl)=CC=C2Cl)C3=C(C=C(Cl)C=C3)/C1=N/OC(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Anguizole, CAS:442666-98-0, Molecular Weight: 408.8096, C17H11ClF2N4O2S, Purity:98, SMILES: FC(Cl)(C1=CC(C2=CC=CO2)=NC3=CC(C(NCC4=CC=CS4)=O)=NN31)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Doravirine, CAS:1338225-97-0, Molecular Weight: 425.7491, C17H11ClF3N5O3, Purity:98, SMILES: N#CC1=CC(OC2=C(C(F)(F)F)C=CN(CC(N3C)=NNC3=O)C2=O)=CC(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-((6-Chloropyridazin-3-yl)methyl)-2-(2-fluorophenyl)-5H-imidazo[4,5-c]pyridine, CAS:1000787-76-7, Molecular Weight: 339.754, C17H11ClFN5, Purity:95, SMILES: Clc1ccc(nn1)Cn1ccc2c(c1)nc(n2)c1ccccc1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PS-1145, CAS:431898-65-6, Molecular Weight: 322.7484, C17H11ClN4O, Purity:98, SMILES: O=C(C1=CC=CN=C1)NC2=CC(Cl)=CC3=C2NC4=C3C=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KYA1797K, CAS:1956356-56-1, Molecular Weight: 442.50734, C17H11KN2O6S2, Purity:98, SMILES: O=C([O-])CCN(C/1=O)C(SC1=C/C2=CC=C(C3=CC=C([N+]([O-])=O)C=C3)O2)=S.[K+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Letrozole, CAS:112809-51-5, Molecular Weight: 285.30274, C17H11N5, Purity:98, SMILES: N#CC1=CC=C(C(N2C=NC=N2)C3=CC=C(C#N)C=C3)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ocinaplon, CAS:96604-21-6, Molecular Weight: 301.3021, C17H11N5O, Purity:95, SMILES: O=C(c1cnn2c1nccc2c1ccncc1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzbromarone, CAS:3562-84-3, Molecular Weight: 424.0834, C17H12Br2O3, Purity:98, SMILES: O=C(C1=CC(Br)=C(O)C(Br)=C1)C2=C(CC)OC3=CC=CC=C23, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-BROMO-1-(4-HYDROXY-2-METHYLPHENYL)-4-OXO-1,4-DIHYDROQUINOLINE-3-CARBOXYLIC ACID, CAS:1447607-26-2, Molecular Weight: 374.185, C17H12BrNO4, Purity:95, SMILES: Cc1cc(O)ccc1-n1cc(C(O)=O)c(=O)c2ccc(Br)cc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BMS-3, CAS:1338247-30-5, Molecular Weight: 429.2712, C17H12Cl2F2N4OS, Purity:98, SMILES: O=C(C1CC1)NC2=NC=C(C3=CC(C(F)F)=NN3C4=C(Cl)C=CC=C4Cl)S2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MLN 2480, CAS:1096708-71-2, Molecular Weight: 506.2890896, C17H12Cl2F3N7O2S, Purity:98, SMILES: NC1=NC=NC(C(N[C@@H](C2=NC=C(C(NC3=NC=C(Cl)C(C(F)(F)F)=C3)=O)S2)C)=O)=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MGL-3196, CAS:920509-32-6, Molecular Weight: 435.221, C17H12Cl2N6O4, Purity:98, SMILES: N#CC1=NN(C2=CC(Cl)=C(OC(C=C3C(C)C)=NNC3=O)C(Cl)=C2)C(NC1=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SC-560, CAS:188817-13-2, Molecular Weight: 352.7382, C17H12ClF3N2O, Purity:98, SMILES: FC(C1=NN(C2=CC=C(OC)C=C2)C(C3=CC=C(Cl)C=C3)=C1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(3-CHLOROBENZYL)-3-CYANO-N-(THIAZOL-2-YL)BENZENESULFONAMIDE, CAS:1799439-21-6, Molecular Weight: 389.879, C17H12ClN3O2S2, Purity:95, SMILES: Clc1cccc(Cc2ccc(cc2C#N)S(=O)(=O)Nc2nccs2)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 1-chloro-4-hydroxy-7-phenoxyisoquinoline-3-carboxylate, CAS:1421312-33-5, Molecular Weight: 329.734, C17H12ClNO4, Purity:95, SMILES: COC(=O)C1=NC(Cl)=C2C=C(OC3=CC=CC=C3)C=CC2=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nifedipine D6, CAS:1188266-14-9, Molecular Weight: 352.371590668, C17H12D6N2O6, Purity:98, SMILES: CC(N1)=C(C(OC([2H])([2H])[2H])=O)C(C(C(OC([2H])([2H])[2H])=O)=C1C)C2=CC=CC=C2[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PT-2385, CAS:1672665-49-4, Molecular Weight: 383.3417, C17H12F3NO4S, Purity:98, SMILES: N#CC1=CC(F)=CC(OC2=CC=C(S(=O)(C)=O)C3=C2CC(F)(F)[C@H]3O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| T0901317, CAS:293754-55-9, Molecular Weight: 481.3327, C17H12F9NO3S, Purity:98, SMILES: OC(C(F)(F)F)(C(F)(F)F)C1=CC=C(N(CC(F)(F)F)S(C2=CC=CC=C2)(=O)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| STK16-IN-1, CAS:1223001-53-3, Molecular Weight: 293.2950832, C17H12FN3O, Purity:98, SMILES: FC1=CC=C(N2C(C(C=CC2=O)=CN3)=C4C3=NC=C4)C=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-fluorophenyl)-5-[4-(methylsulfonyl)phenyl]-pyrazole-3-carbonitrile, CAS:134729-13-8, Molecular Weight: 341.3594832, C17H12FN3O2S, Purity:98, SMILES: N#CC1=NN(C2=CC=C(F)C=C2)C(C3=CC=C(S(=O)(C)=O)C=C3)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FPTQ, CAS:864863-72-9, Molecular Weight: 305.3091, C17H12FN5, Purity:98, SMILES: FC(N=CC=C1)=C1N2N=NC(C3=CC4=C(C=C3)N=CC=C4)=C2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-amino-6-(1-(2-fluorobenzyl)-1H-pyrazolo[3,4-b]pyridin-3-yl)-1,3,5-triazine-2-carboxylic acid, CAS:, Molecular Weight: 365.3213, C17H12FN7O2, Purity:95, SMILES: O=C(C1=NC(N)=NC(C2=NN(CC3=CC=CC=C3F)C4=NC=CC=C42)=N1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3-IODO-1H-INDAZOL-5-YL)SPIRO[CYCLOPROPANE-1,3'-INDOLIN]-2'-ONE, CAS:1799434-54-0, Molecular Weight: 401.2012, C17H12IN3O, Purity:95, SMILES: Ic1n[nH]c2ccc(cc12)C1CC11C(=O)Nc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PFK-015, CAS:4382-63-2, Molecular Weight: 260.29, C17H12N2O, Purity:98, SMILES: O=C(C1=CC=NC=C1)/C=C/C2=NC3=CC=CC=C3C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(methoxy(4-phenoxyphenyl)methylene)malononitrile, CAS:330792-69-3, Molecular Weight: 276.2894, C17H12N2O2, Purity:95, SMILES: COC(=C(C#N)C#N)c1ccc(Oc2ccccc2)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Meisoindigo, CAS:97207-47-1, Molecular Weight: 276.2894, C17H12N2O2, Purity:98, SMILES: O=C1N(C)C2=C(C=CC=C2)/C1=C3C(NC4=C\3C=CC=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TC-DAPK 6, CAS:315694-89-4, Molecular Weight: 276.2894, C17H12N2O2, Purity:98, SMILES: O=C(OC(/C=C/C1=CC=CC=C1)=N/2)C2=C/C3=CC=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY-364947, CAS:396129-53-6, Molecular Weight: 272.304, C17H12N4, Purity:98, SMILES: C1(C2=CNN=C2C3=NC=CC=C3)=CC=NC4=CC=CC=C14, HPLC, NMR, LCMS is ok, stock more than 10g. |
| E7820, CAS:289483-69-8, Molecular Weight: 336.36778, C17H12N4O2S, Purity:98, SMILES: O=S(C1=CC(C#N)=CC=C1)(NC2=C(NC=C3C#N)C3=C(C)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Quinotolast (sodium), CAS:101193-62-8, Molecular Weight: 371.3048007, C17H12N6NaO3+, Purity:98, SMILES: O=C(NC1=NN=NN1)C2=CC(OC3=CC=CC=C3)=C4N(C2=O)C=CC=C4.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1-Naphthalenyloxy-Benzoic Acid, CAS:613669-18-4, Molecular Weight: 264.2754, C17H12O3, Purity:95, SMILES: OC(=O)C1=CC=CC=C1OC1=CC=CC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| R162, CAS:64302-87-0, Molecular Weight: 264.27538, C17H12O3, Purity:98, SMILES: O=C1C2=C(C=CC=C2)C(C3=CC=C(CC=C)C(O)=C13)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PTC-209, CAS:315704-66-6, Molecular Weight: 495.191, C17H13Br2N5OS, Purity:98, SMILES: CC1=C(C2=CSC(NC3=C(Br)C=C(OC)C=C3Br)=N2)N4C=CC=NC4=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lesinurad (sodium), CAS:1151516-14-1, Molecular Weight: 426.2628, C17H13BrN3NaO2S, Purity:98, SMILES: [O-]C(CSC1=NN=C(Br)N1C2=C3C=CC=CC3=C(C4CC4)C=C2)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD168393, CAS:194423-15-9, Molecular Weight: 369.2153, C17H13BrN4O, Purity:98, SMILES: C=CC(NC1=CC2=C(NC3=CC=CC(Br)=C3)N=CN=C2C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| YK-4-279, CAS:1037184-44-3, Molecular Weight: 366.1954, C17H13Cl2NO4, Purity:98, SMILES: ClC1=C2C(C(O)(CC(C3=CC=C(OC)C=C3)=O)C(N2)=O)=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JIB-04, CAS:199596-05-9, Molecular Weight: 308.7649, C17H13ClN4, Purity:98, SMILES: ClC1=CN=C(N/N=C(C2=CC=CC=C2)/C3=NC=CC=C3)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AVE-3085, CAS:450348-85-3, Molecular Weight: 317.2868, C17H13F2NO3, Purity:98, SMILES: O=C(C1=CC=C(OC(F)(F)O2)C2=C1)NC3CC4=C(C=CC=C4)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((1-(2-(trifluoromethyl)phenyl)ethoxy)carbonyl)benzoic acid, CAS:127733-45-3, Molecular Weight: 338.2779, C17H13F3O4, Purity:96, SMILES: O=C(c1ccccc1C(=O)O)OC(c1ccccc1C(F)(F)F)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(2-fluoro-4-nitrophenoxy)-6,7-dimethoxyquinoline, CAS:516526-44-6, Molecular Weight: 344.2939, C17H13FN2O5, Purity:99, SMILES: COc1cc2nccc(Oc3ccc(cc3F)[N+]([O-])=O)c2cc1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E-3-((1-Methyl-1H-Indol-3-YlMethylene-1H-Pyrrolo[3,2-B]Pyridin-2(3H-One, CAS:1243657-78-4, Molecular Weight: 275.3046, C17H13N3O, Purity:95, SMILES: CN1C=C(\C=C2\C(=O)NC3=C2N=CC=C3)C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GW 441756, CAS:504433-23-2, Molecular Weight: 275.30462, C17H13N3O, Purity:98, SMILES: O=C1/C(C2=NC=CC=C2N1)=C\C3=CN(C)C4=C3C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AS8351, CAS:796-42-9, Molecular Weight: 291.304, C17H13N3O2, Purity:98, SMILES: O=C(C1=CC=NC=C1)N/N=C/C2=C3C=CC=CC3=CC=C2O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-BENZYL-3-CYANO-N-(THIAZOL-2-YL)BENZENESULFONAMIDE, CAS:, Molecular Weight: 355.434, C17H13N3O2S2, Purity:95, SMILES: O=S(=O)(Nc1nccs1)c1ccc(Cc2ccccc2)c(c1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phthalylsulfathiazole, CAS:85-73-4, Molecular Weight: 403.4322, C17H13N3O5S2, Purity:98, SMILES: O=C(O)C1=CC=CC=C1C(NC2=CC=C(S(=O)(NC3=NC=CS3)=O)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PYR-41, CAS:418805-02-4, Molecular Weight: 371.301, C17H13N3O7, Purity:98, SMILES: O=C(N1)/C(C(N1C2=CC=C(C=C2)C(OCC)=O)=O)=C/C3=CC=C([N+]([O-])=O)O3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RepSox, CAS:446859-33-2, Molecular Weight: 287.3186, C17H13N5, Purity:98, SMILES: CC1=NC(C2=NNC=C2C3=NC4=CC=CN=C4C=C3)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine, CAS:330786-24-8, Molecular Weight: 303.318, C17H13N5O, Purity:95, SMILES: Nc1ncnc2[nH]nc(-c3ccc(Oc4ccccc4)cc3)c12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB-334867 (free base), CAS:792173-99-0, Molecular Weight: 319.3174, C17H13N5O2, Purity:98, SMILES: O=C(NC1=CC(OC(C)=N2)=C2C=C1)NC3=CC=NC4=CC=CN=C43, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(3-PhenylallylPhthalimide, CAS:17480-07-8, Molecular Weight: 263.2906, C17H13NO2, Purity:95, SMILES: O=C1N(C\C=C\C2=CC=CC=C2)C(=O)C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2,4-Diphenyl-1,3-Thiazol-5-YlAcetic Acid, CAS:21256-15-5, Molecular Weight: 295.356, C17H13NO2S, Purity:95, SMILES: OC(=O)CC1=C(N=C(S1)C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| UPF 1069, CAS:1048371-03-4, Molecular Weight: 279.29, C17H13NO3, Purity:98, SMILES: O=C1NC=CC2=C1C=CC=C2OCC(C3=CC=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenepropanoic acid,-[(1,3-dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]-, (R)-, CAS:310404-47-8, Molecular Weight: 311.2888, C17H13NO5, Purity:95, SMILES: OC(=O)[C@H](ON1C(=O)c2c(C1=O)cccc2)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PTC-209 (hydrobromide), CAS:1217022-63-3, Molecular Weight: 576.103, C17H14Br3N5OS, Purity:98, SMILES: CC1=C(C2=CSC(NC3=C(Br)C=C(OC)C=C3Br)=N2)N4C=CC=NC4=N1.Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N4-Benzyl-N2-(4-Bromophenyl-5-Fluoropyrimidine-2,4-Diamine, CAS:0, Molecular Weight: 373.222, C17H14BrFN4, Purity:95, SMILES: FC1=CN=C(NC2=CC=C(Br)C=C2)NC1=NCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-CYANO-N-(1-PHENYLETHYL)ACRYLAMIDE, CAS:1240041-69-3, Molecular Weight: 356.217, C17H14BrN3O, Purity:95, SMILES: C[C@H](NC(=O)C(=C\C1=NC(Br)=CC=C1)\C#N)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WP1066, CAS:857064-38-1, Molecular Weight: 356.2166, C17H14BrN3O, Purity:98, SMILES: O=C(N[C@H](C1=CC=CC=C1)C)/C(C#N)=C/C2=NC(Br)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lesinurad, CAS:878672-00-5, Molecular Weight: 404.2809, C17H14BrN3O2S, Purity:98, SMILES: BrC1=NN=C(SCC(O)=O)N1C2=C3C(C=CC=C3)=C(C4CC4)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(5-bromo-1-tosyl-1H-indol-3-ylethanone, CAS:265111-01-1, Molecular Weight: 392.267, C17H14BrNO3S, Purity:95, SMILES: CC(=O)C1=CN(C2=C1C=C(Br)C=C2)S(=O)(=O)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Roflumilast, CAS:162401-32-3, Molecular Weight: 403.2075, C17H14Cl2F2N2O3, Purity:98, SMILES: O=C(NC1=C(Cl)C=NC=C1Cl)C2=CC=C(OC(F)F)C(OCC3CC3)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Roflumilast, CAS:162401-32-3, Molecular Weight: 403.207, C17H14Cl2F2N2O3, Purity:98, SMILES: FC(F)Oc1ccc(cc1OCC1CC1)C(=O)Nc1c(Cl)cncc1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BMS-5, CAS:1338247-35-0, Molecular Weight: 431.2871, C17H14Cl2F2N4OS, Purity:98, SMILES: CC(C)C(NC1=NC=C(C2=CC(C(F)F)=NN2C3=C(Cl)C=CC=C3Cl)S1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CI-1040, CAS:212631-79-3, Molecular Weight: 478.6595, C17H14ClF2IN2O2, Purity:98, SMILES: O=C(C1=CC=C(C(F)=C1NC2=CC=C(I)C=C2Cl)F)NOCC3CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PLX-4720, CAS:918505-84-7, Molecular Weight: 413.8262, C17H14ClF2N3O3S, Purity:98, SMILES: O=S(NC1=CC=C(C(C(C2=CNC3=NC=C(C=C23)Cl)=O)=C1F)F)(CCC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Doxefazepam, CAS:40762-15-0, Molecular Weight: 348.7560632, C17H14ClFN2O3, Purity:98, SMILES: O=C1N(CCO)C2=CC=C(Cl)C=C2C(C3=CC=CC=C3F)=NC1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Chloro-2-(3,5-DimethylphenylQuinoline, CAS:1404491-66-2, Molecular Weight: 267.753, C17H14ClN, Purity:95, SMILES: CC1=CC(=CC(C)=C1)C1=NC2=CC=CC(Cl)=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl-1-[4-(AminosulfonylPhenyl]-5-(4-Chlorophenyl-1H-Pyrazole-3-Carboxylate, CAS:170571-20-7, Molecular Weight: 391.829, C17H14ClN3O4S, Purity:95, SMILES: COC(=O)C1=NN(C(=C1)C1=CC=C(Cl)C=C1)C1=CC=C(C=C1)S(N)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB-334867, CAS:249889-64-3, Molecular Weight: 355.7784, C17H14ClN5O2, Purity:98, SMILES: O=C(NC1=CC(OC(C)=N2)=C2C=C1)NC3=CC=NC4=CC=CN=C43.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(2-(4-Chlorophenoxy)phenyl)-4-hydroxy-1-methyl-1H-pyrrol-2(5H)-one, CAS:934996-78-8, Molecular Weight: 315.751, C17H14ClNO3, Purity:95, SMILES: Clc1ccc(cc1)Oc1ccccc1C1=C(O)CN(C1=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TA-1801, CAS:88352-44-7, Molecular Weight: 331.7504, C17H14ClNO4, Purity:98, SMILES: O=C(OCC)CC1=C(C2=CC=CO2)OC(C3=CC=C(Cl)C=C3)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chlorpromazine (D6 hydrochloride), CAS:1228182-46-4, Molecular Weight: 361.3621, C17H14D6Cl2N2S, Purity:98, SMILES: ClC1=CC=C(SC(C=CC=C2)=C2N3CCCN(C([2H])([2H])[2H])C([2H])([2H])[2H])C3=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SP-13786, CAS:1448440-52-5, Molecular Weight: 344.3155, C17H14F2N4O2, Purity:98, SMILES: O=C(C1=CC=NC2=CC=CC=C12)NCC(N3[C@H](C#N)CC(F)(F)C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Deracoxib, CAS:169590-41-4, Molecular Weight: 397.3716, C17H14F3N3O3S, Purity:98, SMILES: O=S(C1=CC=C(N2N=C(C(F)F)C=C2C3=CC=C(OC)C(F)=C3)C=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| propane-2,2-diylbis(4,1-phenylene) bis(trifluoromethanesulfonate), CAS:139725-20-5, Molecular Weight: 492.41, C17H14F6O6S2, Purity:95, SMILES: CC(C)(c1ccc(OS(=O)(=O)C(F)(F)F)cc1)c1ccc(OS(=O)(=O)C(F)(F)F)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,3'-Diindolylmethane, CAS:1968-05-4, Molecular Weight: 246.3065, C17H14N2, Purity:98, SMILES: C1(CC2=CNC3=C2C=CC=C3)=CNC4=C1C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ellipticine, CAS:519-23-3, Molecular Weight: 246.3065, C17H14N2, Purity:98, SMILES: CC1=C(C=NC=C2)C2=C(C)C(N3)=C1C4=C3C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WD2000-012547, CAS:283172-68-9, Molecular Weight: 262.30586, C17H14N2O, Purity:98, SMILES: O=C(NCC1)C2=CC=CC3=C2C1=C(C4=CC=CC=C4)N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AG-490, CAS:133550-30-8, Molecular Weight: 294.3047, C17H14N2O3, Purity:98, SMILES: OC1=C(C=CC(/C=C(C(NCC2=CC=CC=C2)=O)\C#N)=C1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PHCCC, CAS:179068-02-1, Molecular Weight: 294.3047, C17H14N2O3, Purity:98, SMILES: O=C(C12C(C2)/C(C3=CC=CC=C3O1)=N\O)NC4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oxamflatin, CAS:151720-43-3, Molecular Weight: 342.36906, C17H14N2O4S, Purity:98, SMILES: O=C(NO)/C=C/C#CC1=CC=CC(NS(=O)(C2=CC=CC=C2)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Iguratimod, CAS:123663-49-0, Molecular Weight: 374.3679, C17H14N2O6S, Purity:98, SMILES: O=C1C2=CC(OC3=CC=CC=C3)=C(C=C2OC=C1NC([H])=O)NS(=O)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Senexin A, CAS:1366002-50-7, Molecular Weight: 274.3199, C17H14N4, Purity:98, SMILES: N#CC1=CC=C2C(C(NCCC3=CC=CC=C3)=NC=N2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-(QUINOLIN-2-YL)ETHYL)PYRROLO[1,2-D][1,2,4]TRIAZIN-1(2H)-ONE, CAS:1799434-60-8, Molecular Weight: 290.3193, C17H14N4O, Purity:95, SMILES: O=c1n(CCc2ccc3ccccc3n2)ncn2cccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IRAK inhibitor 2, CAS:928333-30-6, Molecular Weight: 306.3187, C17H14N4O2, Purity:98, SMILES: OC1=CC=C(C=C1)C2=CN=C3C=CC(NCC4=CC=CO4)=NN32, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(5-METHOXY-2-(PYRIDIN-2-YL)PYRIMIDIN-4-YL)-1H-INDAZOL-6-AMINE, CAS:1447606-32-7, Molecular Weight: 318.3327, C17H14N6O, Purity:95, SMILES: COc1cnc(nc1Nc1ccc2cn[nH]c2c1)-c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TZ9, CAS:1002789-86-7, Molecular Weight: 366.33086, C17H14N6O4, Purity:98, SMILES: O=C(OCC1=NC(N)=NC(NC2=CC=CC=C2)=N1)C3=CC=C([N+]([O-])=O)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| c-Met inhibitor 1, CAS:1357072-61-7, Molecular Weight: 362.4117, C17H14N8S, Purity:98, SMILES: CN1N=CC(C2=NN3C(C=C2)=NN=C3SC4=CC5=CN(C)N=C5C=C4)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| R803, CAS:67700-30-5, Molecular Weight: 266.29126, C17H14O3, Purity:98, SMILES: OC(C(C1=CC=CC2=C1OC=C2C3=CC=CC=C3)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Naphthyl p-Toluenesulfonate, CAS:7385-85-5, Molecular Weight: 298.356, C17H14O3S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)Oc1ccc2c(c1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Zaltoprofen, CAS:74711-43-6, Molecular Weight: 298.3563, C17H14O3S, Purity:98, SMILES: CC(C1=CC=C(SC2=C3C=CC=C2)C(CC3=O)=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4',7-Dimethoxyisoflavone, CAS:1157-39-7, Molecular Weight: 282.2906, C17H14O4, Purity:98, SMILES: O=C1C(C2=CC=C(OC)C=C2)=COC3=CC(OC)=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DMXAA, CAS:117570-53-3, Molecular Weight: 282.2906, C17H14O4, Purity:98, SMILES: O=C(O)CC1=CC=CC(C2=O)=C1OC3=C2C=CC(C)=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rofecoxib, CAS:162011-90-7, Molecular Weight: 314.3557, C17H14O4S, Purity:98, SMILES: O=C1OCC(C2=CC=C(S(=O)(C)=O)C=C2)=C1C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3,4-Dihydroxyphenyl)-6-ethyl-3-hydroxychromen-4-one, CAS:1313738-76-9, Molecular Weight: 298.2901, C17H14O5, Purity:95, SMILES: CCc1ccc2c(c1)c(=O)c(c(o2)c1ccc(c(c1)O)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7,4'-Di-O-methylapigenin, CAS:5128-44-9, Molecular Weight: 298.2901, C17H14O5, Purity:98, SMILES: O=C1C=C(C2=CC=C(OC)C=C2)OC3=CC(OC)=CC(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AH 6809, CAS:33458-93-4, Molecular Weight: 298.2901, C17H14O5, Purity:98, SMILES: O=C1C2=C(C=CC(C(O)=O)=C2)OC3=CC(OC(C)C)=CC=C31, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Selumetinib, CAS:606143-52-6, Molecular Weight: 457.6814, C17H15BrClFN4O3, Purity:98, SMILES: O=C(C1=C(C(F)=C2N=CN(C2=C1)C)NC3=CC=C(C=C3Cl)Br)NOCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MEK162, CAS:606143-89-9, Molecular Weight: 441.2268, C17H15BrF2N4O3, Purity:98, SMILES: BrC1=CC=C(C(F)=C1)NC2=C(C3=C(C=C2C(NOCCO)=O)N(C=N3)C)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-bromo-N-(3-methoxybenzyl-1H-indole-2-carboxamide, CAS:1296201-73-4, Molecular Weight: 359.217, C17H15BrN2O2, Purity:95, SMILES: COC1=CC(CNC(=O)C2=CC3=C(N2)C=C(Br)C=C3)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PEAQX (tetrasodium hydrate), CAS:, Molecular Weight: 560.1544, C17H15BrN3Na4O6P, Purity:98, SMILES: [O-]P([O-])(C(N[C@@H](C)C1=CC=C(Br)C=C1)C2=CC=CC3=C2N=C([O-])C([O-])=N3)=O.[H]O[H].[Na+].[Na+].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gidazepam, CAS:129186-29-4, Molecular Weight: 387.2306, C17H15BrN4O2, Purity:98, SMILES: O=C(NN)CN1C(CN=C(C2=CC=CC=C2)C3=CC(Br)=CC=C31)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6,7-dichloro-1-(2-isopropyl-6-methylphenyl)pyrido[2,3-d]pyrimidine-2,4(1H,3H)-dione, CAS:, Molecular Weight: 364.226, C17H15Cl2N3O2, Purity:98, SMILES: CC(C)c1cccc(C)c1-n1c2nc(Cl)c(Cl)cc2c(=O)[nH]c1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ellipticine (hydrochloride), CAS:5081-48-1, Molecular Weight: 282.7674, C17H15ClN2, Purity:98, SMILES: CC1=C(C=NC=C2)C2=C(C)C(N3)=C1C4=C3C=CC=C4.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Etizolam, CAS:40054-69-1, Molecular Weight: 342.8458, C17H15ClN4S, Purity:98, SMILES: CC1=NN=C2N1C3=C(C=C(CC)S3)C(C4=CC=CC=C4Cl)=NC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E)-methyl 4-(2-chloro-4-methoxystyryl)benzoate, CAS:1268246-22-5, Molecular Weight: 302.752, C17H15ClO3, Purity:95, SMILES: O=C(OC)C1=CC=C(/C=C/C2=CC=C(OC)C=C2Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fenofibric acid, CAS:42017-89-0, Molecular Weight: 318.7516, C17H15ClO4, Purity:98, SMILES: CC(C)(OC1=CC=C(C(C2=CC=C(Cl)C=C2)=O)C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Losmiprofen, CAS:74168-08-4, Molecular Weight: 318.7516, C17H15ClO4, Purity:98, SMILES: CC(OC1=CC=CC(C(C2=CC=C(Cl)C=C2)=O)=C1C)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TAK-733, CAS:1035555-63-5, Molecular Weight: 504.2267, C17H15F2IN4O4, Purity:98, SMILES: O=C1C(C(NC2=CC=C(I)C=C2F)=C(F)C(N3C)=O)=C3N=CN1C[C@@H](O)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Acetamido-2-nitrophenyl 4-(dimethylamino)-3,5-difluorobenzoate, CAS:, Molecular Weight: 379.3149, C17H15F2N3O5, Purity:95, SMILES: CC(=O)Nc1cccc(c1[N+](=O)[O-])OC(=O)c1cc(F)c(c(c1)F)N(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JNJ-17203212, CAS:821768-06-3, Molecular Weight: 419.3243, C17H15F6N5O, Purity:98, SMILES: O=C(N1CCN(C2=NC=CC=C2C(F)(F)F)CC1)NC3=NC=C(C(F)(F)F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HDAC-IN-1, CAS:1239610-44-6, Molecular Weight: 314.311, C17H15FN2O3, Purity:98, SMILES: O=C(NO)/C=C/C1=CC(/C=C/C(C2=CC=CC(F)=C2)=O)=CN1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MC1568, CAS:852475-26-4, Molecular Weight: 314.311, C17H15FN2O3, Purity:98, SMILES: O=C(NO)/C=C/C1=CC=C(/C=C/C(C2=CC=CC(F)=C2)=O)N1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-Tedizolid, CAS:1431699-67-0, Molecular Weight: 370.3378, C17H15FN6O3, Purity:98, SMILES: O=C1O[C@H](CO)CN1C2=CC=C(C3=CC=C(C4=NN(C)N=N4)N=C3)C(F)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tedizolid, CAS:856866-72-3, Molecular Weight: 370.3378, C17H15FN6O3, Purity:98, SMILES: O=C1O[C@@H](CO)CN1C2=CC=C(C3=CC=C(C4=NN(C)N=N4)N=C3)C(F)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Balsalazide, CAS:80573-04-2, Molecular Weight: 357.3175, C17H15N3O6, Purity:98, SMILES: O=C(O)C1=CC(/N=N/C2=CC=C(C(NCCC(O)=O)=O)C=C2)=CC=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ro 61-8048, CAS:199666-03-0, Molecular Weight: 421.4475, C17H15N3O6S2, Purity:98, SMILES: O=S(C1=CC=C(OC)C(OC)=C1)(NC2=NC(C3=CC=CC([N+]([O-])=O)=C3)=CS2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LDN-212320, CAS:894002-50-7, Molecular Weight: 293.3861, C17H15N3S, Purity:98, SMILES: CC1=CC=CC=C1CSC2=NN=C(C3=NC=CC=C3)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-06447475, CAS:1527473-33-1, Molecular Weight: 305.3339, C17H15N5O, Purity:98, SMILES: N#CC1=CC=CC(C2=CNC3=NC=NC(N4CCOCC4)=C32)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DB07268, CAS:929007-72-7, Molecular Weight: 321.3333, C17H15N5O2, Purity:98, SMILES: O=C(N)C1=CC=CC=C1NC2=NC(NC3=CC=CC(O)=C3)=NC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FG8119, CAS:106447-61-4, Molecular Weight: 321.3333, C17H15N5O2, Purity:98, SMILES: O=C1N(C)CC2=C(C3=NOC(C4CC4)=N3)N=CN2C5=CC=CC=C15, HPLC, NMR, LCMS is ok, stock more than 10g. |
| EED226, CAS:2083627-02-3, Molecular Weight: 369.3977, C17H15N5O3S, Purity:98, SMILES: O=S(C1=CC=C(C2=CN=C(NCC3=CC=CO3)N4C2=NN=C4)C=C1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CP-466722, CAS:1080622-86-1, Molecular Weight: 349.3467, C17H15N7O2, Purity:98, SMILES: NC1=NC(C2=NC=CC=C2)=NN1C3=C4C=C(OC)C(OC)=CC4=NC=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Savolitinib, CAS:1313725-88-0, Molecular Weight: 345.3613, C17H15N9, Purity:98, SMILES: CN1N=CC(C2=CN=C3C(N([C@H](C4=CN5C(C=C4)=NC=C5)C)N=N3)=N2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (9H-Fluoren-9-yl)methyl 2-oxoethylcarbamate, CAS:156939-62-7, Molecular Weight: 281.3059, C17H15NO3, Purity:98, SMILES: O=CCNC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-(Benzyloxy)-6-methoxyquinolin-4-ol, CAS:849217-23-8, Molecular Weight: 281.3059, C17H15NO3, Purity:99, SMILES: COc1cc2c(O)ccnc2cc1OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Indoprofen, CAS:31842-01-0, Molecular Weight: 281.3059, C17H15NO3, Purity:98, SMILES: O=C(O)C(C)C1=CC=C(N(CC2=C3C=CC=C2)C3=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 4-Benzyloxy-indole-6-carboxylate, CAS:61545-36-6, Molecular Weight: 281.3059, C17H15NO3, Purity:95, SMILES: COC(=O)C1=CC2=C(C=CN2)C(OCC2=CC=CC=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NU 7026, CAS:154447-35-5, Molecular Weight: 281.3059, C17H15NO3, Purity:98, SMILES: O=C1C2=CC=C3C=CC=CC3=C2OC(N4CCOCC4)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-methoxy-1-(4-methoxybenzyl)indoline-2,3-dione, CAS:, Molecular Weight: 297.3053, C17H15NO4, Purity:95, SMILES: O=C1N(CC2=CC=C(OC)C=C2)C3=C(C=CC(OC)=C3)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Gly-OH, CAS:29022-11-5, Molecular Weight: 297.3053, C17H15NO4, Purity:98, SMILES: OC(=O)CNC(=O)OCC1c2ccccc2c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Parcetasal, CAS:87549-36-8, Molecular Weight: 313.3047, C17H15NO5, Purity:98, SMILES: CC(NC1=CC=C(OC(O2)(C)OC3=CC=CC=C3C2=O)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB-705498, CAS:501951-42-4, Molecular Weight: 429.2343496, C17H16BrF3N4O, Purity:98, SMILES: BrC1=CC=CC=C1NC(N[C@@H]2CCN(C3=NC=C(C(F)(F)F)C=C3)C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MK-8245, CAS:1030612-90-8, Molecular Weight: 467.2491, C17H16BrFN6O4, Purity:98, SMILES: O=C(CN1N=C(N=N1)C2=CC(N3CCC(CC3)OC4=CC(F)=CC=C4Br)=NO2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| EBE-A22, CAS:229476-53-3, Molecular Weight: 374.2318, C17H16BrN3O2, Purity:98, SMILES: BrC1=CC(N(C)C2=NC=NC3=CC(OC)=C(OC)C=C23)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 6-(4-bromo-3-formylphenoxy-2-ethoxynicotinate, CAS:1187189-41-8, Molecular Weight: 394.217, C17H16BrNO5, Purity:95, SMILES: CCOC(=O)C1=C(OCC)N=C(OC2=CC=C(Br)C(C=O)=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amoxapine, CAS:14028-44-5, Molecular Weight: 313.7814, C17H16ClN3O, Purity:98, SMILES: ClC1=CC=C(OC2=CC=CC=C2N=C3N4CCNCC4)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AT13148, CAS:1056901-62-2, Molecular Weight: 313.7814, C17H16ClN3O, Purity:98, SMILES: ClC1=CC=C([C@](C2=CC=C(C3=CNN=C3)C=C2)(O)CN)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Carburazepam, CAS:59009-93-7, Molecular Weight: 329.78084, C17H16ClN3O2, Purity:98, SMILES: O=C(N1CC(N(C)C2=CC=C(Cl)C=C2C1C3=CC=CC=C3)=O)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Asenapine, CAS:65576-45-6, Molecular Weight: 285.768, C17H16ClNO, Purity:98, SMILES: ClC1=CC=C2OC3=CC=CC=C3[C@@](C4)([H])[C@](CN4C)([H])C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Alosetron (D3 Hydrochloride), CAS:1189919-71-8, Molecular Weight: 333.8304, C17H16D3ClN4O, Purity:98, SMILES: O=C1N(CC2=C(C)N=CN2)CCC3=C1C4=CC=CC=C4N3C([2H])([2H])[2H].[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Omeprazole D3, CAS:922731-01-9, Molecular Weight: 348.4345, C17H16D3N3O3S, Purity:98, SMILES: CC(C(OC)=C(C)C=N1)=C1CS(C2=NC3=CC=C(OC([2H])([2H])[2H])C=C3N2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BTZ043, CAS:1161233-85-7, Molecular Weight: 431.3862496, C17H16F3N3O5S, Purity:98, SMILES: O=C1N=C(N(CC2)CCC32OC[C@H](C)O3)SC4=C([N+]([O-])=O)C=C(C(F)(F)F)C=C14, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-(trifluoromethoxyphenylethanone O-(4-methoxybenzyl oxime, CAS:1571034-51-9, Molecular Weight: 339.309, C17H16F3NO3, Purity:95, SMILES: COC1=CC=C(CON=C(C)C2=CC=C(OC(F)(F)F)C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TAK-438 (free base), CAS:881681-00-1, Molecular Weight: 345.3912, C17H16FN3O2S, Purity:98, SMILES: O=S(N1C=C(CNC)C=C1C2=CC=CC=C2F)(C3=CC=CN=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tedizolid (phosphate), CAS:856867-55-5, Molecular Weight: 450.3177, C17H16FN6O6P, Purity:98, SMILES: O=C1O[C@@H](COP(O)(O)=O)CN1C2=CC=C(C3=CC=C(C4=NN(C)N=N4)N=C3)C(F)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Carbenicillin (disodium), CAS:4800-94-6, Molecular Weight: 422.3633, C17H16N2Na2O6S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC(C(C([O-])=O)C3=CC=CC=C3)=O)N1C2=O)[O-].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Eslicarbazepine (acetate), CAS:236395-14-5, Molecular Weight: 296.3205, C17H16N2O3, Purity:98, SMILES: O=C(N1C2=CC=CC=C2C[C@H](OC(C)=O)C3=CC=CC=C31)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PCI-34051, CAS:950762-95-5, Molecular Weight: 296.3205, C17H16N2O3, Purity:98, SMILES: COC(C=C1)=CC=C1CN2C3=CC(C(NO)=O)=CC=C3C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SU 5402, CAS:215543-92-3, Molecular Weight: 296.3205, C17H16N2O3, Purity:98, SMILES: O=C(CCC1=C(NC=C1C)/C=C2C(NC3=C\2C=CC=C3)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TEPP-46, CAS:1221186-53-3, Molecular Weight: 372.4645, C17H16N4O2S2, Purity:98, SMILES: O=C1C(N(C)C2=C3SC(S(C)=O)=C2)=C3C=NN1CC4=CC=CC(N)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| XMU-MP-1, CAS:2061980-01-4, Molecular Weight: 416.4773, C17H16N6O3S2, Purity:98, SMILES: O=S(C1=CC=C(NC2=NC=C(C(N(C)C3=C4SC=C3)=N2)N(C)C4=O)C=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| APY29, CAS:1216665-49-4, Molecular Weight: 332.3625, C17H16N8, Purity:98, SMILES: C1(NC2=CC=C3N=CNC3=C2)=NC=CC(NC4=NNC(C5CC5)=C4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,2',3,3'-Tetrahydro-1,1'-spirobi[indene]-7,7'-diol, CAS:223137-87-9, Molecular Weight: 252.3077, C17H16O2, Purity:98, SMILES: Oc1cccc2CCC3(CCc4cccc(O)c34)c12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,1-BIS(4-METHOXYPHENYL)-2-PROPYN-1-OL, CAS:101597-25-5, Molecular Weight: 268.3071, C17H16O3, Purity:95, SMILES: COC1=CC=C(C=C1)C(O)(C#C)C1=CC=C(OC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-acetyl-4-methylphenyl 2-methylbenzoate, CAS:0, Molecular Weight: 268.3071, C17H16O3, Purity:95, SMILES: CC(=O)C1=CC(C)=CC=C1OC(=O)C1=C(C)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2H-1-Benzopyran-7-ol, 2-(ethylthio)-3-(4-hydroxyphenyl)-, CAS:1096621-42-9, Molecular Weight: 300.37214, C17H16O3S, Purity:98, SMILES: OC1=CC=C2C=C(C3=CC=C(O)C=C3)C(SCC)OC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E)-3-(3,4-Dimethoxyphenyl)-1-(3-hydroxyphenyl)-1-propenone, CAS:178445-80-2, Molecular Weight: 284.3065, C17H16O4, Purity:95, SMILES: COc1cc(/C=C/C(=O)c2cccc(c2)O)ccc1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HA14-1, CAS:65673-63-4, Molecular Weight: 409.2313, C17H17BrN2O5, Purity:98, SMILES: BrC1=CC=C2C(C(C(C(OCC)=O)=C(O2)N)C(C#N)C(OCC)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PEAQX, CAS:459836-30-7, Molecular Weight: 454.2117, C17H17BrN3O5P, Purity:98, SMILES: O=C1C(NC2=C(C(C(P(O)(O)=O)N[C@H](C3=CC=C(Br)C=C3)C)=CC=C2)N1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Asenapine (hydrochloride), CAS:1412458-61-7, Molecular Weight: 322.229, C17H17Cl2NO, Purity:98, SMILES: [H]Cl.ClC1=CC2=C(C=C1)OC3=C(C=CC=C3)[C@](C4)([H])[C@]2([H])CN4C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diclofensine, CAS:67165-56-4, Molecular Weight: 322.229, C17H17Cl2NO, Purity:98, SMILES: CN1CC2=C(C=CC(OC)=C2)C(C3=CC=C(Cl)C(Cl)=C3)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mefloquine (hydrochloride), CAS:51773-92-3, Molecular Weight: 414.7730992, C17H17ClF6N2O, Purity:98, SMILES: O[C@H]([C@]1([H])NCCCC1)C2=CC(C(F)(F)F)=NC3=C(C(F)(F)F)C=CC=C32.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RS 127445, CAS:199864-86-3, Molecular Weight: 317.7884, C17H17ClFN3, Purity:98, SMILES: NC1=NC(C(C)C)=CC(C2=C3C=CC=CC3=C(F)C=C2)=N1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clinafloxacin, CAS:105956-97-6, Molecular Weight: 365.7866, C17H17ClFN3O3, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N4CC(N)CC4)=C3Cl)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Etifoxine, CAS:21715-46-8, Molecular Weight: 300.7827, C17H17ClN2O, Purity:98, SMILES: ClC1=CC=C2C(C(C3=CC=CC=C3)(C)OC(NCC)=N2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JNJ-63533054, CAS:1802326-66-4, Molecular Weight: 316.7821, C17H17ClN2O2, Purity:98, SMILES: O=C(NCC(N[C@H](C1=CC=CC=C1)C)=O)C2=CC=CC(Cl)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SC79, CAS:305834-79-1, Molecular Weight: 364.7803, C17H17ClN2O5, Purity:98, SMILES: O=C(OCC)C(C#N)C1C(C(OCC)=O)=C(N)OC2=CC=C(Cl)C=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-chloro-7-methoxy-8-methylquinolin-2-yl)-4-isopropylthiazole, CAS:1193272-59-1, Molecular Weight: 332.848, C17H17ClN2OS, Purity:95, SMILES: COc1ccc2c(c1C)nc(cc2Cl)c1scc(n1)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Desmethylclozapine, CAS:6104-71-8, Molecular Weight: 312.7967, C17H17ClN4, Purity:98, SMILES: ClC1=CC=C2C(N=C(N3CCNCC3)C4=CC=CC=C4N2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Griseofulvin, CAS:126-07-8, Molecular Weight: 352.7663, C17H17ClO6, Purity:98, SMILES: O=C1[C@]2(C(OC)=CC(C[C@H]2C)=O)OC3=C(Cl)C(OC)=CC(OC)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mycophenolic acid D3, CAS:1185242-90-3, Molecular Weight: 323.3556, C17H17D3O6, Purity:98, SMILES: O=C(OC1)C2=C1C(C)=C(OC([2H])([2H])[2H])C(C/C=C(C)/CCC(O)=O)=C2O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Verubecestat, CAS:1286770-55-5, Molecular Weight: 409.4104, C17H17F2N5O3S, Purity:98, SMILES: O=C(C1=NC=C(F)C=C1)NC2=CC=C(F)C([C@@](C3)(C)N=C(N)N(C)S3(=O)=O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| VU 0357121, CAS:433967-28-3, Molecular Weight: 305.3192, C17H17F2NO2, Purity:98, SMILES: O=C(NC1=CC=C(F)C=C1F)C2=CC=C(OCCCC)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,2S)-2-(3,4-Difluorophenyl)cyclopropanamine (R)-2-hydroxy-2-phenylacetate, CAS:376608-71-8, Molecular Weight: 321.3186, C17H17F2NO3, Purity:95, SMILES: OC(=O)[C@@H](c1ccccc1)O.N[C@@H]1C[C@H]1c1ccc(c(c1)F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Balsalazide (sodium hydrate), CAS:150399-21-6, Molecular Weight: 437.3117, C17H17N3Na2O8, Purity:98, SMILES: [O-]C(CCNC(C1=CC=C(/N=N/C2=CC=C([O-])C(C(O)=O)=C2)C=C1)=O)=O.[Na+].[Na+].O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PJ34, CAS:344458-19-1, Molecular Weight: 295.3358, C17H17N3O2, Purity:98, SMILES: O=C(NC(C=C1C2=C3C=CC=C2)=CC=C1NC3=O)CN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CFM-2, CAS:178616-26-7, Molecular Weight: 311.3352, C17H17N3O3, Purity:98, SMILES: O=C1NN=C(C2=CC=C(N)C=C2)C3=CC(OC)=C(OC)C=C3C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Picoprazole, CAS:78090-11-6, Molecular Weight: 343.4002, C17H17N3O3S, Purity:98, SMILES: O=C(C1=C(C)C=C2N=C(S(CC3=NC=CC=C3C)=O)NC2=C1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SKF81367, CAS:39685-31-9, Molecular Weight: 423.39718, C17H17N3O8S, Purity:98, SMILES: OC(C1=C(COC(C)=O)CS[C@@]([C@@H]2NC(/C(C3=CC=CO3)=N\OC)=O)([H])N1C2=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY2183240, CAS:874902-19-9, Molecular Weight: 307.3498, C17H17N5O, Purity:98, SMILES: O=C(N(C)C)N1N=NN=C1CC(C=C2)=CC=C2C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(9-((2R,3R,4S,5R-3,4-dihydroxy-5-(hydroxymethyltetrahydrofuran-2-yl-9H-purin-6-ylbenzamide, CAS:0, Molecular Weight: 371.3474, C17H17N5O5, Purity:95, SMILES: OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)N1C=NC2=C(NC(=O)C3=CC=CC=C3)N=CN=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N6-Benzoyladenosine, CAS:4546-55-8, Molecular Weight: 371.3474, C17H17N5O5, Purity:98, SMILES: OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(NC(=O)c3ccccc3)ncnc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PP121, CAS:1092788-83-4, Molecular Weight: 319.3638, C17H17N7, Purity:98, SMILES: NC1=C2C(C3=CC4=C(N=C3)NC=C4)=NN(C2=NC=N1)C5CCCC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vps34-PIK-III, CAS:1383716-40-2, Molecular Weight: 319.3638, C17H17N7, Purity:98, SMILES: NC1=NC=C(C2=CC=NC(NC3=CC=NC=C3)=N2)C(CC4CC4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Diphenylmethyl)azetidine-3-carboxylic acid, CAS:36476-87-6, Molecular Weight: 267.3224, C17H17NO2, Purity:95, SMILES: OC(=O)C1CN(C1)C(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-5-Ethoxy-1,3-Dihydro-Indol-2-One, CAS:346577-65-9, Molecular Weight: 267.3224, C17H17NO2, Purity:95, SMILES: CCOC1=CC=C2N(CC3=CC=CC=C3)C(=O)CC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 2-((diphenylmethylene)amino)acetate, CAS:69555-14-2, Molecular Weight: 267.3224, C17H17NO2, Purity:99, SMILES: CCOC(=O)CN=C(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-tosyl-3,4-dihydro-1H-benzo[c]azepin-5(2H)-one, CAS:1951439-55-6, Molecular Weight: 315.387, C17H17NO3S, Purity:99, SMILES: Cc1ccc(cc1)S(=O)(=O)N1CCC(=O)c2ccccc2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZ-1355, CAS:75451-07-9, Molecular Weight: 299.32118, C17H17NO4, Purity:98, SMILES: O=C(C1=CC=C2OC3=C(OC)C=CC=C3CNC2=C1)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Z-Tyr-OH, CAS:1164-16-5, Molecular Weight: 315.3206, C17H17NO5, Purity:95, SMILES: OC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AN3199, CAS:1187187-10-5, Molecular Weight: 327.1395, C17H18BNO5, Purity:98, SMILES: O=C(C1=CC=C(OC2=CC=C(B(O)OC3)C3=C2)N=C1)OCCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| OF-1, CAS:919973-83-4, Molecular Weight: 440.3115, C17H18BrN3O4S, Purity:98, SMILES: O=S(C1=CC=C(Br)C=C1C)(NC2=C(OC)C=C(N3C)C(N(C)C3=O)=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(2-bromo-5-hydroxy-4-methoxybenzyl)-N-(4-hydroxyphenethyl)formamide, CAS:122584-18-3, Molecular Weight: 380.233, C17H18BrNO4, Purity:95, SMILES: O=CN(Cc1cc(O)c(cc1Br)OC)CCc1ccc(cc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Etifoxine (hydrochloride), CAS:56776-32-0, Molecular Weight: 337.2436, C17H18Cl2N2O, Purity:98, SMILES: ClC1=CC=C2C(C(C3=CC=CC=C3)(C)OC(NCC)=N2)=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fenmetozole (Tosylate), CAS:83474-08-2, Molecular Weight: 417.30682, C17H18Cl2N2O4S, Purity:98, SMILES: ClC1=CC=C(OCC2=NCCN2)C=C1Cl.O=S(C3=CC=C(C)C=C3)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| R(+)-IAA-94, CAS:54197-31-8, Molecular Weight: 357.2284, C17H18Cl2O4, Purity:98, SMILES: O=C(O)COC1=CC2=C(C([C@@](C)(C3CCCC3)C2)=O)C(Cl)=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sertraline (hydrochloride), CAS:79559-97-0, Molecular Weight: 342.6905, C17H18Cl3N, Purity:98, SMILES: CN[C@H]1CC[C@@H](C2=CC=C(Cl)C(Cl)=C2)C3=C1C=CC=C3.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diclofensine (hydrochloride), CAS:34041-84-4, Molecular Weight: 358.6899, C17H18Cl3NO, Purity:98, SMILES: CN1CC2=C(C=CC(OC)=C2)C(C3=CC=C(Cl)C(Cl)=C3)C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-CHLORO-N2-(4-FLUOROBENZYL)-N4-(5-ISOPROPOXY-1H-PYRAZOL-3-YL)PYRIMIDINE-2,4-DIAMINE, CAS:1447605-97-1, Molecular Weight: 376.816, C17H18ClFN6O, Purity:95, SMILES: CC(C)Oc1cc(Nc2nc(NCc3ccc(F)cc3)ncc2Cl)n[nH]1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ramosetron (Hydrochloride), CAS:132907-72-3, Molecular Weight: 315.7973, C17H18ClN3O, Purity:98, SMILES: O=C(C1=CN(C)C2=C1C=CC=C2)[C@@H](C3)CCC4=C3NC=N4.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PJ34 (hydrochloride), CAS:344458-15-7, Molecular Weight: 331.7967, C17H18ClN3O2, Purity:98, SMILES: O=C(NC(C=C1C2=C3C=CC=C2)=CC=C1NC3=O)CN(C)C.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrazolo[1,5-a]pyrimidine, 7-chloro-2-(3,4-dimethoxyphenyl)-6-ethyl-5-methyl-, CAS:1464091-54-0, Molecular Weight: 331.797, C17H18ClN3O2, Purity:95, SMILES: CCc1c(C)nc2cc(nn2c1Cl)-c1ccc(OC)c(OC)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nadolol D9, CAS:94513-92-5, Molecular Weight: 318.456, C17H18D9NO4, Purity:98, SMILES: OC1C(O)CC2=C(OCC(O)CNC(C([2H])([2H])[2H])(C([2H])([2H])[2H])C([2H])([2H])[2H])C=CC=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BX341, CAS:34633-34-6, Molecular Weight: 292.3204264, C17H18F2O2, Purity:98, SMILES: C[C@H](C1=CC(F)=C(O)C=C1)[C@H](C2=CC(F)=C(O)C=C2)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fleroxacin, CAS:79660-72-3, Molecular Weight: 369.3383, C17H18F3N3O3, Purity:98, SMILES: O=C(C1=CN(CCF)C2=C(C=C(F)C(N3CCN(C)CC3)=C2F)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RU 58841, CAS:154992-24-2, Molecular Weight: 369.3383, C17H18F3N3O3, Purity:98, SMILES: FC(F)(C1=C(C=CC(N2C(C(C)(N(C2=O)CCCCO)C)=O)=C1)C#N)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fluoxetine, CAS:54910-89-3, Molecular Weight: 309.3261, C17H18F3NO, Purity:98, SMILES: FC(C1=CC=C(OC(C2=CC=CC=C2)CCNC)C=C1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ciprofloxacin, CAS:85721-33-1, Molecular Weight: 331.3415, C17H18FN3O3, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N4CCNCC4)=C3)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| T338C Src-IN-2, CAS:1351927-00-8, Molecular Weight: 327.3561, C17H18FN5O, Purity:98, SMILES: NC1=C2C(N(C(C)C)N=C2CC3=CC(C(CF)=O)=CC=C3)=NC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ro 67-7476, CAS:298690-60-5, Molecular Weight: 319.3937, C17H18FNO2S, Purity:98, SMILES: O=S(N1[C@H](C2=CC=C(F)C=C2)CCC1)(C3=CC=C(C)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzhydryl-3-(IodomethylAzetidine, CAS:0, Molecular Weight: 363.236, C17H18IN, Purity:95, SMILES: ICC1CN(C1)C(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Esomeprazole (potassium salt), CAS:161796-84-5, Molecular Weight: 383.5064, C17H18KN3O3S, Purity:98, SMILES: O=[S@](C1=NC2=CC=C(OC)C=C2[N-]1)CC3=NC=C(C)C(OC)=C3C.[K+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Esomeprazole (magnesium salt), CAS:1198768-91-0, Molecular Weight: 368.7126, C17H18MgN3O3S+, Purity:98, SMILES: O=[S@](C1=NC2=CC=C(OC)C=C2[N-]1)CC3=NC=C(C)C(OC)=C3C.[Mg+2], HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZLN005, CAS:49671-76-3, Molecular Weight: 250.3382, C17H18N2, Purity:98, SMILES: CC(C1=CC=C(C2=NC3=CC=CC=C3N2)C=C1)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FH1, CAS:2719-05-3, Molecular Weight: 282.337, C17H18N2O2, Purity:98, SMILES: CC(NC1=CC=C(CC2=CC=C(NC(C)=O)C=C2)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-4-Phenyl-1-(Pyridin-2-YlmethylPyrrolidine-3-Carboxylic Acid, CAS:1422948-25-1, Molecular Weight: 282.337, C17H18N2O2, Purity:95, SMILES: OC(=O)[C@@H]1CN(CC2=CC=CC=N2)C[C@H]1C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HPOB, CAS:1429651-50-2, Molecular Weight: 314.3358, C17H18N2O4, Purity:98, SMILES: O=C(N(CCO)C1=CC=CC=C1)CC2=CC=C(C(NO)=O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nifedipine, CAS:21829-25-4, Molecular Weight: 346.33462, C17H18N2O6, Purity:98, SMILES: O=C(C1=C(C)NC(C)=C(C(OC)=O)C1C2=CC=CC=C2[N+]([O-])=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Carbenicillin, CAS:4697-36-3, Molecular Weight: 378.3996, C17H18N2O6S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC(C(C(O)=O)C3=CC=CC=C3)=O)N1C2=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-allyl-3-(4-benzylphenyl)thiourea, CAS:, Molecular Weight: 282.403, C17H18N2S, Purity:95, SMILES: S=C(NC1=CC=C(CC2=CC=CC=C2)C=C1)NCC=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sulbentine, CAS:350-12-9, Molecular Weight: 314.4682, C17H18N2S2, Purity:98, SMILES: S=C1SCN(CC2=CC=CC=C2)CN1CC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Esomeprazole (sodium), CAS:161796-78-7, Molecular Weight: 367.3979, C17H18N3NaO3S, Purity:98, SMILES: O=[S@](C1=NC2=CC(OC)=CC=C2[N-]1)CC3=NC=C(C)C(OC)=C3C.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| DREADD agonist 21, CAS:56296-18-5, Molecular Weight: 278.3516, C17H18N4, Purity:98, SMILES: C12=CC=CC=C1NC3=CC=CC=C3C(N4CCNCC4)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Alosetron, CAS:122852-42-0, Molecular Weight: 294.351, C17H18N4O, Purity:98, SMILES: O=C(C(C1=C2C=CC=C1)=C(N2C)CC3)N3CC4=C(NC=N4)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lersivirine, CAS:473921-12-9, Molecular Weight: 310.35042, C17H18N4O2, Purity:98, SMILES: CCC1=NN(CCO)C(CC)=C1OC2=CC(C#N)=CC(C#N)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| UNBS5162, CAS:956590-23-1, Molecular Weight: 326.3498, C17H18N4O3, Purity:98, SMILES: O=C(N)NC1=CC2=CC=CC(C(N(CCN(C)C)C3=O)=O)=C2C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ruxolitinib, CAS:941678-49-5, Molecular Weight: 306.365, C17H18N6, Purity:98, SMILES: N#CC[C@H](C1CCCC1)N2N=CC(C3=C4C=CNC4=NC=N3)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ruxolitinib (S enantiomer), CAS:941685-37-6, Molecular Weight: 306.36502, C17H18N6, Purity:98, SMILES: N#CC[C@@H](C1CCCC1)N2N=CC(C3=NC=NC4=C3C=CN4)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NBTGR, CAS:13153-27-0, Molecular Weight: 434.42642, C17H18N6O6S, Purity:98, SMILES: OC[C@@H]1[C@H]([C@H]([C@H](N2C=NC3=C2N=C(N)N=C3SCC4=CC=C([N+]([O-])=O)C=C4)O1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4'-Butylbiphenyl-4-Carboxylic Acid, CAS:59662-46-3, Molecular Weight: 254.3236, C17H18O2, Purity:95, SMILES: CCCCC1=CC=C(C=C1)C1=CC=C(C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9,9-Bis(methoxymethyl)-9H-fluorene, CAS:182121-12-6, Molecular Weight: 254.3236, C17H18O2, Purity:98, SMILES: COCC1(COC)c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| trans-Trimethoxyresveratrol, CAS:22255-22-7, Molecular Weight: 270.323, C17H18O3, Purity:98, SMILES: COC1=CC=C(/C=C/C2=CC(OC)=CC(OC)=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Loureirin A, CAS:119425-89-7, Molecular Weight: 286.3224, C17H18O4, Purity:98, SMILES: O=C(C1=CC=C(O)C=C1)CCC2=CC=C(OC)C=C2OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-benzyl-N-(3-bromopyridin-2-yl)pivalamide, CAS:2055841-41-1, Molecular Weight: 347.25, C17H19BrN2O, Purity:95, SMILES: CC(C)(C)C(N(CC1=CC=CC=C1)C2=NC=CC=C2Br)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-bromo-4'-(pentyloxy)-1,1'-biphenyl, CAS:63619-51-2, Molecular Weight: 319.236, C17H19BrO, Purity:95, SMILES: CCCCCOc1ccc(cc1)-c1ccc(Br)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NVP-LCQ195, CAS:902156-99-4, Molecular Weight: 460.3349, C17H19Cl2N5O4S, Purity:98, SMILES: CS(=O)(N1CCC(NC(C2=C(NC(C3=C(Cl)C=CC=C3Cl)=O)C=NN2)=O)CC1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SCH 23390 (hydrochloride), CAS:125941-87-9, Molecular Weight: 324.2449, C17H19Cl2NO, Purity:98, SMILES: OC1=C(Cl)C=C2CCN(C)C[C@H](C3=CC=CC=C3)C2=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fluoxetine (hydrochloride), CAS:56296-78-7, Molecular Weight: 345.7871, C17H19ClF3NO, Purity:98, SMILES: FC(C1=CC=C(OC(C2=CC=CC=C2)CCNC)C=C1)(F)F.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rufloxacin (hydrochloride), CAS:106017-08-7, Molecular Weight: 399.8675, C17H19ClFN3O3S, Purity:98, SMILES: O=C(C(C1=O)=CN2CCSC3=C(N4CCN(C)CC4)C(F)=CC1=C23)O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(4-Chlorobenzhydryl)piperazine, CAS:303-26-4, Molecular Weight: 286.799, C17H19ClN2, Purity:95, SMILES: Clc1ccc(cc1)C(c1ccccc1)N1CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((4-chlorophenyl)(piperidin-4-yloxy)methyl)pyridine, CAS:122368-54-1, Molecular Weight: 302.799, C17H19ClN2O, Purity:98, SMILES: Clc1ccc(cc1)C(OC1CCNCC1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyronin Y, CAS:92-32-0, Molecular Weight: 302.79856, C17H19ClN2O, Purity:98, SMILES: CN(C1=CC2=[O+]C3=C(C=CC(N(C)C)=C3)C=C2C=C1)C.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| DMCM (hydrochloride), CAS:1215833-62-7, Molecular Weight: 350.7968, C17H19ClN2O4, Purity:98, SMILES: O=C(C1=C(CC)C2=C(C=N1)NC3=C2C=C(OC)C(OC)=C3)OC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thioflavin T, CAS:2390-54-7, Molecular Weight: 318.8642, C17H19ClN2S, Purity:98, SMILES: CC1=CC=C2[N+](C)=C(C3=CC=C(N(C)C)C=C3)SC2=C1.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Alosetron (Hydrochloride(1:X)), CAS:132414-02-9, Molecular Weight: 330.81196, C17H19ClN4O, Purity:98, SMILES: O=C1N(CC2=C(NC=N2)C)CCC(N3C)=C1C4=C3C=CC=C4.[F,Cl,Br,I].Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Alosetron (Hydrochloride), CAS:122852-69-1, Molecular Weight: 330.812, C17H19ClN4O, Purity:98, SMILES: O=C(C(C1=C2C=CC=C1)=C(N2C)CC3)N3CC4=C(NC=N4)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PROTO-1, CAS:312951-85-2, Molecular Weight: 378.8764, C17H19ClN4O2S, Purity:98, SMILES: O=C(C1=C(NC(NC2=CC=C(Cl)C=C2)=O)SC3=C1CCN(CC)C3)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Propanol, 1-[4-[(3-chlorophenyl)methoxy]phenoxy]-3-methoxy-, (S)-, CAS:124991-40-8, Molecular Weight: 322.78336, C17H19ClO4, Purity:98, SMILES: O[C@@H](COC)COC1=CC=C(OCC2=CC=CC(Cl)=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lomefloxacin, CAS:98079-51-7, Molecular Weight: 351.3479, C17H19F2N3O3, Purity:98, SMILES: O=C(C1=CN(CC)C2=C(C=C(F)C(N3CC(C)NCC3)=C2F)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NVP-QAV-572, CAS:957209-68-6, Molecular Weight: 471.5047, C17H19F2N7O3S2, Purity:98, SMILES: O=C(NC1=NC(C)=C(C2=CC=C(S(=O)(C)=O)C(F)=C2)S1)NCCC3=NN(CCF)N=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AU1235, CAS:1338780-86-1, Molecular Weight: 324.3407696, C17H19F3N2O, Purity:98, SMILES: O=C(NC(C=CC(F)=C1F)=C1F)NC2(C[C@H](C3)C4)C[C@H]4C[C@H]3C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Upadacitinib, CAS:1310726-60-3, Molecular Weight: 380.3676, C17H19F3N6O, Purity:98, SMILES: O=C(N1C[C@@H](CC)[C@@H](C2=CN=C3C=NC(NC=C4)=C4N32)C1)NCC(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Safinamide, CAS:133865-89-1, Molecular Weight: 302.3434, C17H19FN2O2, Purity:98, SMILES: O=C([C@@H](NCC1=CC=C(OCC2=CC(F)=CC=C2)C=C1)C)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pazufloxacin (mesylate), CAS:163680-77-1, Molecular Weight: 414.4054, C17H19FN2O7S, Purity:98, SMILES: O=C(C(C1=O)=CN2[C@@H](C)COC3=C(C4(N)CC4)C(F)=CC1=C23)O.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ACY-775, CAS:1375466-18-4, Molecular Weight: 330.3568, C17H19FN4O2, Purity:98, SMILES: O=C(NO)C(C=N1)=CN=C1NC2(CCCCC2)C3=CC=CC(F)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD-7762, CAS:860352-01-8, Molecular Weight: 362.4218, C17H19FN4O2S, Purity:98, SMILES: O=C(N[C@@H]1CNCCC1)C2=C(C=C(S2)C3=CC=CC(F)=C3)NC(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Marbofloxacin, CAS:115550-35-1, Molecular Weight: 362.3556, C17H19FN4O4, Purity:98, SMILES: O=C(C(C1=O)=CN2N(C)COC3=C(N4CCN(C)CC4)C(F)=CC1=C32)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BMS-707035, CAS:729607-74-3, Molecular Weight: 410.42, C17H19FN4O5S, Purity:98, SMILES: FC1=CC=C(C=C1)CNC(C(N=C(N2C)N3S(CCCC3)(=O)=O)=C(C2=O)O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Biphenyl-4-yl-piperidine, CAS:143867-44-1, Molecular Weight: 237.3395, C17H19N, Purity:95, SMILES: N1CCC(CC1)c1ccc(cc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methicillin (sodium salt), CAS:132-92-3, Molecular Weight: 402.3973, C17H19N2NaO6S, Purity:98, SMILES: [O-]C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC(C3=C(OC)C=CC=C3OC)=O)N1C2=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mirtazapine, CAS:85650-52-8, Molecular Weight: 265.3529, C17H19N3, Purity:98, SMILES: CN1CC2C3=CC=CC=C3CC4=CC=CN=C4N2CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phenol, 4-[[(4,5-dihydro-1H-imidazol-2-yl)methyl](4-methylphenyl)amino]-, CAS:47142-51-8, Molecular Weight: 281.35226, C17H19N3O, Purity:98, SMILES: OC1=CC=C(N(CC2=NCCN2)C3=CC=C(C)C=C3)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-4-(4-nitrophenyl)piperazine, CAS:16155-08-1, Molecular Weight: 297.3517, C17H19N3O2, Purity:95, SMILES: [O-][N+](=O)c1ccc(cc1)N1CCN(CC1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CP-409092, CAS:194098-25-4, Molecular Weight: 297.35166, C17H19N3O2, Purity:98, SMILES: O=C(C1=CNC2=C1C(CCC2)=O)NC3=CC=C(CNC)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NSP-805, CAS:125068-54-4, Molecular Weight: 297.3517, C17H19N3O2, Purity:98, SMILES: O=C1CC(C)C(C2=CC=C(NC3=C(C)C(CC3)=O)C=C2)=NN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| XY1, CAS:1624117-53-8, Molecular Weight: 297.3517, C17H19N3O2, Purity:98, SMILES: O=C(NCC(N1CCCC1)=O)NC2=CC=C3C=CC=CC3=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Omeprazole metabolite Omeprazole sulfide, CAS:73590-85-9, Molecular Weight: 329.4167, C17H19N3O2S, Purity:98, SMILES: CC(C(OC)=C(C)C=N1)=C1CSC2=NC3=CC=C(OC)C=C3N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Omeprazole, CAS:73590-58-6, Molecular Weight: 345.416, C17H19N3O3S, Purity:98, SMILES: O=S(C1=NC2=CC=C(OC)C=C2N1)CC3=NC=C(C)C(OC)=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenesulfonamide, 4-[[(6-hydroxy-4,5,7-trimethyl-2-benzothiazolyl)amino]methyl]-, CAS:120165-51-7, Molecular Weight: 377.48106, C17H19N3O3S2, Purity:98, SMILES: O=S(C1=CC=C(CNC2=NC3=C(C)C(C)=C(O)C(C)=C3S2)C=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Omeprazole metabolite Omeprazole sulfone, CAS:88546-55-8, Molecular Weight: 361.4155, C17H19N3O4S, Purity:98, SMILES: CC(C(OC)=C(C)C=N1)=C1CS(C2=NC3=CC=C(OC)C=C3N2)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| METHYL 2-(2-(((BENZYLOXY)CARBONYL)AMINO)PROPAN-2-YL)-5-HYDROXY-6-OXO-1,6-DIHYDROPYRIMIDINE-4-CARBOXYLATE, CAS:519032-08-7, Molecular Weight: 361.3493, C17H19N3O6, Purity:95, SMILES: COC(=O)c1nc([nH]c(=O)c1O)C(C)(C)NC(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Anastrozole, CAS:120511-73-1, Molecular Weight: 293.36626, C17H19N5, Purity:98, SMILES: CC(C)(C#N)C1=CC(C(C)(C#N)C)=CC(CN2C=NC=N2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IRAK inhibitor 1, CAS:1042224-63-4, Molecular Weight: 293.3663, C17H19N5, Purity:98, SMILES: C1(C2=CN=C3N2C=CC=C3)=CC=CC(NC4CCNCC4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pixantrone, CAS:144510-96-3, Molecular Weight: 325.3651, C17H19N5O2, Purity:98, SMILES: O=C(C1=C(NCCN)C=CC(NCCN)=C12)C3=C(C=NC=C3)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N6-(4-Hydroxybenzyl)adenosine, CAS:110505-75-4, Molecular Weight: 373.3633, C17H19N5O5, Purity:98, SMILES: OC[C@@H]1[C@H]([C@H]([C@H](N2C=NC3=C2N=CN=C3NCC4=CC=C(O)C=C4)O1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-(-)-¦�,¦�-Diphenyl-2-pyrrolidinemethanol, CAS:112068-01-6, Molecular Weight: 253.3389, C17H19NO, Purity:95, SMILES: OC(c1ccccc1)(c1ccccc1)[C@@H]1CCCN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Org-10490, CAS:83507-02-2, Molecular Weight: 253.33886, C17H19NO, Purity:98, SMILES: CN1CCC2=CC=CC=C2OC3=CC=CC=C3CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Galanthaminone, CAS:510-77-0, Molecular Weight: 285.3376, C17H19NO3, Purity:98, SMILES: O=C1C=C[C@@]23CCN(C)CC4=CC=C(OC)C(O[C@@]3([H])C1)=C24, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Piperine, CAS:94-62-2, Molecular Weight: 285.3376, C17H19NO3, Purity:98, SMILES: O=C(N1CCCCC1)/C=C/C=C/C2=CC=C(OCO3)C3=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzhydryl-3-azetidinyl methanesulfonate, CAS:33301-41-6, Molecular Weight: 317.403, C17H19NO3S, Purity:97, SMILES: CS(=O)(=O)OC1CN(C1)C(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(BenzyloxycarbonylaminoEthyl 4-Methylbenzenesulfonate, CAS:93407-96-6, Molecular Weight: 349.401, C17H19NO5S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OCCNC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Ethyl 6-methyl 1-benzoyl-3-oxopiperidine-2,6-dicarboxylate, CAS:, Molecular Weight: 333.3359, C17H19NO6, Purity:95, SMILES: CCOC(=O)C1C(=O)CCC(N1C(=O)c1ccccc1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Faropenem daloxate, CAS:141702-36-5, Molecular Weight: 397.3997, C17H19NO8S, Purity:98, SMILES: O=C(N1[C@@]2(SC([C@@H]3OCCC3)=C1C(OCC4=C(OC(O4)=O)C)=O)[H])[C@@H]2[C@H](O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-[BIS(PHENYLMETHOXY)PHOSPHINYL]-PROPANOIC ACID, CAS:805243-04-3, Molecular Weight: 334.3035, C17H19O5P, Purity:95, SMILES: OC(=O)CCP(=O)(OCc1ccccc1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)pyridine, CAS:1009033-87-7, Molecular Weight: 281.157, C17H20BNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1ccc(cc1)c1ccncc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(7-bromo-6-chloroquinazolin-4-ylpiperazine-1-carboxylate, CAS:1698027-00-7, Molecular Weight: 427.723, C17H20BrClN4O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC1)C1=NC=NC2=CC(Br)=C(Cl)C=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chlorpromazine (hydrochloride), CAS:69-09-0, Molecular Weight: 355.3251, C17H20Cl2N2S, Purity:98, SMILES: CN(C)CCCN1C2=C(C=CC=C2)SC3=CC=C(Cl)C=C13.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PU-WS13, CAS:1454619-14-7, Molecular Weight: 411.3519, C17H20Cl2N6S, Purity:98, SMILES: CC(NCCCN1C(SC2=CC(Cl)=CC(Cl)=C2)=NC3=C(N)N=CN=C13)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lomefloxacin (hydrochloride), CAS:98079-52-8, Molecular Weight: 387.8088, C17H20ClF2N3O3, Purity:98, SMILES: CCN(C=C(C(O)=O)C1=O)C(C1=CC(F)=C2N(CCN3)CC3C)=C2F.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GNE-9605, CAS:1536200-31-3, Molecular Weight: 449.8336, C17H20ClF4N7O, Purity:98, SMILES: FC(C1=CN=C(NC2=C(Cl)N([C@@H]3[C@@H](F)CN(C4COC4)CC3)N=C2)N=C1NC)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Marbofloxacin (hydrochloride), CAS:115551-26-3, Molecular Weight: 398.8165, C17H20ClFN4O4, Purity:98, SMILES: O=C(C(C1=O)=CN2N(C)COC3=C(N4CCN(C)CC4)C(F)=CC1=C32)O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acridine Orange (hydrochloride), CAS:65-61-2, Molecular Weight: 301.8138, C17H20ClN3, Purity:98, SMILES: CN(C)C1=CC=C2C(N=C3C=C(N(C)C)C=CC3=C2)=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Antazoline (hydrochloride), CAS:2508-72-7, Molecular Weight: 301.8138, C17H20ClN3, Purity:98, SMILES: [H]Cl.C1(CN(C2=CC=CC=C2)CC3=CC=CC=C3)=NCCN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HG-10-102-01, CAS:1351758-81-0, Molecular Weight: 377.8254, C17H20ClN5O3, Purity:98, SMILES: COC1=CC(C(N2CCOCC2)=O)=CC=C1NC3=NC(NC)=C(Cl)C=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MHP 133, CAS:147340-43-0, Molecular Weight: 377.8254, C17H20ClN5O3, Purity:98, SMILES: O=C(N/N=C/C1=C(OC(N(C)C)=O)C=CC=[N+]1C)NC2=CC=CC=C2.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nefopam (hydrochloride), CAS:23327-57-3, Molecular Weight: 289.7998, C17H20ClNO, Purity:98, SMILES: CN1CCOC(C2=CC=CC=C2)C3=CC=CC=C3C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fenoldopam (mesylate), CAS:67227-57-0, Molecular Weight: 401.8618, C17H20ClNO6S, Purity:98, SMILES: OC1=C(O)C=C2C(C3=CC=C(O)C=C3)CNCCC2=C1Cl.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Omarigliptin, CAS:1226781-44-7, Molecular Weight: 398.4275, C17H20F2N4O3S, Purity:98, SMILES: N[C@@H]1[C@@H](C2=CC(F)=CC=C2F)OC[C@H](N3CC4=NN(S(=O)(C)=O)C=C4C3)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PQR309, CAS:1225037-39-7, Molecular Weight: 411.3816, C17H20F3N7O2, Purity:98, SMILES: NC1=NC=C(C2=NC(N3CCOCC3)=NC(N4CCOCC4)=N2)C(C(F)(F)F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pefloxacin, CAS:70458-92-3, Molecular Weight: 333.3574, C17H20FN3O3, Purity:98, SMILES: O=C(C1=CN(CC)C2=C(C=C(F)C(N3CCN(C)CC3)=C2)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-3-(Dibenzylamino-2-Fluoropropan-1-Ol, CAS:0, Molecular Weight: 273.3452, C17H20FNO, Purity:95, SMILES: OC[C@@H](F)CN(CC1=CC=CC=C1)CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Diphenylmethyl-3-Methyl-3-Azetidinamine, CAS:133891-52-8, Molecular Weight: 252.3541, C17H20N2, Purity:95, SMILES: CC1(N)CN(C1)C(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 3-(2-cyanopropan-2-yl)-1H-indole-1-carboxylate, CAS:380626-46-0, Molecular Weight: 284.3529, C17H20N2O2, Purity:95, SMILES: N#CC(c1cn(c2c1cccc2)C(=O)OC(C)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tropicamide, CAS:1508-75-4, Molecular Weight: 284.3529, C17H20N2O2, Purity:98, SMILES: O=C(N(CC)CC1=CC=NC=C1)C(C2=CC=CC=C2)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tropisetron, CAS:89565-68-4, Molecular Weight: 284.3529, C17H20N2O2, Purity:98, SMILES: O=C(C1=CNC2=C1C=CC=C2)O[C@H]3C[C@H]4CC[C@H](N4C)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-(Tert-ButoxycarbonylaminoPhenyl-1-Methyl-1H-Pyrrole-2-Carboxylic Acid, CAS:864076-03-9, Molecular Weight: 316.3517, C17H20N2O4, Purity:95, SMILES: CN1C=C(C=C1C(O)=O)C1=CC=C(NC(=O)OC(C)(C)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bumetanide, CAS:28395-03-1, Molecular Weight: 364.4161, C17H20N2O5S, Purity:98, SMILES: O=C(O)C1=CC(NCCCC)=C(OC2=CC=CC=C2)C(S(=O)(N)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| diethyl 2-(((benzyloxy)carbonyl)amino)-2-cyanosuccinate, CAS:159345-13-8, Molecular Weight: 348.3505, C17H20N2O6, Purity:95, SMILES: CCOC(=O)CC(NC(=O)OCc1ccccc1)(C#N)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-METHYL-5-(6-PHENYLPYRIDAZIN-3-YL)OCTAHYDROPYRROLO[3,4-C]PYRROLE, CAS:848591-89-9, Molecular Weight: 280.3675, C17H20N4, Purity:95, SMILES: CN1CC2CN(CC2C1)c1ccc(nn1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Riboflavin (phosphate sodium), CAS:130-40-5, Molecular Weight: 478.3256, C17H20N4NaO9P, Purity:98, SMILES: CC1=CC2=C(C=C1C)N=C(C(N2C[C@H](O)[C@H](O)[C@H](O)COP([O-])(O)=O)=N3)C(NC3=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 5'H-Spiro[Azetidine-3,6'-Pyrido[3,2-E]Pyrrolo[1,2-A]Pyrazine]-1-Carboxylate, CAS:1290627-64-3, Molecular Weight: 312.3663, C17H20N4O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)NC1=C(N=CC=C1)N1C=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Riboflavin, CAS:83-88-5, Molecular Weight: 376.3639, C17H20N4O6, Purity:98, SMILES: O[C@H]([C@H](O)[C@H](O)CO)CN1C(C=C(C)C(C)=C2)=C2N=C(C(N3)=O)C1=NC3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Olanzapine, CAS:132539-06-1, Molecular Weight: 312.4325, C17H20N4S, Purity:98, SMILES: CC1=CC(C(N2CCN(C)CC2)=N3)=C(S1)NC4=C3C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,6-Diazaspiro[3.5]nonane-1-propanenitrile, 3-methyl-β-oxo-6-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-, CAS:1263774-57-7, Molecular Weight: 324.3803, C17H20N6O, Purity:98, SMILES: N#CCC(N1CC(C)C12CN(C3=C4C(NC=C4)=NC=N3)CCC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KDM5-IN-1, CAS:1628210-26-3, Molecular Weight: 324.3803, C17H20N6O, Purity:98, SMILES: N#CC1=C2NC(C3=CN(C(C)(C)C)N=C3)=C(C(C)C)C(N2N=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
eFT508, CAS:1849590-01-7, Molecular Weight: 340.3797, C17H20N6O2, Purity:98, SMILES: O=C(C1=C(C)C=C(NC2=NC=NC(N)=C2)C(N13)=O)NC43CCCCC4, HPLC, NMR, LCMS is ok, stock more than 10g.
EOS Med Chem, Medchem is Big
執大象,天下往,往而無害,安平泰
2018. 4.18 Janpan CPHI, Attend
2018. 5.15 Israel Biomed, Attend
2018. 6. 20 China CPHI, W4E82
2018. 8. 28 Korea CPHI, Attend
2018. 10. 9 Spain World CPHI, Attend
郵箱: info@eosmedchem.com ; eosmedchem@gmail.com
辦公室: 0086-531-69905422-806(直通)
攜帶番號 & WhatsApp & Wechat: +8618653174435
住所: Diaozhen Chemical Industrial Park, Jinan City, China
Skype: willgutian
QQ: 2393923585
|