Tropisetron (Hydrochloride), CAS:105826-92-4, Molecular Weight: 320.8138, C17H21ClN2O2, Purity:98, SMILES: O=C(C1=CNC2=C1C=CC=C2)O[C@H]3C[C@H]4CC[C@H](N4C)C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
ML264, CAS:1550008-55-3, Molecular Weight: 384.8777, C17H21ClN2O4S, Purity:98, SMILES: O=C(NCC(N(C)C(CC1)CCS1(=O)=O)=O)/C=C/C2=CC=CC(Cl)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Promazine (hydrochloride), CAS:53-60-1, Molecular Weight: 320.88, C17H21ClN2S, Purity:98, SMILES: CN(C)CCCN1C2=C(C=CC=C2)SC3=CC=CC=C13.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Promethazine (hydrochloride), CAS:58-33-3, Molecular Weight: 320.88, C17H21ClN2S, Purity:98, SMILES: CC(N(C)C)CN1C(C=CC=C2)=C2SC3=CC=CC=C13.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
BVT 2733, CAS:376640-41-4, Molecular Weight: 428.9566, C17H21ClN4O3S2, Purity:98, SMILES: ClC1=C(C)C(S(NC2=NC(CC(N3CCN(C)CC3)=O)=CS2)(=O)=O)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl 2-(4,4-difluorocyclohexanecarboxamido)-3-phenylpropanoate, CAS:, Molecular Weight: 325.3503, C17H21F2NO3, Purity:95, SMILES: COC(=O)C(Cc1ccccc1)NC(=O)C1CCC(CC1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(2,4-difluorobenzoyl)piperidine-1-carboxylate, CAS:1159825-99-6, Molecular Weight: 325.3503, C17H21F2NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C(=O)C1=C(F)C=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(2,5-Difluorobenzoyl)piperidine-1-carboxylate, CAS:, Molecular Weight: 325.3503, C17H21F2NO3, Purity:95, SMILES: O=C(c1cc(F)ccc1F)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Fluoro-2-Oxospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:866028-06-0, Molecular Weight: 320.3586, C17H21FN2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(=O)NC1=C2C=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Atglistatin, CAS:1469924-27-3, Molecular Weight: 283.3681, C17H21N3O, Purity:98, SMILES: O=C(NC1=CC(C2=CC=C(N(C)C)C=C2)=CC=C1)N(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(1H-Pyrrolo[2,3-b]pyridin-3-yl)-5,6-dihydropyridine-1(2H)-carboxylate, CAS:400801-82-3, Molecular Weight: 299.3675, C17H21N3O2, Purity:95, SMILES: O=C(N1CCC(=CC1)c1c[nH]c2c1cccn2)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
U93631, CAS:152273-12-6, Molecular Weight: 299.3676, C17H21N3O2, Purity:98, SMILES: O=C(C1=C2N(C=N1)C3=C(C=CC=C3)NC2(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
MIM1, CAS:509102-00-5, Molecular Weight: 347.4319, C17H21N3O3S, Purity:98, SMILES: OC1=C(O)C(/C=N/N2/C(SC=C2C)=N/C3CCCCC3)=CC=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
KB-R7943 (mesylate), CAS:182004-65-5, Molecular Weight: 427.4951, C17H21N3O6S2, Purity:98, SMILES: NC(SCCC1=CC=C(OCC2=CC=C([N+]([O-])=O)C=C2)C=C1)=N.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
AVN-492, CAS:1220646-23-0, Molecular Weight: 359.44594, C17H21N5O2S, Purity:98, SMILES: O=S(C1=CC=CC=C1)(C2=C3N(C(C)=C(N(C)C)C(C)=N3)N=C2NC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Theodrenaline, CAS:13460-98-5, Molecular Weight: 375.37914, C17H21N5O5, Purity:98, SMILES: O=C(N1C)N(C)C2=C(N(CCNCC(C3=CC=C(O)C(O)=C3)O)C=N2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ruxolitinib (phosphate), CAS:1092939-17-7, Molecular Weight: 404.3602, C17H21N6O4P, Purity:98, SMILES: N#CC[C@H](C1CCCC1)N2N=CC(C3=C4C=CNC4=NC=N3)=C2.O=P(O)(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
SID 3712249, CAS:522606-67-3, Molecular Weight: 323.3955, C17H21N7, Purity:98, SMILES: NC1=C2C(C=C(N3CCCC3)N=C2N)=C(C#N)C(N4CCCC4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
MHY1485, CAS:326914-06-1, Molecular Weight: 387.3931, C17H21N7O4, Purity:98, SMILES: O=[N+](C1=CC=C(NC2=NC(N3CCOCC3)=NC(N4CCOCC4)=N2)C=C1)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
N-benzyl-1-(4-methoxyphenyl)propan-2-amine, CAS:43229-65-8, Molecular Weight: 255.3547, C17H21NO, Purity:95, SMILES: CC(NCC1=CC=CC=C1)CC2=CC=C(OC)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
SN 2, CAS:823218-99-1, Molecular Weight: 255.3547, C17H21NO, Purity:98, SMILES: CC(C=C(C)C=C1C)=C1C2=NOC3C2C4CC3CC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R)-N-(3,4-dimethoxybenzyl)-1-phenylethanamine, CAS:134430-93-6, Molecular Weight: 271.3541, C17H21NO2, Purity:95, SMILES: COc1ccc(CN[C@H](C)c2ccccc2)cc1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Napropamide, CAS:15299-99-7, Molecular Weight: 271.3541, C17H21NO2, Purity:98, SMILES: CC(OC1=C2C=CC=CC2=CC=C1)C(N(CC)CC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Etodolac, CAS:41340-25-4, Molecular Weight: 287.3535, C17H21NO3, Purity:98, SMILES: O=C(O)CC(OCC1)(CC)C2=C1C3=CC=CC(CC)=C3N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Galanthamine, CAS:357-70-0, Molecular Weight: 287.3535, C17H21NO3, Purity:98, SMILES: O[C@@H]1C[C@@H]2OC3=C4C(CN(C)CC[C@]42C=C1)=CC=C3OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fenoterol, CAS:13392-18-2, Molecular Weight: 303.3529, C17H21NO4, Purity:98, SMILES: OC1=CC(C(O)CNC(C)CC2=CC=C(O)C=C2)=CC(O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Scopolamine, CAS:51-34-3, Molecular Weight: 303.3529, C17H21NO4, Purity:98, SMILES: O=C([C@@H](C1=CC=CC=C1)CO)O[C@H]2C[C@H]3[C@@H]4O[C@@H]4[C@H](N3C)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ethyl 1-Cbz-5-oxoazepane-4-carboxylate, CAS:31696-09-0, Molecular Weight: 319.3523, C17H21NO5, Purity:95, SMILES: CCOC(=O)C1CCN(CCC1=O)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Racemic-(1S,3S,4R,6S-2-Benzyl 3-Ethyl 6-Hydroxy-2-Azabicyclo[2.2.1]Heptane-2,3-Dicarboxylate, CAS:1445949-65-4, Molecular Weight: 319.3523, C17H21NO5, Purity:95, SMILES: CCOC(=O)[C@@H]1C2C[C@H](O)C(C2)N1C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S-Methyl 2-(((BenzyloxyCarbonyl(Prop-2-Yn-1-YlAmino-4-(MethylsulfinylButanoate, CAS:0, Molecular Weight: 351.417, C17H21NO5S, Purity:95, SMILES: COC(=O)[C@H](CCS(C)=O)N(CC#C)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-benzyl 3,5-Dimethyl piperidine-1,3,5-tricarboxylate, CAS:1221818-73-0, Molecular Weight: 335.3517, C17H21NO6, Purity:95, SMILES: COC(=O)C1CC(CN(C1)C(=O)OCc1ccccc1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
benzhydryl diethyl phosphate, CAS:27329-60-8, Molecular Weight: 320.32, C17H21O4P, Purity:95, SMILES: CCOP(=O)(OCC)OC(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-ethyl-3-(4-nitrophenyl)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole, CAS:942920-11-8, Molecular Weight: 343.185, C17H22BN3O4, Purity:98, SMILES: CCn1cc(c(n1)c1ccc(cc1)[N+](=O)[O-])B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(3-(2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)phenyl)acetonitrile, CAS:, Molecular Weight: 283.173, C17H22BNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1CC1c1cccc(CC#N)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(4-((1R,2R)-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)phenyl)acetonitrile, CAS:, Molecular Weight: 283.173, C17H22BNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)[C@@H]1C[C@H]1c1ccc(CC#N)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(6-(METHYLSULFONAMIDO)NAPHTHALEN-2-YL)BORONIC ACID PINACOL ESTER, CAS:1132940-88-5, Molecular Weight: 347.237, C17H22BNO4S, Purity:95, SMILES: CS(=O)(=O)Nc1ccc2c(c1)ccc(c2)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(5-bromo-1H-indazol-3-yl)piperidine-1-carboxylate, CAS:1198284-77-3, Molecular Weight: 380.279, C17H22BrN3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C1=NNC2=C1C=C(Br)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Galanthamine (hydrobromide), CAS:1953-04-4, Molecular Weight: 368.2655, C17H22BrNO3, Purity:98, SMILES: O[C@@H]1C[C@@H]2OC3=C4C(CN(C)CC[C@]42C=C1)=CC=C3OC.Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fenoterol (hydrobromide), CAS:1944-12-3, Molecular Weight: 384.2649, C17H22BrNO4, Purity:98, SMILES: [H]Br.OC1=CC(C(O)CNC(C)CC2=CC=C(O)C=C2)=CC(O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Scopolamine (hydrobromide), CAS:114-49-8, Molecular Weight: 384.2649, C17H22BrNO4, Purity:98, SMILES: CN1[C@@H]2[C@H](O3)[C@H]3[C@H]1C[C@@H](OC([C@@H](C4=CC=CC=C4)CO)=O)C2.Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
SA504, CAS:35035-05-3, Molecular Weight: 400.39668, C17H22BrNOS2, Purity:98, SMILES: C[N+]1(C)C/C(CC(OC)C1)=C(C2=CC=CS2)\C3=CC=CS3.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Ro 10-5824 (dihydrochloride), CAS:189744-94-3, Molecular Weight: 353.28938, C17H22Cl2N4, Purity:98, SMILES: NC1=NC(C)=NC=C1CN2CC=C(C3=CC=CC=C3)CC2.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
TAK-659 (hydrochloride), CAS:1952251-28-3, Molecular Weight: 380.8475832, C17H22ClFN6O, Purity:98, SMILES: FC1=C(N[C@@H]2CCCC[C@@H]2N)N=C(C3=CN(C)N=C3)C4=C1CNC4=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(5-chloro-1H-indazol-3-yl)piperidine-1-carboxylate, CAS:1198284-74-0, Molecular Weight: 335.828, C17H22ClN3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C1=NNC2=C1C=C(Cl)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(5-Chloro-1H-indazol-3-yl)piperidine-1-carboxylate, CAS:1198284-74-0, Molecular Weight: 335.828, C17H22ClN3O2, Purity:95, SMILES: O=C(N1CCC(CC1)c1n[nH]c2c1cc(Cl)cc2)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pyrido[2,3-d]pyrimidine, 7-chloro-2-[(2R,6S)-2,6-dimethyl-4-morpholinyl]-4-(4-morpholinyl)-, rel-, CAS:938443-23-3, Molecular Weight: 363.842, C17H22ClN5O2, Purity:95, SMILES: C[C@@H]1O[C@H](C)CN(C1)c1nc2nc(Cl)ccc2c(n1)N1CCOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Atomoxetine (hydrochloride), CAS:82248-59-7, Molecular Weight: 291.8157, C17H22ClNO, Purity:98, SMILES: CC1=CC=CC=C1O[C@@H](C2=CC=CC=C2)CCNC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diphenhydramine (hydrochloride), CAS:147-24-0, Molecular Weight: 291.8157, C17H22ClNO, Purity:98, SMILES: CN(C)CCOC(C1=CC=CC=C1)C2=CC=CC=C2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R-tert-butyl (1-(2-chlorophenyl-2-oxocyclohexylcarbamate, CAS:0, Molecular Weight: 323.814, C17H22ClNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@]1(CCCCC1=O)C1=C(Cl)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Piperidinecarboxylic acid, 3-(3-chlorobenzoyl)-, 1,1-dimethylethyl ester, (3R)-, CAS:884512-09-8, Molecular Weight: 323.814, C17H22ClNO3, Purity:95, SMILES: Clc1cccc(c1)C(=O)[C@@H]1CCCN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ritodrine (hydrochloride), CAS:23239-51-2, Molecular Weight: 323.8145, C17H22ClNO3, Purity:98, SMILES: OC1=CC=C(CCN[C@H](C)[C@@H](O)C2=CC=C(O)C=C2)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
5-Methoxy-N-(2-(thiophen-2-yl)ethyl)-1,2,3,4-tetrahydronaphthalen-2-amine hydrochloride, CAS:102120-96-7, Molecular Weight: 323.881, C17H22ClNOS, Purity:95, SMILES: COc1cccc2c1CCC(C2)NCCc1cccs1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
BI605906, CAS:960293-88-3, Molecular Weight: 432.5084, C17H22F2N4O3S2, Purity:98, SMILES: O=C(C1=C(N)C2=C(C(F)(F)CC)C=C(N3CCC(S(=O)(C)=O)CC3)N=C2S1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S-ethyl 2-((tert-butoxycarbonylamino-3-(4-(((trifluoromethylsulfonyloxyphenylpropanoate, CAS:169158-01-4, Molecular Weight: 441.419, C17H22F3NO7S, Purity:95, SMILES: CCOC(=O)[C@H](CC1=CC=C(OS(=O)(=O)C(F)(F)F)C=C1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(5-Fluoro-1H-indazol-3-yl)piperidine-1-carboxylate, CAS:, Molecular Weight: 319.3739, C17H22FN3O2, Purity:95, SMILES: O=C(N1CCC(CC1)c1n[nH]c2c1cc(F)cc2)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(6-fluoro-1H-indazol-3-yl)piperidine-1-carboxylate, CAS:, Molecular Weight: 319.3739, C17H22FN3O2, Purity:95, SMILES: Fc1ccc2c(c1)[nH]nc2C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
5-fluoro-4-(1H-pyrazol-4-yl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indole, CAS:, Molecular Weight: 331.46, C17H22FN3OSi, Purity:95, SMILES: FC(C=CC1=C2C=CN1COCC[Si](C)(C)C)=C2C3=CNN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2-(4-Fluoro-2-Methylphenyl-4-Oxopiperidine-1-Carboxylate, CAS:1480151-85-6, Molecular Weight: 307.3599, C17H22FNO3, Purity:95, SMILES: CC1=CC(F)=CC=C1C1CC(=O)CCN1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(4-fluorobenzoyl)piperidine-1-carboxylate, CAS:160296-40-2, Molecular Weight: 307.3599, C17H22FNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C(=O)C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(4-fluorobenzoyl)piperidine-1-carboxylate, CAS:160296-40-2, Molecular Weight: 307.3599, C17H22FNO3, Purity:95, SMILES: O=C(c1ccc(cc1)F)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Iopamidol, CAS:60166-93-0, Molecular Weight: 777.0853, C17H22I3N3O8, Purity:98, SMILES: O=C(C1=C(I)C(NC([C@@H](O)C)=O)=C(I)C(C(NC(CO)CO)=O)=C1I)NC(CO)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Amino-3-(DibenzylaminoPropan-2-Ol, CAS:50456-65-0, Molecular Weight: 270.3694, C17H22N2O, Purity:95, SMILES: NCC(O)CN(CC1=CC=CC=C1)CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
7-N-Benzyl-1-oxo-2,7-diazaspiro[4.5]decan-10-one ethylene ketal, CAS:, Molecular Weight: 302.3682, C17H22N2O3, Purity:95, SMILES: O=C1NCCC21CN(CCC12OCCO1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl 2-Oxo-1,8-Diazaspiro[4.6]Undecane-8-Carboxylate, CAS:1160246-78-5, Molecular Weight: 302.3682, C17H22N2O3, Purity:95, SMILES: O=C(OCC1=CC=CC=C1)N1CCCC2(CCC(=O)N2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl 2-Oxo-1,9-Diazaspiro[5.5]Undecane-9-Carboxylate, CAS:1160246-77-4, Molecular Weight: 302.3682, C17H22N2O3, Purity:95, SMILES: O=C(OCC1=CC=CC=C1)N1CCC2(CCCC(=O)N2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
CL-82198, CAS:307002-71-7, Molecular Weight: 302.3682, C17H22N2O3, Purity:98, SMILES: O=C(C1=CC2=CC=CC=C2O1)NCCCCN3CCOCC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl (1r,3r)-1-(4-cyanophenyl)-3-hydroxy-3-methylcyclobutylcarbamate, CAS:, Molecular Weight: 302.3682, C17H22N2O3, Purity:95, SMILES: O=C(OC(C)(C)C)N[C@@]1(C2=CC=C(C#N)C=C2)C[C@](C)(O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2'-Oxo-2',4'-Dihydro-1'H-Spiro[Pyrrolidine-3,3'-Quinoline]-1-Carboxylate, CAS:1160247-71-1, Molecular Weight: 302.3682, C17H22N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)CC1=CC=CC=C1NC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2-Oxospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:252882-60-3, Molecular Weight: 302.3682, C17H22N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(=O)NC1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3-Oxospiro[Isoindoline-1,4'-Piperidine]-1'-Carboxylate, CAS:920023-54-7, Molecular Weight: 302.3682, C17H22N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)NC(=O)C1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
Trichostatin A, CAS:58880-19-6, Molecular Weight: 302.3682, C17H22N2O3, Purity:98, SMILES: CN(C1=CC=C(C=C1)C([C@@H](/C=C(/C=C/C(NO)=O)C)C)=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-Boc-1,2-dihydro-2-oxo-spiro[4H-3,1-benzoxazine-4,4'-piperidine], CAS:84060-08-2, Molecular Weight: 318.3676, C17H22N2O4, Purity:95, SMILES: O=C1Nc2ccccc2C2(O1)CCN(CC2)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Boc-2-Cbz-4-Methylene-Pyrazolidine, CAS:503072-28-4, Molecular Weight: 318.3676, C17H22N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC(=C)CN1C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Noopept, CAS:157115-85-0, Molecular Weight: 318.3676, C17H22N2O4, Purity:98, SMILES: O=C(OCC)CNC([C@H]1N(C(CC2=CC=CC=C2)=O)CCC1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
ethyl 4-(1-hydrazinylethyl)benzoate benzenesulfonate, CAS:1415565-11-5, Molecular Weight: 366.432, C17H22N2O5S, Purity:98, SMILES: OS(=O)(=O)c1ccccc1.CCOC(=O)c1ccc(cc1)C(C)NN, HPLC, NMR, LCMS is ok, stock more than 10g. |
Minaprine, CAS:25905-77-5, Molecular Weight: 298.3828, C17H22N4O, Purity:98, SMILES: CC1=CC(C2=CC=CC=C2)=NN=C1NCCN3CCOCC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-(4-amino-2-(ethoxymethyl)-1H-imidazo[4,5-c]quinolin-1-yl)-2-methylpropan-2-ol, CAS:144875-48-9, Molecular Weight: 314.3822, C17H22N4O2, Purity:95, SMILES: CCOCc1nc2c(N)nc3ccccc3c2n1CC(C)(C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Resiquimod, CAS:144875-48-9, Molecular Weight: 314.3822, C17H22N4O2, Purity:98, SMILES: OC(C)(C)CN1C(COCC)=NC2=C1C3=CC=CC=C3N=C2N, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(6-Formylpyrazolo[1,5-a]pyrimidin-2-yl)piperidine-1-carboxylate, CAS:1258638-43-5, Molecular Weight: 330.3816, C17H22N4O3, Purity:95, SMILES: O=Cc1cnc2n(c1)nc(c2)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
VS-5584, CAS:1246560-33-7, Molecular Weight: 354.4096, C17H22N8O, Purity:98, SMILES: NC1=NC=C(C2=C3N=C(C)N(C(C)C)C3=NC(N4CCOCC4)=N2)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
RPH-2823, CAS:96558-24-6, Molecular Weight: 370.40898, C17H22N8O2, Purity:98, SMILES: OC(COC1=CC=C(C2=NC3=C(N)N=C(N)N=C3N=C2N)C=C1)CN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bephenium, CAS:7181-73-9, Molecular Weight: 256.3621, C17H22NO+, Purity:98, SMILES: C[N+](CCOC1=CC=CC=C1)(C)CC2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Podocarpic acid, CAS:5947-49-9, Molecular Weight: 274.35478, C17H22O3, Purity:98, SMILES: O=C([C@@]1(C)CCC[C@]2(C)C3=C(CC[C@@]12[H])C=CC(O)=C3)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-(4-Methoxybenzyl-4-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-Yl-1H-Pyrazole, CAS:1105039-88-0, Molecular Weight: 314.187, C17H23BN2O3, Purity:95, SMILES: COC1=CC=C(CN2C=C(C=N2)B2OC(C)(C)C(C)(C)O2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-(Tert-Butoxycarbonyl-2-Oxospiro[Indoline-3,4'-Piperidine]-5-Ylboronic Acid, CAS:1246372-96-2, Molecular Weight: 346.186, C17H23BN2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(=O)NC1=CC=C(C=C21)B(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-[4-(4,4,5,5-Tetramethyl-[1,3,2]dioxaborolan-2-yl)-phenyl]-cyclopropanecarboxylic acid methyl ester, CAS:1396007-85-4, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)C1(CC1)C1=CC=C(C=C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 2-((1R,2R)-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzoate, CAS:, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)c1ccccc1[C@@H]1C[C@H]1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 2-(1-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzoate, CAS:, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)c1ccccc1C1(CC1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 2-(2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzoate, CAS:, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)c1ccccc1C1CC1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 3-((1R,2R)-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzoate, CAS:, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)c1cccc(c1)[C@@H]1C[C@H]1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 3-(1-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzoate, CAS:, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)c1cccc(c1)C1(CC1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 3-(2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzoate, CAS:, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)c1cccc(c1)C1CC1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 4-((1R,2R)-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzoate, CAS:, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)c1ccc(cc1)[C@@H]1C[C@H]1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 4-(1-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzoate, CAS:, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)c1ccc(cc1)C1(CC1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 4-(2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclopropyl)benzoate, CAS:1240492-31-2, Molecular Weight: 302.173, C17H23BO4, Purity:95, SMILES: COC(=O)c1ccc(cc1)C1CC1B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Bromospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:878167-55-6, Molecular Weight: 367.281, C17H23BrN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CNC3=CC=C(Br)C=C23)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cyclohexaneacetic acid, 4-[4-(bromomethyl)phenyl]-, ethyl ester, trans-, CAS:1359943-47-7, Molecular Weight: 339.267, C17H23BrO2, Purity:90, SMILES: CCOC(=O)C[C@@H]1CC[C@H](CC1)c1ccc(cc1)CBr, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Chlorospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:637362-21-1, Molecular Weight: 322.83, C17H23ClN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CNC3=CC=C(Cl)C=C23)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Etomoxir, CAS:124083-20-1, Molecular Weight: 326.8151, C17H23ClO4, Purity:98, SMILES: O=C(OCC)[C@@]1(OC1)CCCCCCOC2=CC=C(C=C2)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Naratriptan (D3 Hydrochloride), CAS:1190021-64-7, Molecular Weight: 374.9437, C17H23D3ClN3O2S, Purity:98, SMILES: CNS(CCC1=CC=C(NC=C2C3CCN(C([2H])([2H])[2H])CC3)C2=C1)(=O)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Fluorospiro[Indoline-3,4'-Piperidine]-1-Carboxylate, CAS:858351-47-0, Molecular Weight: 306.3751, C17H23FN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(CCNCC2)C2=CC(F)=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
PR66, CAS:2531-04-6, Molecular Weight: 285.38402, C17H23N3O, Purity:98, SMILES: O=C1N(C2CCN(C)CC2)NC(C3=CC=CC=C3)=C1CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
(-)-Indolactam V, CAS:90365-57-4, Molecular Weight: 301.3834, C17H23N3O2, Purity:98, SMILES: CC(C)[C@@H](C1=O)N(C)C2=C3C(NC=C3C[C@H](N1)CO)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Boc-4-(7-Azaindol-1-yl)piperidine, CAS:1093759-55-7, Molecular Weight: 301.3834, C17H23N3O2, Purity:95, SMILES: O=C(N1CCC(CC1)n1ccc2c1nccc2)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 4-(Cyano(PhenylMethylPiperazine-1-Carboxylate, CAS:444891-21-8, Molecular Weight: 301.3834, C17H23N3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC1)C(C#N)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Oxo-6,7-Dihydro-5H-Spiro[[1,6]Naphthyridine-8,4'-Piperidine]-1'-Carboxylate, CAS:1330765-76-8, Molecular Weight: 317.3828, C17H23N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CNC(=O)C1=C2N=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
A66, CAS:1166227-08-2, Molecular Weight: 393.5268, C17H23N5O2S2, Purity:98, SMILES: CC(C)(C1=NC(C2=C(N=C(S2)NC(N3[C@@H](CCC3)C(N)=O)=O)C)=CS1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Taltirelin, CAS:103300-74-9, Molecular Weight: 405.4084, C17H23N7O5, Purity:98, SMILES: O=C(N(CCC1)[C@@H]1C(N)=O)[C@@H](NC([C@@H](NC2=O)CC(N2C)=O)=O)CC3=CN=CN3, HPLC, NMR, LCMS is ok, stock more than 10g. |
9-benzyl-9-azabicyclo[5.3.1]undecan-11-one, CAS:1193388-93-0, Molecular Weight: 257.3706, C17H23NO, Purity:95, SMILES: O=C1C2CCCCCC1CN(C2)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ML213, CAS:489402-47-3, Molecular Weight: 257.37062, C17H23NO, Purity:98, SMILES: O=C(C1C(C2)CCC2C1)NC3=C(C)C=C(C)C=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Atropine, CAS:51-55-8, Molecular Weight: 289.3694, C17H23NO3, Purity:98, SMILES: O=C(O[C@@H]1C[C@@H](N2C)CC[C@@H]2C1)C(CO)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
L-Hyoscyamine, CAS:101-31-5, Molecular Weight: 289.3694, C17H23NO3, Purity:98, SMILES: CN1[C@@H]2C[C@@H](OC([C@@H](C3=CC=CC=C3)CO)=O)C[C@H]1CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Atropine (sulfate), CAS:55-48-1, Molecular Weight: 338.41, C17H23NO3 . 1/2 H2O4S , Purity:98, SMILES: O=C(O[C@@H]1C[C@@H](N2C)CC[C@@H]2C1)C(CO)C3=CC=CC=C3.[0.5H2SO4], HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzyl 3-Ethyl 2-Methylpiperidine-1,3-Dicarboxylate, CAS:0, Molecular Weight: 305.3688, C17H23NO4, Purity:95, SMILES: CCOC(=O)C1CCCN(C1C)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-benzyl 4-ethyl 4-methylpiperidine-1,4-dicarboxylate, CAS:203521-95-3, Molecular Weight: 305.3688, C17H23NO4, Purity:95, SMILES: CCOC(=O)C1(C)CCN(CC1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Anisodamine, CAS:55869-99-3, Molecular Weight: 305.3688, C17H23NO4, Purity:98, SMILES: CN1[C@H]2[C@@H](O)C[C@@H]1C[C@H](OC([C@@H](C3=CC=CC=C3)CO)=O)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cis-1-(Tert-Butoxycarbonyl-3-Phenylpiperidine-4-Carboxylic Acid, CAS:1068522-21-3, Molecular Weight: 305.3688, C17H23NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC[C@@H]([C@@H](C1)C1=CC=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2-(4-Methoxyphenyl-4-Oxopiperidine-1-Carboxylate, CAS:1823776-36-8, Molecular Weight: 305.3688, C17H23NO4, Purity:95, SMILES: COC1=CC=C(C=C1)C1CC(=O)CCN1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Carbamic acid, [2-(2,2-dimethyl-4H-1,3-benzodioxin-6-yl)-2-oxoethyl]-, 1,1-dimethylethyl ester, CAS:452339-71-8, Molecular Weight: 321.3682, C17H23NO5, Purity:90, SMILES: O=C(OC(C)(C)C)NCC(=O)c1ccc2c(c1)COC(O2)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Boc-beta-homoaspartic acid(OBzl), CAS:254101-10-5, Molecular Weight: 337.3676, C17H23NO6, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@H](CC(O)=O)CC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Boc-Glu-OBzl, CAS:30924-93-7, Molecular Weight: 337.3676, C17H23NO6, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H](CCC(O)=O)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(4-FLUORO-1-ISOPROPYL-2-METHYL-1H-BENZO[D]IMIDAZOL-6-YL)BORONIC ACID PINACOL ESTER, CAS:1231930-37-2, Molecular Weight: 318.194, C17H24BFN2O2, Purity:95, SMILES: Fc1cc(cc2c1nc(n2C(C)C)C)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
NBD-557, CAS:333352-59-3, Molecular Weight: 382.2953, C17H24BrN3O2, Purity:98, SMILES: O=C(C(NC1CC(C)(NC(C)(C1)C)C)=O)NC2=CC=C(C=C2)Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
Homatropine (methylbromide), CAS:80-49-9, Molecular Weight: 370.2814, C17H24BrNO3, Purity:98, SMILES: C[N+]1([C@@H]2C[C@@H](OC(C(O)C3=CC=CC=C3)=O)C[C@H]1CC2)C.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Chlorospiro[Indoline-3,4'-Piperidine]-1-Carboxylate Hydrochloride, CAS:1188264-23-4, Molecular Weight: 359.291, C17H24Cl2N2O2, Purity:95, SMILES: Cl.CC(C)(C)OC(=O)N1CC2(CCNCC2)C2=C1C=CC(Cl)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Minaprine (dihydrochloride), CAS:25953-17-7, Molecular Weight: 371.3047, C17H24Cl2N4O, Purity:98, SMILES: [H]Cl.CC1=CC(C2=CC=CC=C2)=NN=C1NCCN3CCOCC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
NBD-556, CAS:333353-44-9, Molecular Weight: 337.8444, C17H24ClN3O2, Purity:98, SMILES: O=C(C(NC1CC(C)(NC(C)(C1)C)C)=O)NC2=CC=C(C=C2)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Piperidinecarboxylic acid, 3-[(R)-(3-chlorophenyl)hydroxymethyl]-, 1,1-dimethylethyl ester, (3R)-, CAS:942142-74-7, Molecular Weight: 325.83, C17H24ClNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC[C@H](C1)[C@@H](O)c1cccc(Cl)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
5,6-Dimethoxy-2-(piperidin-4-ylmethyl)-2,3-dihydro-1H-inden-1-one hydrochloride, CAS:120013-39-0, Molecular Weight: 325.83, C17H24ClNO3, Purity:97, SMILES: COc1cc2c(cc1OC)CC(C2=O)CC1CCNCC1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 1-benzyl-3,3-difluoropiperidin-4-ylcarbamate, CAS:, Molecular Weight: 326.3815, C17H24F2N2O2, Purity:95, SMILES: O=C(OC(C)(C)C)NC1CCN(CC1(F)F)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Gosogliptin, CAS:869490-23-3, Molecular Weight: 366.4088664, C17H24F2N6O, Purity:98, SMILES: O=C([C@H](C1)NC[C@H]1N2CCN(CC2)C3=NC=CC=N3)N4CC(CC4)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Velneperit, CAS:342577-38-2, Molecular Weight: 407.451, C17H24F3N3O3S, Purity:98, SMILES: FC(F)(F)C1=CN=C(NC([C@H]2CC[C@H](NS(=O)(C(C)(C)C)=O)CC2)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-((4-fluorophenyl)(hydroxy)methyl)piperidine-1-carboxylate, CAS:160296-41-3, Molecular Weight: 309.3758, C17H24FNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C(O)C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-((4-Fluorophenyl)(hydroxy)methyl)piperidine-1-carboxylate, CAS:160296-41-3, Molecular Weight: 309.3758, C17H24FNO3, Purity:95, SMILES: OC(c1ccc(cc1)F)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl 2,9-Diazaspiro[5.5]Undecane-2-Carboxylate, CAS:1086394-61-7, Molecular Weight: 288.3847, C17H24N2O2, Purity:95, SMILES: O=C(OCC1=CC=CC=C1)N1CCCC2(CCNCC2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
benzyl 2,9-diazaspiro[5.5]undecane-2-carboxylate, CAS:1086394-61-7, Molecular Weight: 288.3847, C17H24N2O2, Purity:95, SMILES: O=C(N1CCCC2(C1)CCNCC2)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Phenglutarimid, CAS:1156-05-4, Molecular Weight: 288.38466, C17H24N2O2, Purity:98, SMILES: O=C(C(C1=CC=CC=C1)(CCN(CC)CC)CC2)NC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Racemic-Tert-Butyl ((2S,6S-1,2,3,4,5,6-Hexahydro-2,6-Methanobenzo[B]Azocin-11-YlCarbamate, CAS:1250883-88-5, Molecular Weight: 288.3847, C17H24N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)NC1[C@@H]2CCC[C@H]1C1=CC=CC=C1N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
S 38093, CAS:862896-30-8, Molecular Weight: 288.38466, C17H24N2O2, Purity:98, SMILES: O=C(N)C1=CC=C(OCCCN2CC3C(CCC3)C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl N-[(4-Tert-Butylphenyl(CyanoMethyl]Carbamate, CAS:774225-35-3, Molecular Weight: 288.3847, C17H24N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)NC(C#N)C1=CC=C(C=C1)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl Spiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:180465-84-3, Molecular Weight: 288.3847, C17H24N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CNC3=C2C=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl (1-(4-formylphenyl)piperidin-4-yl)carbamate, CAS:, Molecular Weight: 304.3841, C17H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)NC1CCN(CC1)c1ccc(C=O)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl N-[2-Oxo-1-Phenyl-2-(Pyrrolidin-1-YlEthyl]Carbamate, CAS:136329-30-1, Molecular Weight: 304.3841, C17H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)NC(C(=O)N1CCCC1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(1-BENZYL-4-NITROMETHYL-PIPERIDIN-4-YL-ACETIC ACID ETHYL ESTER, CAS:154495-66-6, Molecular Weight: 320.3835, C17H24N2O4, Purity:95, SMILES: CCOC(=O)CC1(C[N+]([O-])=O)CCN(CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R-tert-butyl (1-(benzyloxy-2,2-dimethyl-4-oxoazetidin-3-ylcarbamate, CAS:0, Molecular Weight: 320.3835, C17H24N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@H]1C(=O)N(OCC2=CC=CC=C2)C1(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S-tert-butyl (1-(benzyloxy-2,2-dimethyl-4-oxoazetidin-3-ylcarbamate, CAS:0, Molecular Weight: 320.3835, C17H24N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H]1C(=O)N(OCC2=CC=CC=C2)C1(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(1-Benzyl-Piperidin-3-Yl-3-Nitro-Propionic Acid Ethyl Ester, CAS:1357352-31-8, Molecular Weight: 320.3835, C17H24N2O4, Purity:95, SMILES: CCOC(=O)C(C[N+]([O-])=O)C1CCCN(CC2=CC=CC=C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Trans-Tert-Butyl 3-(((BenzyloxyCarbonylAmino-4-Hydroxypyrrolidine-1-Carboxylate, CAS:952443-93-5, Molecular Weight: 336.3829, C17H24N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H](O)[C@@H](C1)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sinapine (thiocyanate), CAS:7431-77-8, Molecular Weight: 368.4478, C17H24N2O5S, Purity:98, SMILES: COC1=C(O)C(OC)=CC(C=CC(OCC[N+](C)(C)C)=O)=C1.N#C[S-], HPLC, NMR, LCMS is ok, stock more than 10g. |
SNS-032, CAS:345627-80-7, Molecular Weight: 380.528, C17H24N4O2S2, Purity:98, SMILES: CC(C)(C1=CN=C(CSC2=CN=C(NC(C3CCNCC3)=O)S2)O1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Geniposide, CAS:24512-63-8, Molecular Weight: 388.3665, C17H24O10, Purity:98, SMILES: O[C@@H]1[C@@H](CO)O[C@@H](O[C@H]2[C@@]3([H])[C@@](CC=C3CO)([H])C(C(OC)=O)=CO2)[C@H](O)[C@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(E)-[6]-Dehydroparadol, CAS:878006-06-5, Molecular Weight: 276.3707, C17H24O3, Purity:98, SMILES: CCCCCCCC(/C=C/C1=CC=C(O)C(OC)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cyclandelate, CAS:456-59-7, Molecular Weight: 276.3707, C17H24O3, Purity:98, SMILES: O=C(OC1CC(C)(C)CC(C)C1)C(O)C2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Shogaol, CAS:555-66-8, Molecular Weight: 276.3707, C17H24O3, Purity:98, SMILES: OC1=C(OC)C=C(CCC(/C=C/CCCCC)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(1R,2R,4R-1,7,7-trimethylbicyclo[2.2.1]heptan-2-yl 4-methylbenzenesulfonate, CAS:22467-56-7, Molecular Weight: 308.436, C17H24O3S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)O[C@H]1CC2CC[C@]1(C)C2(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-O-Acetylbritannilactone, CAS:33627-41-7, Molecular Weight: 308.3694, C17H24O5, Purity:98, SMILES: O[C@H]1[C@@](C2=C)([H])[C@@](OC2=O)([H])CC(C)=C1[C@@H](C)CCCOC(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate, CAS:850568-72-8, Molecular Weight: 304.189, C17H25BO4, Purity:95, SMILES: CC(C)(C)OC(=O)c1ccc(cc1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl 2,9-Diazaspiro[5.5]Undecane-2-Carboxylate Hydrochloride Hydrochloride, CAS:1714144-91-8, Molecular Weight: 324.846, C17H25ClN2O2, Purity:95, SMILES: Cl.O=C(OCC1=CC=CC=C1)N1CCCC2(CCNCC2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cis-Tert-Butyl3A-Phenylhexahydropyrrolo[3,4-C]Pyrrole-2(1H-Carboxylate Hydrochloride, CAS:0, Molecular Weight: 324.846, C17H25ClN2O2, Purity:95, SMILES: Cl.CC(C)(C)OC(=O)N1C[C@@H]2CNC[C@@]2(C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
LY2334737, CAS:892128-60-8, Molecular Weight: 389.3943, C17H25F2N3O5, Purity:98, SMILES: OC[C@@H]1[C@H](C(F)(F)[C@H](N2C(N=C(C=C2)NC(C(CCC)CCC)=O)=O)O1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert butyl 3,4-Trans-4-(Benzylamino)-3-fluoropiperidine-1-carboxylate, CAS:211108-52-0, Molecular Weight: 308.391, C17H25FN2O2, Purity:95, SMILES: F[C@@H]1CN(CC[C@H]1NCc1ccccc1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
MS023, CAS:1831110-54-3, Molecular Weight: 287.3999, C17H25N3O, Purity:98, SMILES: CN(CCN)CC1=CNC=C1C2=CC=C(OC(C)C)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetrodotoxin (citrate), CAS:18660-81-6, Molecular Weight: 511.3915, C17H25N3O15, Purity:98, SMILES: O[C@@]1([H])[C@]2(NC(N)=N[C@@H]3O)[C@]3([H])[C@](O4)([H])[C@](CO)(O)[C@@]1([H])O[C@]4(O)[C@H]2O.OC(C(O)=O)(CC(O)=O)CC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
MG 1, CAS:148274-76-4, Molecular Weight: 303.3993, C17H25N3O2, Purity:98, SMILES: O=C1N(CC(O)CN2CCN(C3=CC=CC=C3)CC2)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Vildagliptin, CAS:274901-16-5, Molecular Weight: 303.3993, C17H25N3O2, Purity:98, SMILES: O[C@@]1(C2)C[C@H]3C[C@H](C[C@]2(NCC(N4[C@H](C#N)CCC4)=O)C3)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Almotriptan, CAS:154323-57-6, Molecular Weight: 335.4643, C17H25N3O2S, Purity:98, SMILES: O=S(CC1=CC2=C(NC=C2CCN(C)C)C=C1)(N3CCCC3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Naratriptan, CAS:121679-13-8, Molecular Weight: 335.4643, C17H25N3O2S, Purity:98, SMILES: O=S(CCC1=CC2=C(NC=C2C3CCN(C)CC3)C=C1)(NC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 1'-Methyl-5'-Oxo-1',5',6',7'-Tetrahydrospiro[Piperidine-4,4'-Pyrrolo[2,3-C]Pyridine]-1-Carboxylate, CAS:0, Molecular Weight: 319.3987, C17H25N3O3, Purity:95, SMILES: CN1C=CC2=C1CNC(=O)C21CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cipropride (S enantiomer), CAS:66183-70-8, Molecular Weight: 367.4631, C17H25N3O4S, Purity:98, SMILES: O=C(NC[C@H]1N(CC2CC2)CCC1)C3=CC(S(=O)(N)=O)=CC=C3OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Meropenem, CAS:96036-03-2, Molecular Weight: 383.4625, C17H25N3O5S, Purity:98, SMILES: O=C(C(N12)=C(S[C@@H]3CN[C@H](C(N(C)C)=O)C3)[C@H](C)[C@]2([H])[C@@H]([C@H](O)C)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Veralipride, CAS:66644-81-3, Molecular Weight: 383.4625, C17H25N3O5S, Purity:98, SMILES: O=C(NCC1N(CC=C)CCC1)C2=CC(S(=O)(N)=O)=CC(OC)=C2OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sch59498, CAS:224157-99-7, Molecular Weight: 315.4133, C17H25N5O, Purity:98, SMILES: CN1C2=N[C@@](CCC3)([H])[C@@]3([H])N2C4=C(N=C(CCCCCC)N4)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-(2-AcetylphenylNonanamide, CAS:1496050-19-1, Molecular Weight: 275.3859, C17H25NO2, Purity:95, SMILES: CCCCCCCCC(=O)NC1=CC=CC=C1C(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-Butyl 4-(benzyloxy)piperidine-1-carboxylate, CAS:159557-47-8, Molecular Weight: 291.3853, C17H25NO3, Purity:95, SMILES: O=C(N1CCC(CC1)OCc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-hydroxy-4-(o-tolyl)piperidine-1-carboxylate, CAS:553630-96-9, Molecular Weight: 291.3853, C17H25NO3, Purity:95, SMILES: Cc1ccccc1C1(O)CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Atropine (sulfate monohydrate), CAS:5908-99-6, Molecular Weight: 347.42, C17H25NO5.5S0.5, Purity:98, SMILES: O=C(C(C1=CC=CC=C1)CO)O[C@H]2C[C@@H](CC3)N(C)[C@@H]3C2.[0.5H2SO4].[0.5H2O], HPLC, NMR, LCMS is ok, stock more than 10g. |
((S)-1-(tert-butoxycarbonyl)pyrrolidin-2-yl)methyl 4-methylbenzenesulfonate, CAS:86661-32-7, Molecular Weight: 355.449, C17H25NO5S, Purity:95, SMILES: O=S(C1=CC=C(C)C=C1)(OC[C@H]2N(C(OC(C)(C)C)=O)CCC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(TOLUENE-4-SULFONYLOXY)-PIPERIDINE-1-CARBOXYLIC ACID TERT-BUTYL ESTER, CAS:118811-07-7, Molecular Weight: 355.449, C17H25NO5S, Purity:99, SMILES: Cc1ccc(cc1)S(=O)(=O)OC1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
t-Butyl 3-(p-tolylsulfonyloxy)piperidine-1-carboxylate, CAS:85275-46-3, Molecular Weight: 355.449, C17H25NO5S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)OC1CCCN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 4-(TosyloxyPiperidine-1-Carboxylate, CAS:118811-07-7, Molecular Weight: 355.449, C17H25NO5S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OC1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S-Tert-Butyl 2-((TosyloxyMethylMorpholine-4-Carboxylate, CAS:148638-76-0, Molecular Weight: 371.448, C17H25NO6S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OC[C@@H]1CN(CCO1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
EMIGLITATE, CAS:80879-63-6, Molecular Weight: 355.3829, C17H25NO7, Purity:98, SMILES: O=C(OCC)C1=CC=C(OCCN2[C@H](CO)[C@@H](O)[C@H](O)[C@@H](O)C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-[4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzyl]morpholine, CAS:364794-79-6, Molecular Weight: 303.204, C17H26BNO3, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1ccc(cc1)CN1CCOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl (4-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-YlPhenylCarbamate, CAS:330793-01-6, Molecular Weight: 319.204, C17H26BNO4, Purity:95, SMILES: CC(C)(C)OC(=O)NC1=CC=C(C=C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ditert-Butyl 3-Bromo-6,6-Dimethylpyrrolo[3,4-C]Pyrazole-2,5(4H,6H-Dicarboxylate, CAS:1330766-42-1, Molecular Weight: 416.31, C17H26BrN3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1N=C2C(CN(C(=O)OC(C)(C)C)C2(C)C)=C1Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
Naratriptan (hydrochloride), CAS:143388-64-1, Molecular Weight: 371.9252, C17H26ClN3O2S, Purity:98, SMILES: O=S(CCC1=CC2=C(NC=C2C3CCN(C)CC3)C=C1)(NC)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pitolisant, CAS:362665-56-3, Molecular Weight: 295.8474, C17H26ClNO, Purity:98, SMILES: ClC1=CC=C(CCCOCCCN2CCCCC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Levobunolol (hydrochloride), CAS:27912-14-7, Molecular Weight: 327.8463, C17H26ClNO3, Purity:98, SMILES: O=C1CCCC2=C1C=CC=C2OC[C@@H](O)CNC(C)(C)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Buflomedil (hydrochloride), CAS:35543-24-9, Molecular Weight: 343.8456, C17H26ClNO4, Purity:98, SMILES: O=C(C1=C(OC)C=C(OC)C=C1OC)CCCN2CCCC2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
(4-Phenyl-Piperidin-4-Ylmethyl-Carbamic Acid Tert-Butyl Ester, CAS:1071866-01-7, Molecular Weight: 290.4005, C17H26N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)NCC1(CCNCC1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzyl-3-Boc-aminomethylpyrrolidine, CAS:155497-10-2, Molecular Weight: 290.4005, C17H26N2O2, Purity:95, SMILES: O=C(NCC1CN(CC2=CC=CC=C2)CC1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(4-amino-3-methylphenyl)piperidine-1-carboxylate, CAS:1383682-59-4, Molecular Weight: 290.4005, C17H26N2O2, Purity:95, SMILES: Cc1cc(ccc1N)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
(6S,10aR,Z-Methyl 6-((Tert-ButoxycarbonylAmino-5-Oxo-1,2,3,5,6,7,10,10A-Octahydropyrrolo[1,2-A]Azocine-10A-Carboxylate, CAS:0, Molecular Weight: 338.3987, C17H26N2O5, Purity:95, SMILES: COC(=O)[C@]12CCCN1C(=O)[C@H](C\C=C/C2)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R-tert-butyl (1-((benzyloxyamino-3-hydroxy-3-methyl-1-oxobutan-2-ylcarbamate, CAS:0, Molecular Weight: 338.3987, C17H26N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H](C(=O)NOCC1=CC=CC=C1)C(C)(C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl (2-(((BenzyloxyCarbonylAminoEthyl(2-HydroxyethylCarbamate, CAS:169773-08-4, Molecular Weight: 338.3987, C17H26N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N(CCO)CCNC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ethyl 2-(di(tert-butoxycarbonyl)amino)-5-methylthiazole-4-carboxylate, CAS:, Molecular Weight: 386.463, C17H26N2O6S, Purity:94, SMILES: CCOC(=O)c1sc(nc1C)N(C(=O)OC(C)(C)C)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Alniditan, CAS:152317-89-0, Molecular Weight: 302.41454, C17H26N4O, Purity:98, SMILES: C1(NCCCNC[C@H]2CCC3=CC=CC=C3O2)=NCCCN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Gly-Phe-Arg, CAS:, Molecular Weight: 378.4, C17H26N6O4, Purity:98, SMILES: [GFR], HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(trans-4-Pentylcyclohexyl)phenol, CAS:82575-69-7, Molecular Weight: 246.3877, C17H26O, Purity:99, SMILES: CCCCC[C@H]1CC[C@@H](CC1)c1ccc(O)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Loganin, CAS:18524-94-2, Molecular Weight: 390.3824, C17H26O10, Purity:98, SMILES: O[C@H]([C@@H](O)[C@@H]1O)[C@](O[C@@H]1CO)([H])O[C@H]2[C@@]([C@H]3C)([H])[C@@](C[C@@H]3O)([H])C(C(OC)=O)=CO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
11-Phenylundecanoic acid, CAS:3343-24-6, Molecular Weight: 262.3871, C17H26O2, Purity:95, SMILES: OC(=O)CCCCCCCCCCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(3,5-Di-tert-butyl-4-hydroxyphenyl)propionic acid, CAS:20170-32-5, Molecular Weight: 278.3865, C17H26O3, Purity:95, SMILES: CC(C)(C)c1cc(CCC(O)=O)cc(c1O)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Paradol, CAS:27113-22-0, Molecular Weight: 278.3865, C17H26O3, Purity:98, SMILES: COC1=C(O)C=CC(CCC(CCCCCCC)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
[6]-Gingerol, CAS:23513-14-6, Molecular Weight: 294.3859, C17H26O4, Purity:98, SMILES: CCCCC[C@H](O)CC(CCC1=CC=C(O)C(OC)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Embelin, CAS:550-24-3, Molecular Weight: 294.3859, C17H26O4, Purity:98, SMILES: O=C1C(O)=C(CCCCCCCCCCC)C(C(O)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Methyl-4-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)piperazine, CAS:747413-21-4, Molecular Weight: 302.219, C17H27BN2O2, Purity:98, SMILES: CN1CCN(CC1)c1ccc(cc1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sibutramine (hydrochloride), CAS:84485-00-7, Molecular Weight: 316.309, C17H27Cl2N, Purity:98, SMILES: ClC1=CC=C(C2(C(N(C)C)CC(C)C)CCC2)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pitolisant (hydrochloride), CAS:903576-44-3, Molecular Weight: 332.3084, C17H27Cl2NO, Purity:98, SMILES: ClC(C=C1)=CC=C1CCCOCCCN2CCCCC2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Phenampromid (hydrochloride), CAS:98348-21-1, Molecular Weight: 310.86208, C17H27ClN2O, Purity:98, SMILES: CCC(N(C(C)CN1CCCCC1)C2=CC=CC=C2)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
((3H-[1,2,3]Triazolo[4,5-b]pyridin-3-yl)oxy)tri(pyrrolidin-1-yl)phosphonium hexafluorophosphate(V), CAS:156311-83-0, Molecular Weight: 521.3805, C17H27F6N7OP2, Purity:95, SMILES: F[P+](F)(F)(F)(F)F.C1CCN(C1)[P+](On1nnc2cccnc12)(N1CCCC1)N1CCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Amisulpride, CAS:71675-85-9, Molecular Weight: 369.479, C17H27N3O4S, Purity:98, SMILES: CCN1C(CNC(C2=CC(S(=O)(CC)=O)=C(N)C=C2OC)=O)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Gabexate (mesylate), CAS:56974-61-9, Molecular Weight: 417.4772, C17H27N3O7S, Purity:98, SMILES: O=C(OCC)C1=CC=C(OC(CCCCCNC(N)=N)=O)C=C1.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-Amino-6,7-Dihydro-9H-Pyrimido[5,4-E][1,4]Diazepine-5,8-Dicarboxylic Acid Di-Tert-Butyl Ester, CAS:1250997-39-7, Molecular Weight: 365.4274, C17H27N5O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(C(=O)OC(C)(C)C)C2=CNC(=N)N=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Venlafaxine, CAS:93413-69-5, Molecular Weight: 277.4018, C17H27NO2, Purity:98, SMILES: OC1(C(C2=CC=C(OC)C=C2)CN(C)C)CCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S-1-Benzyl-3-((Tert-ButyldimethylsilylOxyPyrrolidin-2-One, CAS:0, Molecular Weight: 305.4873, C17H27NO2Si, Purity:95, SMILES: CC(C)(C)[Si](C)(C)O[C@H]1CCN(CC2=CC=CC=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Embutramide, CAS:15687-14-6, Molecular Weight: 293.40118, C17H27NO3, Purity:98, SMILES: O=C(NCC(C1=CC=CC(OC)=C1)(CC)CC)CCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nonivamide, CAS:2444-46-4, Molecular Weight: 293.4012, C17H27NO3, Purity:98, SMILES: CCCCCCCCC(NCC1=CC=C(O)C(OC)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nordihydrocapsaicin, CAS:28789-35-7, Molecular Weight: 293.4012, C17H27NO3, Purity:95, SMILES: COc1cc(CNC(=O)CCCCCC(C)C)ccc1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R-2-((3R,5R,7R-Adamantan-1-Yl-2-((Tert-ButoxycarbonylAminoAcetic Acid, CAS:1564266-26-7, Molecular Weight: 309.4006, C17H27NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H](C(O)=O)C12CC3CC(CC(C3)C1)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Racemic-(3aR,4S,6S,7S,7aS-5-tert-butyl 6-ethyl 2,2-dimethyltetrahydro-4,7-methano[1,3]dioxolo[4,5-c]pyridine-5,6(6H-dicarboxylate, CAS:1250883-57-8, Molecular Weight: 341.3994, C17H27NO6, Purity:95, SMILES: CCOC(=O)[C@@H]1C2CC(C3OC(C)(C)O[C@@H]23)N1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(Boc-amino)benzeneboronic acid pinacol ester, CAS:330793-01-6, Molecular Weight: 337.219, C17H28BNO5, Purity:95, SMILES: O=C(OC(C)(C)C)Nc1ccc(cc1)B(OC(C(O)(C)C)(C)C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Amisulpride (hydrochloride), CAS:81342-13-4, Molecular Weight: 405.9399, C17H28ClN3O4S, Purity:98, SMILES: CCN1C(CNC(C2=CC(S(=O)(CC)=O)=C(N)C=C2OC)=O)CCC1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
ICI 118,551 (hydrochloride), CAS:72795-01-8, Molecular Weight: 313.8627, C17H28ClNO2, Purity:98, SMILES: CC1=C(CCC2)C2=C(OC[C@H](O)[C@@H](C)NC(C)C)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Venlafaxine (hydrochloride), CAS:99300-78-4, Molecular Weight: 313.8627, C17H28ClNO2, Purity:98, SMILES: OC1(C(C2=CC=C(OC)C=C2)CN(C)C)CCCCC1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pramocaine (hydrochloride), CAS:637-58-1, Molecular Weight: 329.8621, C17H28ClNO3, Purity:98, SMILES: CCCCOC1=CC=C(OCCCN2CCOCC2)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
di-tert-butyl 9-oxo-3,7-diaza-bicyclo[3.3.1]nonane-3,7-dicarboxylate, CAS:1664366-95-3, Molecular Weight: 340.4146, C17H28N2O5, Purity:95, SMILES: O=C(N1CC2CN(CC(C1)C2=O)C(=O)OC(C)(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Racemic-(4R,4aR,9aS-7-tert-butyl 4-ethyl 1-oxooctahydro-1H-pyrido[3,4-d]azepine-4,7(8H-dicarboxylate, CAS:0, Molecular Weight: 340.4146, C17H28N2O5, Purity:95, SMILES: CCOC(=O)[C@H]1CNC(=O)[C@H]2CCN(CC[C@@H]12)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-Timolol (Maleate), CAS:26921-17-5, Molecular Weight: 432.4918, C17H28N4O7S, Purity:98, SMILES: O[C@H](COC1=NSN=C1N2CCOCC2)CNC(C)(C)C.O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Metoprolol (Tartrate), CAS:56392-17-7, Molecular Weight: 342.41, C17H28NO6, Purity:98, SMILES: OC(CNC(C)C)COC1=CC=C(CCOC)C=C1.O=C(O)[C@H](O)[C@@H](O)C(O)=O.[0.5], HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(1-((Tert-ButyldimethylsilylOxy-2-Methylpropan-2-YlBenzoic Acid, CAS:1005786-00-4, Molecular Weight: 308.4879, C17H28O3Si, Purity:95, SMILES: CC(C)(CO[Si](C)(C)C(C)(C)C)C1=CC=C(C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Artemotil, CAS:75887-54-6, Molecular Weight: 312.4012, C17H28O5, Purity:98, SMILES: C[C@@H]1[C@@](CC[C@@H](C)[C@]2([H])CC[C@]3(C)O4)([H])[C@@]2(OO3)[C@]4([H])O[C@@H]1OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-phenyl-2,5,8,11,14-pentaoxahexadecan-16-ol, CAS:57671-28-0, Molecular Weight: 328.4006, C17H28O6, Purity:95, SMILES: OCCOCCOCCOCCOCCOCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(1S,3R)-5-Bromo-3-[[(tert-butyldimethylsilyl)oxy]methyl]-1-methyl-1,2,3,4-tetrahydroisoquinoline hydrochloride, CAS:1638668-28-6, Molecular Weight: 406.861, C17H29BrClNOSi, Purity:95, SMILES: Cl.C[C@@H]1N[C@@H](CO[Si](C)(C)C(C)(C)C)Cc2c(Br)cccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sibutramine (hydrochloride monohydrate), CAS:125494-59-9, Molecular Weight: 334.3242, C17H29Cl2NO, Purity:98, SMILES: ClC1=CC=C(C2(C(N(C)C)CC(C)C)CCC2)C=C1.O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ropivacaine (hydrochloride monohydrate), CAS:132112-35-7, Molecular Weight: 328.8773, C17H29ClN2O2, Purity:98, SMILES: O=C([C@H]1N(CCC)CCCC1)NC2=C(C)C=CC=C2C.O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Gadoteridol, CAS:120066-54-8, Molecular Weight: 558.6848, C17H29GdN4O7, Purity:98, SMILES: CC1O([H])[Gd+3]2([N]3(CC4)CC5=O)([N]6(CC7)CC([O-]2)=O)([N]47CC8=O)([O-]8)([O-]5)[N](CC6)(CC3)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Imidodicarbonic Acid, 2-?(4-?Methylenecyclohexyl?-?, 1,?3-?Bis(1,?1-?Dimethylethyl Ester, CAS:725255-41-4, Molecular Weight: 311.4165, C17H29NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N(C1CCC(=C)CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
5-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)-2-(2-((trimethylsilyl)oxy)propan-2-yl)pyridine, CAS:1228014-10-5, Molecular Weight: 335.322, C17H30BNO3Si, Purity:98, SMILES: CC(C)(O[Si](C)(C)C)c1ccc(cn1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl (4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)cyclohex-3-en-1-yl)carbamate, CAS:1251732-64-5, Molecular Weight: 323.235, C17H30BNO4, Purity:95, SMILES: CC(C)(C)OC(=O)NC1CCC(=CC1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Aloxistatin, CAS:88321-09-9, Molecular Weight: 342.4305, C17H30N2O5, Purity:98, SMILES: O=C([C@H]1O[C@@H]1C(N[C@H](C(NCCC(C)C)=O)CC(C)C)=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
di-tert-butyl 9-hydroxy-3,7-diaza-bicyclo[3.3.1]nonane-3,7-dicarboxylate, CAS:228270-29-9, Molecular Weight: 342.4305, C17H30N2O5, Purity:95, SMILES: OC1C2CN(CC1CN(C2)C(=O)OC(C)(C)C)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
(RS)-Butyryltimolol, CAS:, Molecular Weight: 386.5095, C17H30N4O4S, Purity:98, SMILES: CCCC(OC(CNC(C)(C)C)COC1=NSN=C1N2CCOCC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Gly-Arg-Gly-Asp-Ser, CAS:, Molecular Weight: 490.5, C17H30N8O9, Purity:98, SMILES: [GRGDS], HPLC, NMR, LCMS is ok, stock more than 10g. |
(4R,5S,6S)-3-(((3S,5S)-5-(dimethylcarbamoyl)pyrrolidin-3-yl)thio)-6-((R)-1-hydroxyethyl)-4-methyl-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic acid trihydrate, CAS:119478-56-7, Molecular Weight: 437.508, C17H31N3O8S, Purity:95, SMILES: O.O.O.[H][C@@]1([C@@H](C)O)[C@H]2[C@@H](C)C(S[C@@H]3CN[C@@H](C3)C(=O)N(C)C)=C(N2C1=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Meropenem (trihydrate), CAS:119478-56-7, Molecular Weight: 437.5083, C17H31N3O8S, Purity:98, SMILES: O=C(C(N12)=C(S[C@@H]3CN[C@H](C(N(C)C)=O)C3)[C@H](C)[C@]2([H])[C@@H]([C@H](O)C)C1=O)O.O.O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S,4S-1-Tert-Butyl 2-Methyl 4-((Tert-ButyldimethylsilylOxy-5-Oxopyrrolidine-1,2-Dicarboxylate, CAS:367966-67-4, Molecular Weight: 373.5166, C17H31NO6Si, Purity:95, SMILES: COC(=O)[C@@H]1C[C@H](O[Si](C)(C)C(C)(C)C)C(=O)N1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tin(IV) tributan-1-ide pyridin-2-ide, CAS:17997-47-6, Molecular Weight: 368.145, C17H31NSn, Purity:95, SMILES: [Sn+4].CCC[CH2-].CCC[CH2-].CCC[CH2-].c1ccn[c-]c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
8-Tert-Butyl3-Ethyl2,8-Diazaspiro[4.5]Decane-3,8-Dicarboxylate Mesylate, CAS:0, Molecular Weight: 408.51, C17H32N2O7S, Purity:95, SMILES: CS(O)(=O)=O.CCOC(=O)C1CC2(CN1)CCN(CC2)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Leucylarginylproline, CAS:133943-59-6, Molecular Weight: 384.4738, C17H32N6O4, Purity:98, SMILES: O=C(O)[C@H]1N(C([C@H](CCCNC(N)=N)NC([C@H](CC(C)C)N)=O)=O)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
9-Borabicyclo [3.3.1] nonane dimer, CAS:21205-91-4, Molecular Weight: 259.066, C17H33B2, Purity:97, SMILES: C[H][B]1([H]B2C3CCCC2CCC3)[C@H]2CCC[C@H]1CCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S,4S-1-Tert-Butyl 2-Methyl 4-((Tert-ButyldimethylsilylOxyPyrrolidine-1,2-Dicarboxylate, CAS:367966-45-8, Molecular Weight: 359.5331, C17H33NO5Si, Purity:95, SMILES: COC(=O)[C@@H]1C[C@@H](CN1C(=O)OC(C)(C)C)O[Si](C)(C)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Heptadecanal, CAS:629-90-3, Molecular Weight: 254.4513, C17H34O, Purity:95, SMILES: CCCCCCCCCCCCCCCCC=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Heptadecanoic acid, CAS:506-12-7, Molecular Weight: 270.4507, C17H34O2, Purity:95, SMILES: CCCCCCCCCCCCCCCCC(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl palmitate, CAS:112-39-0, Molecular Weight: 270.4507, C17H34O2, Purity:95, SMILES: CCCCCCCCCCCCCCCC(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetrabutylammonium triflate, CAS:35895-70-6, Molecular Weight: 391.533, C17H36F3NO3S, Purity:95, SMILES: [O-]S(=O)(=O)C(F)(F)F.CCCC[N+](CCCC)(CCCC)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ribostamycin (sulfate), CAS:53797-35-6, Molecular Weight: 552.5511, C17H36N4O14S, Purity:98, SMILES: O=S(O)(O)=O.O[C@@H]([C@H](O)[C@@H](CN)O1)[C@@H](N)[C@@]1([H])O[C@@H]2[C@@H](N)C[C@@H](N)[C@H](O)[C@@]2([H])O[C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Heptadecan-1-ol, CAS:1454-85-9, Molecular Weight: 256.4671, C17H36O, Purity:95, SMILES: CCCCCCCCCCCCCCCCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,5,8,11,14,17,20,23-octaoxapentacosan-25-ol, CAS:25990-96-9, Molecular Weight: 384.4623, C17H36O9, Purity:95, SMILES: COCCOCCOCCOCCOCCOCCOCCOCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
AOP;7-(Azabenzotriazol-1-yl)oxy tris(dimethylamino)phosphonium hexafluorophosphate, CAS:156311-85-2, Molecular Weight: 419.4854, C17H39N7OP2, Purity:95, SMILES: C[P+](C)(C)(C)(C)C.CN([P+](N(C)C)(N(C)C)On1nnc2c1nccc2)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Letrazuril, CAS:103337-74-2, Molecular Weight: 391.1833632, C17H9Cl2FN4O2, Purity:98, SMILES: O=C(N1)N(N=CC1=O)C2=CC(Cl)=C(C(C3=CC=C(F)C=C3)C#N)C(Cl)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ciliobrevin A, CAS:302803-72-1, Molecular Weight: 358.1783, C17H9Cl2N3O2, Purity:98, SMILES: N#C/C(C(C1=CC=C(Cl)C=C1Cl)=O)=C(N2)\NC3=C(C=CC=C3)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diclazuril, CAS:101831-37-2, Molecular Weight: 407.638, C17H9Cl3N4O2, Purity:98, SMILES: O=C(NC1=O)N(N=C1)C2=CC(Cl)=C(C(C#N)C3=CC=C(Cl)C=C3)C(Cl)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Novaluron, CAS:116714-46-6, Molecular Weight: 492.7046, C17H9ClF8N2O4, Purity:98, SMILES: O=C(NC(NC1=CC=C(OC(F)(F)C(F)OC(F)(F)F)C(Cl)=C1)=O)C2=C(F)C=CC=C2F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pyr6, CAS:245747-08-4, Molecular Weight: 418.2684, C17H9F7N4O, Purity:98, SMILES: O=C(C1=C(F)C=NC=C1)NC2=CC=C(N3N=C(C(F)(F)F)C=C3C(F)(F)F)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
SJB2-043, CAS:63388-44-3, Molecular Weight: 275.2583, C17H9NO3, Purity:98, SMILES: O=C1C2=C(N=C(C3=CC=CC=C3)O2)C(C4=CC=CC=C41)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Teriparatide, CAS:52232-67-4, Molecular Weight: 4117.72, C181H291N55O51S2, Purity:98, SMILES: [Teriparatide], HPLC, NMR, LCMS is ok, stock more than 10g. |
Exendin-4, CAS:141758-74-9, Molecular Weight: 4186.57188, C184H282N50O60S, Purity:98, SMILES: OC[C@@H](C(N)=O)NC([C@H]1N(C([C@H]2N(C([C@H]3N(C([C@H](C)NC(CNC([C@H](CO)NC([C@H](CO)NC([C@H]4N(C(CNC(CNC([C@H](CC(N)=O)NC([C@H](CCCCN)NC([C@H](CC(C)C)NC([C@H](CC5=CNC6=CC=CC=C56)NC([C@H](CCC(O)=O)NC([C@H]([C@@H](C)CC)NC([C@H](CC7=CC=CC=C7)NC([C@H](CC(C)C)NC([C@H](CCCNC(N)=N)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](CCC(O)=O)NC([C@H](CCC(O)=O)NC([C@H](CCC(O)=O)NC([C@H](CCSC)NC([C@H](CCC(N)=O)NC([C@H](CCCCN)NC([C@H](CO)NC([C@H](CC(C)C)NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H]([C@H](O)C)NC([C@H](CC8=CC=CC=C8)NC([C@H]([C@H](O)C)NC(CNC([C@H](CCC(O)=O)NC(CNC([C@H](CC9=CNC=N9)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CCC4)=O)=O)=O)=O)=O)CCC3)=O)CCC2)=O)CCC1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Exendin-4 (Acetate), CAS:914454-01-6, Molecular Weight: 4246.624, C186H286N50O62S, Purity:98, SMILES: CC(O)=O.OC[C@@H](C(N)=O)NC([C@H]1N(C([C@H]2N(C([C@H]3N(C([C@H](C)NC(CNC([C@H](CO)NC([C@H](CO)NC([C@H]4N(C(CNC(CNC([C@H](CC(N)=O)NC([C@H](CCCCN)NC([C@H](CC(C)C)NC([C@H](CC5=CNC6=CC=CC=C56)NC([C@H](CCC(O)=O)NC([C@H]([C@@H](C)CC)NC([C@H](CC7=CC=CC=C7)NC([C@H](CC(C)C)NC([C@H](CCCNC(N)=N)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](CCC(O)=O)NC([C@H](CCC(O)=O)NC([C@H](CCC(O)=O)NC([C@H](CCSC)NC([C@H](CCC(N)=O)NC([C@H](CCCCN)NC([C@H](CO)NC([C@H](CC(C)C)NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H]([C@H](O)C)NC([C@H](CC8=CC=CC=C8)NC([C@H]([C@H](O)C)NC(CNC([C@H](CCC(O)=O)NC(CNC([C@H](CC9=CNC=N9)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CCC4)=O)=O)=O)=O)=O)CCC3)=O)CCC2)=O)CCC1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
tris(perfluorophenyl)borane, CAS:1109-15-5, Molecular Weight: 511.98, C18BF15, Purity:95, SMILES: Fc1c(F)c(F)c(B(c2c(F)c(F)c(F)c(F)c2F)c2c(F)c(F)c(F)c(F)c2F)c(F)c1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
CFTR(inh)-172, CAS:307510-92-5, Molecular Weight: 409.4021, C18H10F3NO3S2, Purity:98, SMILES: S=C(S/1)N(C2=CC=CC(C(F)(F)F)=C2)C(C1=C\C3=CC=C(C=C3)C(O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Antitumor Compound 1, CAS:420126-30-3, Molecular Weight: 428.3542, C18H10F6N4S, Purity:98, SMILES: FC(C1=CC=C(NC2=NC(C3=C(C(F)(F)F)N=C4C=CC=CN43)=CS2)C=C1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
TCS PIM-1 1, CAS:491871-58-0, Molecular Weight: 367.1961, C18H11BrN2O2, Purity:98, SMILES: OC1=C(C(N2)=CC(C3=CC=CC=C3)=C(C#N)C2=O)C=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ro 22-3245, CAS:76988-39-1, Molecular Weight: 340.20604, C18H11Cl2N3, Purity:98, SMILES: ClC1=CC=CC=C1C2=NCC3=CN=CN=C3C4=CC=C(Cl)C=C42, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(2,5-Dichloropyrimidin-4-yl)-1-(phenylsulfonyl)-1H-indole, CAS:882562-40-5, Molecular Weight: 404.27, C18H11Cl2N3O2S, Purity:95, SMILES: Clc1ncc(c(n1)c1cn(c2c1cccc2)S(=O)(=O)c1ccccc1)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
USP7/USP47 inhibitor, CAS:1247825-37-1, Molecular Weight: 484.3992, C18H11Cl2N3O3S3, Purity:98, SMILES: ClC1=CN=CC(Cl)=C1SC2=C(C#N)C=C(C(NC3=CC=C(S(C)(=O)=O)C=C3)=O)S2, HPLC, NMR, LCMS is ok, stock more than 10g. |
(Z)-MDL 105519, CAS:179105-67-0, Molecular Weight: 376.19024, C18H11Cl2NO4, Purity:98, SMILES: O=C(C(N1)=C(/C=C(C(O)=O)/C2=CC=CC=C2)C3=C1C=C(Cl)C=C3Cl)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
MDL 105519, CAS:161230-88-2, Molecular Weight: 376.1902, C18H11Cl2NO4, Purity:98, SMILES: O=C(O)C(N1)=C(/C=C(C2=CC=CC=C2)/C(O)=O)C3=C1C=C(Cl)C=C3Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Etoricoxib D4, CAS:1131345-14-6, Molecular Weight: 362.8665, C18H11D4ClN2O2S, Purity:98, SMILES: ClC(C=N1)=CC(C2=C([2H])C([2H])=C(S(C)(=O)=O)C([2H])=C2[2H])=C1C3=CN=C(C)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Oxaprozin D4, CAS:, Molecular Weight: 297.3412, C18H11D4NO3, Purity:98, SMILES: OC(C([2H])([2H])C([2H])([2H])C1=NC(C2=CC=CC=C2)=C(C3=CC=CC=C3)O1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PFK-158, CAS:1462249-75-7, Molecular Weight: 328.2879496, C18H11F3N2O, Purity:98, SMILES: O=C(C1=CC=NC=C1)/C=C/C2=NC3=CC(C(F)(F)F)=CC=C3C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK-5498A, CAS:1253186-49-0, Molecular Weight: 399.2899, C18H11F6N3O, Purity:98, SMILES: O=C(NC1=NN(CC2=C(F)C=CC=C2C(F)(F)F)C=C1)C3=C(F)C=CC=C3F, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-((7-(cyanomethyl)-1-oxo-2,3-dihydro-1H-inden-4-yl)oxy)-5-fluorobenzonitrile, CAS:, Molecular Weight: 306.2905, C18H11FN2O2, Purity:90, SMILES: FC1=CC(OC2=CC=C(CC#N)C3=C2CCC3=O)=CC(C#N)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK1059615, CAS:958852-01-2, Molecular Weight: 333.3638, C18H11N3O2S, Purity:98, SMILES: O=C(S/C1=C\C2=CC=C3N=CC=C(C3=C2)C4=CC=NC=C4)NC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
[2,2':6',2''-Terpyridine]-4,4',4''-tricarboxylic acid, CAS:216018-58-5, Molecular Weight: 365.2964, C18H11N3O6, Purity:95, SMILES: OC(=O)c1cc(nc(c1)c1nccc(c1)C(=O)O)c1nccc(c1)C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
triphenylene, CAS:217-59-4, Molecular Weight: 228.2879, C18H12, Purity:95, SMILES: c1ccc2c(c1)c1ccccc1c1ccccc21, HPLC, NMR, LCMS is ok, stock more than 10g. |
4,4-Dibromo-p-terphenyl, CAS:17788-94-2, Molecular Weight: 388.096, C18H12Br2, Purity:95, SMILES: BrC1=CC=C(C=C1)C1=CC=C(C=C1)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-Bromo-9-phenyl-9H-carbazole, CAS:1153-85-1, Molecular Weight: 322.199, C18H12BrN, Purity:98, SMILES: Brc1ccc2c(c1)c1ccccc1n2c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
PF 05089771, CAS:1235403-62-9, Molecular Weight: 500.354, C18H12Cl2FN5O3S2, Purity:98, SMILES: O=S(C1=CC(Cl)=C(OC2=CC=C(Cl)C=C2C3=CNN=C3N)C=C1F)(NC4=CSC=N4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4EGI-1, CAS:315706-13-9, Molecular Weight: 451.2833, C18H12Cl2N4O4S, Purity:98, SMILES: O=C(O)/C(CC1=CC=CC=C1[N+]([O-])=O)=N/NC2=NC(C3=CC=C(Cl)C(Cl)=C3)=CS2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Delafloxacin, CAS:189279-58-1, Molecular Weight: 440.7605, C18H12ClF3N4O4, Purity:98, SMILES: O=C(C1=CN(C2=NC(N)=C(F)C=C2F)C3=C(C=C(F)C(N4CC(O)C4)=C3Cl)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
NQ301, CAS:130089-98-4, Molecular Weight: 325.74578, C18H12ClNO3, Purity:98, SMILES: O=C1C(NC2=CC=C(C(C)=O)C=C2)=C(Cl)C(C3=C1C=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tris(4-fluorophenyl)phosphine, CAS:18437-78-0, Molecular Weight: 316.2569, C18H12F3P, Purity:96, SMILES: Fc1ccc(cc1)P(c1ccc(F)cc1)c1ccc(F)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(5-(2-fluorophenyl)thiophen-2-yl)(5-iodo-2-methylphenyl)methanone, CAS:, Molecular Weight: 422.255, C18H12FIOS, Purity:95, SMILES: O=C(C1=CC=C(C2=CC=CC=C2F)S1)C3=CC(I)=CC=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
(5-(3-fluorophenyl)thiophen-2-yl)(5-iodo-2-methylphenyl)methanone, CAS:, Molecular Weight: 422.255, C18H12FIOS, Purity:95, SMILES: O=C(C1=CC=C(C2=CC=CC(F)=C2)S1)C3=CC(I)=CC=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tris(4-iodophenyl)amine, CAS:4181-20-8, Molecular Weight: 623.008, C18H12I3N, Purity:95, SMILES: IC1=CC=C(C=C1)N(C1=CC=C(I)C=C1)C1=CC=C(I)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,2-Biquinoline, CAS:119-91-5, Molecular Weight: 256.3013, C18H12N2, Purity:95, SMILES: C1=CC=C2N=C(C=CC2=C1)C1=NC2=CC=CC=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
UK-5099, CAS:56396-35-1, Molecular Weight: 288.3001, C18H12N2O2, Purity:98, SMILES: O=C(O)/C(C#N)=C/C1=CN(C2=CC=CC=C2)C3=C1C=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
10074-G5, CAS:413611-93-5, Molecular Weight: 332.31288, C18H12N4O3, Purity:98, SMILES: O=[N+]([O-])C1=CC=C(NC2=CC=CC=C2C3=CC=CC=C3)C4=NON=C41, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,4,6-tri(pyridin-4-yl)-1,3,5-triazine, CAS:42333-78-8, Molecular Weight: 312.3281, C18H12N6, Purity:95, SMILES: c1cc(ccn1)-c1nc(nc(n1)-c1ccncc1)-c1ccncc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sodium 3,3',3''-phosphinetriyltribenzenesulfonate, CAS:63995-70-0, Molecular Weight: 568.421, C18H12Na3O9PS3, Purity:98, SMILES: [Na+].[Na+].[Na+].[O-]S(=O)(=O)c1cccc(c1)P(c1cccc(c1)S([O-])(=O)=O)c1cccc(c1)S([O-])(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tanshinone I, CAS:568-73-0, Molecular Weight: 276.2861, C18H12O3, Purity:98, SMILES: O=C(C1=C2C=CC3=C1C=CC=C3C)C(C4=C2OC=C4C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Boronic acid, B-(6-phenyl-4-dibenzofuranyl)-, CAS:1010068-85-5, Molecular Weight: 288.105, C18H13BO3, Purity:95, SMILES: OB(O)c1cccc2c1oc1c(cccc21)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
5'-Bromo-1,1':3',1''-terphenyl, CAS:103068-20-8, Molecular Weight: 309.2, C18H13Br, Purity:97, SMILES: Brc1cc(cc(c1)c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1H-Pyrrolo[2,3-b]pyridine, 4-(3-bromo-2-thienyl)-1-[(4-methylphenyl)sulfonyl]-, CAS:942920-42-5, Molecular Weight: 433.342, C18H13BrN2O2S2, Purity:97, SMILES: Cc1ccc(cc1)S(=O)(=O)n1ccc2c1nccc2c1sccc1Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(4-bromothiophen-2-yl)-1-tosyl-1H-pyrrolo[2,3-b]pyridine, CAS:, Molecular Weight: 433.342, C18H13BrN2O2S2, Purity:95, SMILES: O=S(N1C=CC2=C(C3=CC(Br)=CS3)C=CN=C21)(C4=CC=C(C)C=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Skp2 Inhibitor C1, CAS:432001-69-9, Molecular Weight: 465.3408, C18H13BrN2O4S2, Purity:98, SMILES: S=C(S/1)N(CC2=CN=CC=C2)C(C1=C\C(C=C(Br)C=C3)=C3OCC(O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
CL-387785, CAS:194423-06-8, Molecular Weight: 381.226, C18H13BrN4O, Purity:98, SMILES: O=C(NC1=CC2=C(NC3=CC=CC(Br)=C3)N=CN=C2C=C1)C#CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
VU 0364439, CAS:1246086-78-1, Molecular Weight: 422.2851, C18H13Cl2N3O3S, Purity:98, SMILES: O=C(C1=NC=CC=C1)NC2=CC=C(S(=O)(NC3=CC=CC=C3Cl)=O)C(Cl)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Aliconazole, CAS:63824-12-4, Molecular Weight: 363.66822, C18H13Cl3N2, Purity:98, SMILES: ClC1=CC=C(/C=C(C2=CC=C(Cl)C=C2)\CN3C=CN=C3)C(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ROCK inhibitor, CAS:867017-68-3, Molecular Weight: 402.7852, C18H13ClF2N6O, Purity:98, SMILES: NC1=NC(Cl)=CC(NC2=CC(F)=C(OC3=C4C(NC=C4C)=NC=C3)C(F)=C2)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bay 41-4109, CAS:298708-81-3, Molecular Weight: 395.7629, C18H13ClF3N3O2, Purity:98, SMILES: O=C(C1=C(C)N=C(C2=NC=C(F)C=C2F)N[C@H]1C3=CC=C(F)C=C3Cl)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bay 41-4109 (less active enantiomer), CAS:476617-51-3, Molecular Weight: 395.7629296, C18H13ClF3N3O2, Purity:98, SMILES: O=C(C1=C(C)N=C(C2=NC=C(F)C=C2F)N[C@@H]1C3=CC=C(F)C=C3Cl)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bay 41-4109 (racemate), CAS:298708-79-9, Molecular Weight: 395.7629296, C18H13ClF3N3O2, Purity:98, SMILES: O=C(C1=C(C)N=C(C2=NC=C(F)C=C2F)NC1C3=CC=C(F)C=C3Cl)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
CCG-1423, CAS:285986-88-1, Molecular Weight: 454.7508, C18H13ClF6N2O3, Purity:98, SMILES: O=C(NOC(C)C(NC1=CC=C(Cl)C=C1)=O)C2=CC(C(F)(F)F)=CC(C(F)(F)F)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
RG7090, CAS:802906-73-6, Molecular Weight: 325.7673, C18H13ClFN3, Purity:98, SMILES: CC1=C(C#CC2=CC(Cl)=NC=C2)N=C(C)N1C3=CC=C(F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
GNF-2, CAS:778270-11-4, Molecular Weight: 374.3166, C18H13F3N4O2, Purity:98, SMILES: O=C(C1=CC=CC(C2=CC(NC3=CC=C(OC(F)(F)F)C=C3)=NC=N2)=C1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pyr10, CAS:1315323-00-2, Molecular Weight: 449.3701, C18H13F6N3O2S, Purity:98, SMILES: O=S(C1=CC=C(C)C=C1)(NC2=CC=C(N3N=C(C(F)(F)F)C=C3C(F)(F)F)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bay 59-3074, CAS:406205-74-1, Molecular Weight: 453.3555, C18H13F6NO4S, Purity:98, SMILES: O=S(CCCC(F)(F)F)(OC1=CC=CC(OC2=CC=CC(C(F)(F)F)=C2C#N)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
9H-Carbazole, 2-fluoro-7-(3-pyridinylmethyl)-, CAS:164914-28-7, Molecular Weight: 276.3076232, C18H13FN2, Purity:98, SMILES: FC1=CC(NC2=C3C=CC(CC4=CC=CN=C4)=C2)=C3C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
DPH, CAS:484049-04-9, Molecular Weight: 336.3198, C18H13FN4O2, Purity:98, SMILES: O=C1NC(C(N1)C2=CN(N=C2C3=CC=C(C=C3)F)C4=CC=CC=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PF-4989216, CAS:1276553-09-3, Molecular Weight: 380.3988, C18H13FN6OS, Purity:98, SMILES: N#CC1=C(N2CCOCC2)SC(C3=NC=NN3)=C1C4=CC=C(C#N)C=C4F, HPLC, NMR, LCMS is ok, stock more than 10g. |
(5-iodo-2-methylphenyl)(5-phenylthiophen-2-yl)methanone, CAS:, Molecular Weight: 404.265, C18H13IOS, Purity:95, SMILES: O=C(C1=CC(I)=CC=C1C)C2=CC=C(C3=CC=CC=C3)S2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rutaecarpine, CAS:84-26-4, Molecular Weight: 287.3153, C18H13N3O, Purity:98, SMILES: O=C1N2C(C(NC3=C4C=CC=C3)=C4CC2)=NC5=C1C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ro-3306, CAS:872573-93-8, Molecular Weight: 351.4453, C18H13N3OS2, Purity:98, SMILES: O=C1N=C(NCC2=CC=CS2)S/C1=C\C3=CC=C4N=CC=CC4=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
FR 180204, CAS:865362-74-9, Molecular Weight: 327.3427, C18H13N7, Purity:98, SMILES: NC1=NNC2=NN=C(C3=C4C=CC=CN4N=C3C5=CC=CC=C5)C=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
SGX-523, CAS:1022150-57-7, Molecular Weight: 359.4077, C18H13N7S, Purity:98, SMILES: CN1N=CC(C2=NN3C(SC4=CC5=C(N=CC=C5)C=C4)=NN=C3C=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sodium Picosulfate, CAS:10040-45-6, Molecular Weight: 481.4073, C18H13NNa2O8S2, Purity:98, SMILES: O=S(OC1=CC=C(C=C1)C(C2=CC=CC=N2)C3=CC=C(OS(=O)([O-])=O)C=C3)([O-])=O.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
6-(benzyloxyquinoline-2,4-dicarboxylic acid, CAS:250641-16-8, Molecular Weight: 323.2995, C18H13NO5, Purity:95, SMILES: OC(=O)C1=CC(C(O)=O)=C2C=C(OCC3=CC=CC=C3)C=CC2=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(9-Phenyl-9H-carbazol-3-yl)boronic acid, CAS:854952-58-2, Molecular Weight: 287.12, C18H14BNO2, Purity:95, SMILES: OB(O)c1ccc2n(-c3ccccc3)c3ccccc3c2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(9-Carbazolyl)benzeneboronic acid, CAS:864377-33-3, Molecular Weight: 287.12, C18H14BNO2, Purity:95, SMILES: OB(c1cccc(c1)n1c2ccccc2c2c1cccc2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(9-Carbazolyl)benzeneboronic acid, CAS:419536-33-7, Molecular Weight: 287.12, C18H14BNO2, Purity:95, SMILES: OB(c1ccc(cc1)n1c2ccccc2c2c1cccc2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
9-Phenyl-9H-carbazol-3-ylboronic acid, CAS:854952-58-2, Molecular Weight: 287.12, C18H14BNO2, Purity:95, SMILES: OB(O)C1=CC2=C(C=C1)N(C1=CC=CC=C21)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-Bromo-N,N-diphenylaniline, CAS:36809-26-4, Molecular Weight: 324.214, C18H14BrN, Purity:97, SMILES: Brc1ccc(cc1)N(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
UMI-77, CAS:518303-20-3, Molecular Weight: 468.3415, C18H14BrNO5S2, Purity:98, SMILES: O=C(O)CSC1=CC(NS(=O)(C2=CC=C(Br)C=C2)=O)=C3C=CC=CC3=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ipfencarbazone, CAS:212201-70-2, Molecular Weight: 427.2322, C18H14Cl2F2N4O2, Purity:98, SMILES: O=C(N1C=NN(C2=CC=C(Cl)C=C2Cl)C1=O)N(C3=CC=C(F)C=C3F)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
TGR5 Receptor Agonist, CAS:1197300-24-5, Molecular Weight: 361.222, C18H14Cl2N2O2, Purity:98, SMILES: ClC1=CC=CC=C1C2=NOC(C)=C2C(N(C)C3=CC=C(Cl)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ethyl dirazepate, CAS:23980-14-5, Molecular Weight: 377.22136, C18H14Cl2N2O3, Purity:98, SMILES: O=C(C1C(NC2=CC=C(Cl)C=C2C(C3=CC=CC=C3Cl)=N1)=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
MK196, CAS:56049-88-8, Molecular Weight: 365.20736, C18H14Cl2O4, Purity:98, SMILES: O=C(O)COC1=CC2=C(C(C(C3=CC=CC=C3)(C)C2)=O)C(Cl)=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Miconazole, CAS:22916-47-8, Molecular Weight: 416.1286, C18H14Cl4N2O, Purity:98, SMILES: ClC1=C(C=CC(Cl)=C1)C(OCC(C=CC(Cl)=C2)=C2Cl)CN3C=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-(4-((6-Chloro-2-Methylpyrimidin-4-YlAmino-3-Fluorophenyl-3-(4-FluorophenylUrea, CAS:0, Molecular Weight: 389.786, C18H14ClF2N5O, Purity:95, SMILES: CC1=NC(Cl)=CC(NC2=C(F)C=C(NC(=O)NC3=CC=C(F)C=C3)C=C2)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
COX-2-IN-1, CAS:787623-48-7, Molecular Weight: 442.8425696, C18H14ClF3N4O2S, Purity:98, SMILES: O=S(C1=CC=C(N2N=C(C(F)(F)F)CC2C3=CNC4=C3C=CC=C4Cl)C=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4H-1,2,4-Triazole, 3-(2-chloro-4-fluorophenyl)-4-methyl-5-[1-methyl-1-(2,4,6-trifluorophenoxy)ethyl]-, CAS:1203956-47-1, Molecular Weight: 399.7698728, C18H14ClF4N3O, Purity:98, SMILES: CC(C1=NN=C(C2=CC=C(F)C=C2Cl)N1C)(C)OC3=C(F)C=C(F)C=C3F, HPLC, NMR, LCMS is ok, stock more than 10g. |
R1530, CAS:882531-87-5, Molecular Weight: 356.7814, C18H14ClFN4O, Purity:98, SMILES: CC(NN1)=C2C1=NC3=CC(OC)=C(F)C=C3C(C4=CC=CC=C4Cl)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sitaxsentan (sodium), CAS:210421-74-2, Molecular Weight: 476.8863, C18H14ClN2NaO6S2, Purity:98, SMILES: O=S([N-]C1=C(C(C)=NO1)Cl)(C2=C(SC=C2)C(CC3=C(C=C4OCOC4=C3)C)=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
N-(5-chloro-2-methoxyphenyl)-3-hydroxy-2-naphthamide, CAS:137-52-0, Molecular Weight: 327.762, C18H14ClNO3, Purity:95, SMILES: COc1ccc(Cl)cc1NC(=O)c1cc2ccccc2cc1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Toltrazuril, CAS:69004-03-1, Molecular Weight: 425.3817, C18H14F3N3O4S, Purity:98, SMILES: O=C(N(C1=CC=C(OC2=CC=C(SC(F)(F)F)C=C2)C(C)=C1)C(N3)=O)N(C)C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Toltrazuril (sulfone), CAS:69004-04-2, Molecular Weight: 457.3805, C18H14F3N3O6S, Purity:98, SMILES: O=S(C1=CC=C(C=C1)OC2=C(C=C(C=C2)N3C(N(C(NC3=O)=O)C)=O)C)(C(F)(F)F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bicalutamide, CAS:90357-06-5, Molecular Weight: 430.3733728, C18H14F4N2O4S, Purity:98, SMILES: FC1=CC=C(S(=O)(CC(O)(C(NC2=CC=C(C#N)C(C(F)(F)F)=C2)=O)C)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(4-fluorophenyl)-5-(5-iodo-2-methylbenzyl)thiophene, CAS:898566-17-1, Molecular Weight: 408.272, C18H14FIS, Purity:99, SMILES: Cc1ccc(I)cc1Cc1ccc(s1)-c1ccc(F)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
LAS101057, CAS:925676-48-8, Molecular Weight: 335.3351, C18H14FN5O, Purity:98, SMILES: FC1=CN=CC=C1C(N=CC(NC(C2CC2)=O)=N3)=C3C4=CC=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-((3,4-dihydroisoquinolin-1-ylmethylisoindoline-1,3-dione, CAS:88422-83-7, Molecular Weight: 290.316, C18H14N2O2, Purity:95, SMILES: O=C1N(CC2=NCCC3=CC=CC=C23)C(=O)C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-Quinolinecarbonitrile, 1,4-dihydro-6-methoxy-4-oxo-7-(phenylmethoxy)-, CAS:914490-11-2, Molecular Weight: 306.3154, C18H14N2O3, Purity:95, SMILES: COc1cc2c(cc1OCc1ccccc1)[nH]cc(c2=O)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
7-(Benzyloxy)-4-hydroxy-6-methoxyquinoline-3-carbonitrile, CAS:214476-89-8, Molecular Weight: 306.3154, C18H14N2O3, Purity:95, SMILES: COc1cc2c(cc1OCc1ccccc1)ncc(c2O)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dynasore, CAS:304448-55-3, Molecular Weight: 322.3148, C18H14N2O4, Purity:98, SMILES: O=C(C1=C(O)C=C2C=CC=CC2=C1)N/N=C/C3=CC=C(O)C(O)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-((3R,4R-4-Methyl-3-(Methyl(7H-Pyrrolo[2,3-D]Pyrimidin-4-YlAminoPiperidin-1-Yl-3-Oxopropanenitrile, CAS:477600-75-2, Molecular Weight: 354.38, C18H14N2O4S, Purity:95, SMILES: COC1=CC=C(C=C1)C(=O)NC1=NC=C(S1)C1=CC=C(C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
A 77-01, CAS:607737-87-1, Molecular Weight: 286.3306, C18H14N4, Purity:98, SMILES: CC1=CC=CC(C2=NNC=C2C3=CC=NC4=CC=CC=C34)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cysteine Protease inhibitor, CAS:921625-62-9, Molecular Weight: 302.33, C18H14N4O, Purity:98, SMILES: N#CC1=NC(OC2=CC(C3=CC=C(CN)C=C3)=CC=C2)=CC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
TWS119, CAS:601514-19-6, Molecular Weight: 318.3293, C18H14N4O2, Purity:98, SMILES: OC1=CC=CC(OC2=C3C(NC(C4=CC=CC(N)=C4)=C3)=NC=N2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
PF-915275, CAS:857290-04-1, Molecular Weight: 350.3943, C18H14N4O2S, Purity:98, SMILES: N#CC1=CC=C(C2=CC=C(S(NC3=NC(N)=CC=C3)(=O)=O)C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sulfasalazine, CAS:599-79-1, Molecular Weight: 398.3925, C18H14N4O5S, Purity:98, SMILES: OC(C1=C(O)C=CC(/N=N/C2=CC=C(S(=O)(NC3=NC=CC=C3)=O)C=C2)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
SCR7, CAS:1533426-72-0, Molecular Weight: 334.39496, C18H14N4OS, Purity:98, SMILES: O=C(C(/N=C/C1=CC=CC=C1)=C(/N=C/C2=CC=CC=C2)N3)NC3=S.[(E)].[(E)], HPLC, NMR, LCMS is ok, stock more than 10g. |
TG100-115, CAS:677297-51-7, Molecular Weight: 346.3428, C18H14N6O2, Purity:98, SMILES: NC1=C(C(N=C2C3=CC(O)=CC=C3)=NC(N)=N1)N=C2C4=CC(O)=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dihydroisotanshinone I, CAS:20958-18-3, Molecular Weight: 278.302, C18H14O3, Purity:98, SMILES: O=C1C2=C(C3=C(C=C2)C(C)=CC=C3)C(C4=C1C(C)CO4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dihydrotanshinone I, CAS:87205-99-0, Molecular Weight: 278.302, C18H14O3, Purity:98, SMILES: O=C(C1=C2C=CC3=C1C=CC=C3C)C(C4=C2OC[C@@H]4C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(-)-Dibenzoyl-L-tartaric acid, CAS:2743-38-6, Molecular Weight: 358.299, C18H14O8, Purity:97, SMILES: OC(=O)[C@@H]([C@H](C(=O)O)OC(=O)c1ccccc1)OC(=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S,3S)-2,3-Bis(benzoyloxy)succinic acid, CAS:17026-42-5, Molecular Weight: 358.299, C18H14O8, Purity:97, SMILES: OC(=O)C(OC(=O)c1ccccc1)C(OC(=O)c1ccccc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
SMND-309, CAS:1065559-56-9, Molecular Weight: 358.299, C18H14O8, Purity:98, SMILES: OC1=C(C(/C=C/C(O)=O)=CC=C1O)/C(C(O)=O)=C\C2=CC(O)=C(C=C2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
[1,1':3',1''-Terphenyl]-5'-ylboronic acid, CAS:128388-54-5, Molecular Weight: 274.122, C18H15BO2, Purity:95, SMILES: OB(c1cc(cc(c1)c1ccccc1)c1ccccc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nelotanserin, CAS:839713-36-9, Molecular Weight: 437.2381, C18H15BrF2N4O2, Purity:98, SMILES: COC1=C(C2=C(Br)C=NN2C)C=C(NC(NC3=C(F)C=C(F)C=C3)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,4-Bis(benzyloxy)-5-bromopyrimidine, CAS:41244-53-5, Molecular Weight: 371.228, C18H15BrN2O2, Purity:97, SMILES: Brc1cnc(nc1OCc1ccccc1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(Benzyloxy)-1-bromo-6-methoxynaphthalene, CAS:648904-47-6, Molecular Weight: 343.215, C18H15BrO2, Purity:95, SMILES: COc1ccc2c(c1)ccc(c2Br)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Econazole, CAS:27220-47-9, Molecular Weight: 381.6835, C18H15Cl3N2O, Purity:98, SMILES: ClC1=CC=C(C(OCC2=CC=C(Cl)C=C2)CN3C=CN=C3)C(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Isoconazole (nitrate), CAS:24168-96-5, Molecular Weight: 479.1414, C18H15Cl4N3O4, Purity:98, SMILES: ClC1=C(COC(C2=CC=C(Cl)C=C2Cl)CN3C=CN=C3)C(Cl)=CC=C1.O[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Miconazole (nitrate), CAS:22832-87-7, Molecular Weight: 479.1414, C18H15Cl4N3O4, Purity:98, SMILES: [O-][N+](O)=O.ClC1=C(C=CC(Cl)=C1)C(OCC(C=CC(Cl)=C2)=C2Cl)CN3C=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sal003, CAS:1164470-53-4, Molecular Weight: 463.2082, C18H15Cl4N3OS, Purity:98, SMILES: O=C(NC(NC(NC1=CC=C(Cl)C=C1)=S)C(Cl)(Cl)Cl)/C=C/C2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Etoricoxib, CAS:202409-33-4, Molecular Weight: 358.8419, C18H15ClN2O2S, Purity:98, SMILES: O=S(C1=CC=C(C2=CC(Cl)=CN=C2C3=CC=C(C)N=C3)C=C1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
sitaxsentan, CAS:184036-34-8, Molecular Weight: 454.9045, C18H15ClN2O6S2, Purity:98, SMILES: O=S(C1=C(C(CC2=CC3=C(C=C2C)OCO3)=O)SC=C1)(NC4=C(C(C)=NO4)Cl)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cysteine Protease inhibitor (hydrochloride), CAS:, Molecular Weight: 338.7909, C18H15ClN4O, Purity:98, SMILES: N#CC1=NC(OC2=CC(C3=CC=C(CN)C=C3)=CC=C2)=CC=N1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
5-(2,6-dimethoxyphenyl-1-(4-fluorophenyl-1H-pyrazole-3-carboxylic acid, CAS:0, Molecular Weight: 342.3211, C18H15FN2O4, Purity:95, SMILES: COC1=CC=CC(OC)=C1C1=CC(=NN1C1=CC=C(F)C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
SSR128129E, CAS:848318-25-2, Molecular Weight: 346.3125, C18H15N2NaO4, Purity:98, SMILES: O=C([O-])C1=CC(C(C2=C(C)C(OC)=C3C=CC=CN23)=O)=CC=C1N.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Cresyl Violet acetate, CAS:10510-54-0, Molecular Weight: 321.33, C18H15N3O3, Purity:98, SMILES: NC1=CC2=[O+]C3=C(C4=CC=CC=C4C(N)=C3)N=C2C=C1.CC([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
E7449, CAS:1140964-99-3, Molecular Weight: 317.3446, C18H15N5O, Purity:98, SMILES: O=C1NNC2=C3C1=CC=CC3=NC(CN4CC5=C(C=CC=C5)C4)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Necrosulfonamide, CAS:1360614-48-7, Molecular Weight: 461.4716, C18H15N5O6S2, Purity:98, SMILES: O=C(NC1=CC=C(S(=O)(NC2=NC=CN=C2OC)=O)C=C1)/C=C/C3=CC=C([N+]([O-])=O)S3, HPLC, NMR, LCMS is ok, stock more than 10g. |
SCH 58261, CAS:160098-96-4, Molecular Weight: 345.358, C18H15N7O, Purity:98, SMILES: NC1=NC(N(CCC2=CC=CC=C2)N=C3)=C3C4=NC(C5=CC=CO5)=NN14, HPLC, NMR, LCMS is ok, stock more than 10g. |
7ACC2, CAS:1472624-85-3, Molecular Weight: 309.316, C18H15NO4, Purity:98, SMILES: CN(C1=CC=C(C=C(C(O)=O)C(O2)=O)C2=C1)CC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Aminaftone, CAS:14748-94-8, Molecular Weight: 309.316, C18H15NO4, Purity:98, SMILES: OC1=C2C=CC=CC2=C(O)C(C)=C1OC(C3=CC=C(N)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
BQCA, CAS:338747-41-4, Molecular Weight: 309.316, C18H15NO4, Purity:98, SMILES: O=C(C1=CN(CC2=CC=C(OC)C=C2)C3=C(C=CC=C3)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(Diphenylamino)benzeneboronic acid, CAS:201802-67-7, Molecular Weight: 289.136, C18H16BNO2, Purity:95, SMILES: OB(c1ccc(cc1)N(c1ccccc1)c1ccccc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl 2-(5-bromo-4-(4-cyclopropylnaphthalen-1-yl)-4h-1,2,4-triazol-3-ylthio)acetate, CAS:878671-99-9, Molecular Weight: 418.308, C18H16BrN3O2S, Purity:95, SMILES: COC(=O)CSc1nnc(n1c1ccc(c2c1cccc2)C1CC1)Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
MTT, CAS:298-93-1, Molecular Weight: 414.3221, C18H16BrN5S, Purity:98, SMILES: CC1=C(C)N=C(N2N=C(C3=CC=CC=C3)N=[N+]2C4=CC=CC=C4)S1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK2141795, CAS:1047634-65-0, Molecular Weight: 429.248, C18H16Cl2F2N4O2, Purity:98, SMILES: O=C(C1=CC(C2=C(Cl)C=NN2C)=C(Cl)O1)N[C@@H](CC3=CC=C(F)C(F)=C3)CN, HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK2110183, CAS:1047634-63-8, Molecular Weight: 445.3137, C18H16Cl2F2N4OS, Purity:98, SMILES: O=C(C1=CC(C2=C(Cl)C=NN2C)=C(Cl)S1)N[C@@H](CC3=CC=C(F)C(F)=C3)CN, HPLC, NMR, LCMS is ok, stock more than 10g. |
A-196, CAS:, Molecular Weight: 359.2524, C18H16Cl2N4, Purity:98, SMILES: ClC1=C(Cl)C=C(C(C2=CC=NC=C2)=NN=C3NC4CCCC4)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
SCD inhibitor 1, CAS:1150701-66-8, Molecular Weight: 391.2513, C18H16Cl2N4O2, Purity:98, SMILES: ClC(C=CC(CN1N=NC(C(NC2=CC=C(CO)C=C2)=O)=C1C)=C3)=C3Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sulconazole (nitrate), CAS:82382-23-8, Molecular Weight: 460.76194, C18H16Cl3N3O3S, Purity:98, SMILES: [O-][N+](O)=O.ClC1=CC=C(C(SCC2=CC=C(Cl)C=C2)CN3C=CN=C3)C(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Econazole (nitrate), CAS:24169-02-6, Molecular Weight: 444.69634, C18H16Cl3N3O4, Purity:98, SMILES: [O-][N+](O)=O.ClC1=C(C=CC(Cl)=C1)C(OCC2=CC=C(Cl)C=C2)CN3C=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl 3-Chloro-4-Cyano-6,7-Dihydro-5H-Pyrido[3,4-C]Azepine-8(9H-Carboxylate, CAS:1341039-99-3, Molecular Weight: 341.792, C18H16ClN3O2, Purity:95, SMILES: ClC1=C(C#N)C2=C(CN(CCC2)C(=O)OCC2=CC=CC=C2)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
PQ401, CAS:196868-63-0, Molecular Weight: 341.7915, C18H16ClN3O2, Purity:98, SMILES: O=C(NC1=CC(C)=NC2=CC=CC=C12)NC3=C(OC)C=CC(Cl)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fenoxaprop-P-ethyl, CAS:71283-80-2, Molecular Weight: 361.7763, C18H16ClNO5, Purity:98, SMILES: C[C@@H](OC1=CC=C(OC2=NC3=CC=C(Cl)C=C3O2)C=C1)C(OCC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Alimemazine D6, CAS:1346603-88-0, Molecular Weight: 304.4826, C18H16D6N2S, Purity:98, SMILES: CC(CN(C([2H])([2H])[2H])C([2H])([2H])[2H])CN1C2=CC=CC=C2SC3=CC=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl 1-(4-Ethoxy-2,6-Difluorobenzyl-1H-Indazole-3-Carboxylate, CAS:1628723-71-6, Molecular Weight: 346.328, C18H16F2N2O3, Purity:95, SMILES: CCOC1=CC(F)=C(CN2N=C(C(=O)OC)C3=CC=CC=C23)C(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
LY2886721, CAS:1262036-50-9, Molecular Weight: 390.407, C18H16F2N4O2S, Purity:98, SMILES: FC1=CN=C(C=C1)C(NC2=CC=C(C([C@@]34[C@]([H])(CSC(N)=N4)COC3)=C2)F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
AZ960, CAS:905586-69-8, Molecular Weight: 354.3566464, C18H16F2N6, Purity:98, SMILES: N#CC1=CC(F)=C(NC2=NNC(C)=C2)N=C1N[C@H](C3=CC=C(F)C=C3)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pyridone 6, CAS:457081-03-7, Molecular Weight: 309.3376, C18H16FN3O, Purity:98, SMILES: FC1=CC2=C(C(NC=C3)=O)C3=C(N=C(C(C)(C)C)N4)C4=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
DBCO-amine, CAS:1255942-06-3, Molecular Weight: 276.3324, C18H16N2O, Purity:95, SMILES: NCCC(=O)N1Cc2ccccc2C#Cc2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
SC66, CAS:871361-88-5, Molecular Weight: 276.3324, C18H16N2O, Purity:98, SMILES: O=C1/C(CCC/C1=C\C2=CC=NC=C2)=C/C3=CC=NC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
(-)-Blebbistatin, CAS:856925-71-8, Molecular Weight: 292.3318, C18H16N2O2, Purity:98, SMILES: CC1=CC=C(N=C(N(C2=CC=CC=C2)CC3)[C@]3(O)C4=O)C4=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Roquinimex, CAS:84088-42-6, Molecular Weight: 308.3312, C18H16N2O3, Purity:98, SMILES: O=C(C1=C(O)C2=C(N(C)C1=O)C=CC=C2)N(C)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
SSR128129E (free acid), CAS:848463-13-8, Molecular Weight: 324.3306, C18H16N2O4, Purity:98, SMILES: COC1=C2N(C(C(C3=CC=C(N)C(C(O)=O)=C3)=O)=C1C)C=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
FPL59360, CAS:85118-44-1, Molecular Weight: 356.32944, C18H16N2O6, Purity:98, SMILES: O=C(C(O1)=CC(C2=C1C(CCC)=C3N=C(C(O)=O)C=C(NC)C3=C2)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
INH1, CAS:313553-47-8, Molecular Weight: 308.3974, C18H16N2OS, Purity:98, SMILES: O=C(NC1=NC(C2=CC=C(C)C=C2C)=CS1)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Chitinase-IN-1, CAS:1579991-61-9, Molecular Weight: 352.4102, C18H16N4O2S, Purity:98, SMILES: O=C(C1=CC=CC2=C1C3=CC=C2)N(CCNCC4=NN=C(C)S4)C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
VE-821, CAS:1232410-49-9, Molecular Weight: 368.4096, C18H16N4O3S, Purity:98, SMILES: O=C(NC1=CC=CC=C1)C2=NC(C3=CC=C(C=C3)S(=O)(C)=O)=CN=C2N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefonicid (sodium), CAS:61270-78-8, Molecular Weight: 586.5296, C18H16N6Na2O8S3, Purity:98, SMILES: O=C(C(N12)=C(CSC3=NN=NN3CS(=O)([O-])=O)CS[C@]2([H])[C@H](NC([C@H](O)C4=CC=CC=C4)=O)C1=O)[O-].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Ceftriaxone (sodium salt), CAS:74578-69-1, Molecular Weight: 598.5436, C18H16N8Na2O7S3, Purity:98, SMILES: [O-]C1=NN(C)C(SCC(CS[C@]2([H])[C@@H]3NC(/C(C4=CSC(N)=N4)=N\OC)=O)=C(C([O-])=O)N2C3=O)=NC1=O.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Ceftriaxone (sodium hydrate), CAS:104376-79-6, Molecular Weight: 661.6, C18H16N8Na2O7S3 . 3.5H2O, Purity:98, SMILES: [O-]C(C(N12)=C(CSC(N(C)N=C3[O-])=NC3=O)CS[C@]2([H])[C@H](NC(/C(C4=CSC(N)=N4)=N\OC)=O)C1=O)=O.[Na+].[Na+].[3.5H2O], HPLC, NMR, LCMS is ok, stock more than 10g. |
Tranilast (Sodium), CAS:104931-56-8, Molecular Weight: 349.3131, C18H16NNaO5, Purity:98, SMILES: O=C([O-])C1=CC=CC=C1NC(/C=C/C2=CC=C(OC)C(OC)=C2)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
MN-64, CAS:92831-11-3, Molecular Weight: 264.3185, C18H16O2, Purity:98, SMILES: O=C1C=C(C2=CC=C(C(C)C)C=C2)OC3=CC=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ipriflavone, CAS:35212-22-7, Molecular Weight: 280.3178, C18H16O3, Purity:98, SMILES: O=C1C(C2=CC=CC=C2)=COC3=CC(OC(C)C)=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
SYP-5, CAS:1384268-04-5, Molecular Weight: 312.3828, C18H16O3S, Purity:98, SMILES: O=C(C1=C(O)C(C=CC(C)(C)O2)=C2C=C1)/C=C/C3=CC=CS3, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(3,4-Dimethoxyphenyl)-3-hydroxy-8-methyl-4H-chromen-4-one, CAS:1313738-73-6, Molecular Weight: 312.3166, C18H16O5, Purity:95, SMILES: COc1cc(ccc1OC)c1oc2c(C)cccc2c(=O)c1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Eupatilin, CAS:22368-21-4, Molecular Weight: 344.3154, C18H16O7, Purity:98, SMILES: O=C1C=C(C2=CC=C(OC)C(OC)=C2)OC3=CC(O)=C(OC)C(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rosmarinic acid, CAS:20283-92-5, Molecular Weight: 360.3148, C18H16O8, Purity:98, SMILES: OC([C@H](OC(/C=C/C1=CC(O)=C(O)C=C1)=O)CC2=CC(O)=C(O)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rosmarinic acid (racemate), CAS:537-15-5, Molecular Weight: 360.31484, C18H16O8, Purity:98, SMILES: O=C(O)C(OC(/C=C/C1=CC=C(O)C(O)=C1)=O)CC2=CC=C(O)C(O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
9-(4-bromobutyl)-9H-fluorene-9-carboxylic acid, CAS:182438-97-7, Molecular Weight: 345.23, C18H17BrO2, Purity:95, SMILES: BrCCCCC1(C(=O)O)c2ccccc2c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
GW842166X, CAS:666260-75-9, Molecular Weight: 449.2544, C18H17Cl2F3N4O2, Purity:98, SMILES: ClC1=CC(Cl)=C(NC2=NC=C(C(NCC3CCOCC3)=O)C(C(F)(F)F)=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Afuresertib, CAS:1047644-62-1, Molecular Weight: 427.3232, C18H17Cl2FN4OS, Purity:98, SMILES: O=C(C1=CC(C2=C(Cl)C=NN2C)=C(Cl)S1)N[C@@H](CC3=CC=CC(F)=C3)CN, HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK2141795 (hydrochloride), CAS:1047635-80-2, Molecular Weight: 465.709, C18H17Cl3F2N4O2, Purity:98, SMILES: O=C(C1=CC(C2=C(Cl)C=NN2C)=C(Cl)O1)N[C@@H](CC3=CC=C(F)C(F)=C3)CN.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK2110183 (hydrochloride), CAS:, Molecular Weight: 481.7746, C18H17Cl3F2N4OS, Purity:98, SMILES: O=C(C1=CC(C2=C(Cl)C=NN2C)=C(Cl)S1)N[C@@H](CC3=CC=C(F)C(F)=C3)CN.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
JNJ-42165279, CAS:1346528-50-4, Molecular Weight: 410.8024, C18H17ClF2N4O3, Purity:98, SMILES: O=C(N1CCN(CC2=CC=C(OC(F)(F)O3)C3=C2)CC1)NC4=C(Cl)C=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
ML348, CAS:899713-86-1, Molecular Weight: 415.7941, C18H17ClF3N3O3, Purity:98, SMILES: O=C(NC1=CC(C(F)(F)F)=CC=C1Cl)CN2CCN(C(C3=CC=CO3)=O)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
KY02111, CAS:1118807-13-8, Molecular Weight: 376.8572, C18H17ClN2O3S, Purity:98, SMILES: O=C(NC1=NC2=CC=C(Cl)C=C2S1)CCC3=CC=C(OC)C(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
MSC2530818, CAS:1883423-59-3, Molecular Weight: 340.80678, C18H17ClN4O, Purity:98, SMILES: O=C(N1[C@H](C2=CC=C(Cl)C=C2)CCC1)C3=CN=C(NN=C4C)C4=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
7-CHLORO-5-METHYL-2-(2-(1-METHYL-1H-BENZO[D]IMIDAZOL-2-YL)ETHYL)-2,3-DIHYDRO-1H-PYRROLO[3,4-C]PYRIDINE-1,6(5H)-DIONE, CAS:1628618-37-0, Molecular Weight: 356.806, C18H17ClN4O2, Purity:95, SMILES: Cn1c(CCN2Cc3cn(C)c(=O)c(Cl)c3C2=O)nc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Enalaprilat D5 (Sodium Salt), CAS:1356922-29-6, Molecular Weight: 397.388, C18H17D5N2Na2O5, Purity:98, SMILES: C[C@@H](C(N1CCC[C@H]1C([O-])=O)=O)N[C@H](C([O-])=O)CCC2=C([2H])C([2H])=C([2H])C([2H])=C2[2H].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
BMS-265246, CAS:582315-72-8, Molecular Weight: 345.3433, C18H17F2N3O2, Purity:98, SMILES: CC1=CC(F)=C(C(C2=CN=C(NN=C3)C3=C2OCCCC)=O)C(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
TH-237A, CAS:935467-97-3, Molecular Weight: 333.3293, C18H17F2NO3, Purity:98, SMILES: OCC12N([C@H](C3=CC=C(F)C=C3)OC2)[C@@H](C4=CC=C(F)C=C4)OC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
J-147, CAS:1146963-51-0, Molecular Weight: 350.335, C18H17F3N2O2, Purity:98, SMILES: O=C(N(C1=CC=C(C)C=C1C)/N=C/C2=CC=CC(OC)=C2)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
XEN445, CAS:1515856-92-4, Molecular Weight: 366.3344, C18H17F3N2O3, Purity:98, SMILES: O=C(O)C1=CC(C(F)(F)F)=CC=C1N2C[C@@H](OCC3=NC=CC=C3)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
VT-464, CAS:1610537-15-9, Molecular Weight: 399.3395, C18H17F4N3O3, Purity:98, SMILES: FC(F)OC1=C(OC(F)F)C=C(C=CC([C@](C2=CNN=N2)(C(C)C)O)=C3)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
VT-464 (R enantiomer), CAS:1375603-38-5, Molecular Weight: 399.3395, C18H17F4N3O3, Purity:98, SMILES: FC(F)OC1=C(OC(F)F)C=C(C=CC([C@@](C2=CNN=N2)(C(C)C)O)=C3)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
VT-464 (racemate), CAS:1375603-36-3, Molecular Weight: 399.3395, C18H17F4N3O3, Purity:98, SMILES: FC(F)OC1=C(OC(F)F)C=C(C=CC(C(C2=CNN=N2)(C(C)C)O)=C3)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
A-966492, CAS:934162-61-5, Molecular Weight: 324.3521832, C18H17FN4O, Purity:98, SMILES: FC1=CC([C@H]2NCCC2)=CC=C1C3=NC4=C(C(N)=O)C=CC=C4N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
SC57666, CAS:158959-32-1, Molecular Weight: 316.3897832, C18H17FO2S, Purity:98, SMILES: O=S(C1=CC=C(C2=C(C3=CC=C(F)C=C3)CCC2)C=C1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
FR252384, CAS:447405-11-0, Molecular Weight: 275.34768, C18H17N3, Purity:98, SMILES: CC1=CC=C(CCC2)C(C3=C2N=C(C4=CC=CN=C4)N3)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Orteronel, CAS:566939-85-3, Molecular Weight: 307.3465, C18H17N3O2, Purity:98, SMILES: O=C(C1=CC=C2C=C([C@@]3(O)CCN4C=NC=C43)C=CC2=C1)NC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ru-32514, CAS:90807-98-0, Molecular Weight: 307.3465, C18H17N3O2, Purity:98, SMILES: O=C(C1=CC=CC=C1)C2=CN3C(N=C(OC)C4=C3CCCC4)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
(E-3-(dimethylamino-1-(1-(phenylsulfonyl-1H-pyrrolo[2,3-c]pyridin-3-ylprop-2-en-1-one, CAS:1679330-18-7, Molecular Weight: 355.411, C18H17N3O3S, Purity:95, SMILES: CN(C)\C=C\C(=O)C1=CN(C2=CN=CC=C12)S(=O)(=O)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ABT-751, CAS:141430-65-1, Molecular Weight: 371.4103, C18H17N3O4S, Purity:98, SMILES: COC1=CC=C(C=C1)S(=O)(NC2=C(N=CC=C2)NC3=CC=C(C=C3)O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Lck inhibitor 2, CAS:944795-06-6, Molecular Weight: 335.3599, C18H17N5O2, Purity:98, SMILES: OC1=CC=C(C)C(NC2=CC=NC(NC3=CC(C(N)=O)=CC=C3)=N2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
PIK-90, CAS:677338-12-4, Molecular Weight: 351.3593, C18H17N5O3, Purity:98, SMILES: O=C(NC1=NC2=C(C3=NCCN13)C=CC(OC)=C2OC)C4=CC=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
MS436, CAS:1395084-25-9, Molecular Weight: 383.4243, C18H17N5O3S, Purity:98, SMILES: O=S(C1=CC=C(/N=N/C2=CC(C)=C(O)C=C2N)C=C1)(NC3=NC=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefamandole (sodium), CAS:30034-03-8, Molecular Weight: 484.4846, C18H17N6NaO5S2, Purity:98, SMILES: O=C(C(N12)=C(CSC3=NN=NN3C)CS[C@]2([H])[C@H](NC([C@H](O)C4=CC=CC=C4)=O)C1=O)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
5,6,7-trimethoxy-2-phenylquinolin-4(1H)-one, CAS:159188-35-9, Molecular Weight: 311.3319, C18H17NO4, Purity:95, SMILES: COc1cc2[nH]c(cc(=O)c2c(c1OC)OC)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fmoc-Ala-OH, CAS:35661-39-3, Molecular Weight: 311.3319, C18H17NO4, Purity:98, SMILES: C[C@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
IC261, CAS:186611-52-9, Molecular Weight: 311.3319, C18H17NO4, Purity:98, SMILES: O=C1NC2=C(C=CC=C2)/C1=C\C3=C(OC)C=C(OC)C=C3OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Z-(3S)-1,2,3,4-tetrahydroisoquinolene-3-carboxylic acid, CAS:79261-58-8, Molecular Weight: 311.3319, C18H17NO4, Purity:97, SMILES: OC(=O)[C@@H]1Cc2ccccc2CN1C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
NOD-IN-1, CAS:132819-92-2, Molecular Weight: 343.3969, C18H17NO4S, Purity:98, SMILES: O=S(N1C(C(OCC)=O)=CC2=CC=CC=C21)(C3=CC=C(C)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-3-hydroxypropanoic acid, CAS:73724-45-5, Molecular Weight: 327.3313, C18H17NO5, Purity:95, SMILES: OC[C@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(3,4-Dimethoxyphenyl)-3-hydroxy-7-methoxyquinolin-4(1H)-one, CAS:1313738-75-8, Molecular Weight: 327.3313, C18H17NO5, Purity:95, SMILES: COc1ccc2c(c1)[nH]c(c(c2=O)O)c1ccc(c(c1)OC)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tranilast, CAS:53902-12-8, Molecular Weight: 327.3313, C18H17NO5, Purity:98, SMILES: O=C(O)C1=CC=CC=C1NC(/C=C/C2=CC=C(OC)C(OC)=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tranilast (trans-), CAS:70806-55-2, Molecular Weight: 327.33128, C18H17NO5, Purity:98, SMILES: O=C(O)C1=CC=CC=C1NC(/C=C/C2=CC(OC)=C(OC)C=C2)=O.[(E)], HPLC, NMR, LCMS is ok, stock more than 10g. |
IFN alpha-IFNAR-IN-1, CAS:844882-93-5, Molecular Weight: 279.3993, C18H17NS, Purity:98, SMILES: CNCC1=CC=CC=C1SC2=C(C=CC=C3)C3=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
4,4'-diallyl-1,1'-biphenyl, CAS:405201-68-5, Molecular Weight: 234.3355, C18H18, Purity:95, SMILES: C=CCc1ccc(cc1)-c1ccc(CC=C)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4'-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-[1,1'-biphenyl]-4-carbonitrile, CAS:175691-85-7, Molecular Weight: 291.152, C18H18BNO2, Purity:95, SMILES: CC1(C)OCB(CO1)c1ccc(cc1)-c1ccc(cc1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
AT7519 (trifluoroacetate), CAS:1431697-85-6, Molecular Weight: 496.2678, C18H18Cl2F3N5O4, Purity:98, SMILES: O=C(NC1=CNN=C1C(NC2CCNCC2)=O)C3=C(Cl)C=CC=C3Cl.O=C(O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Afuresertib (hydrochloride), CAS:1047645-82-8, Molecular Weight: 463.7841, C18H18Cl3FN4OS, Purity:98, SMILES: O=C(C1=CC(C2=C(Cl)C=NN2C)=C(Cl)S1)N[C@@H](CC3=CC=CC(F)=C3)CN.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cevipabulin, CAS:849550-05-6, Molecular Weight: 464.820136, C18H18ClF5N6O, Purity:98, SMILES: C[C@@]([H])(C(F)(F)F)NC1=C(C2=C(F)C=C(OCCCNC)C=C2F)C(Cl)=NC3=NC=NN13, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-Cl-IB-MECA, CAS:163042-96-4, Molecular Weight: 544.7308, C18H18ClIN6O4, Purity:98, SMILES: O[C@H]([C@@H]1O)[C@@H](O[C@@H]1C(NC)=O)N2C3=NC(Cl)=NC(NCC4=CC(I)=CC=C4)=C3N=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Loxapine, CAS:1977-10-2, Molecular Weight: 327.808, C18H18ClN3O, Purity:98, SMILES: CN1CCN(C2=NC3=CC=CC=C3OC4=CC=C(Cl)C=C24)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
CGP60474, CAS:164658-13-3, Molecular Weight: 355.8214, C18H18ClN5O, Purity:98, SMILES: ClC1=CC(NC2=NC=CC(C3=CC=NC(NCCCO)=C3)=N2)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Chlorprothixene, CAS:113-59-7, Molecular Weight: 315.8602, C18H18ClNS, Purity:98, SMILES: CN(C)CC/C=C1C2=C(SC3=C\1C=CC=C3)C=CC(Cl)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
IFN alpha-IFNAR-IN-1 (hydrochloride), CAS:, Molecular Weight: 315.8602, C18H18ClNS, Purity:98, SMILES: CNCC1=CC=CC=C1SC2=C(C=CC=C3)C3=CC=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Oxycodone D3, CAS:145225-02-1, Molecular Weight: 318.3821, C18H18D3NO4, Purity:98, SMILES: O[C@@]12[C@]3([C@@H](O4)C(CC2)=O)C5=C4C(OC)=CC=C5C[C@H]1N(C([2H])([2H])[2H])CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
EMD638683, CAS:1181770-72-8, Molecular Weight: 364.3433, C18H18F2N2O4, Purity:98, SMILES: CC1=C(CC)C(C(NNC(C(O)C2=CC(F)=CC(F)=C2)=O)=O)=CC=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
EMD638683 (R-Form), CAS:1184940-47-3, Molecular Weight: 364.3433, C18H18F2N2O4, Purity:98, SMILES: CC1=C(CC)C(C(NNC([C@H](O)C2=CC(F)=CC(F)=C2)=O)=O)=CC=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
EMD638683 (S-Form), CAS:1184940-46-2, Molecular Weight: 364.3433, C18H18F2N2O4, Purity:98, SMILES: CC1=C(CC)C(C(NNC([C@@H](O)C2=CC(F)=CC(F)=C2)=O)=O)=CC=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
SRPIN340, CAS:218156-96-8, Molecular Weight: 349.3502, C18H18F3N3O, Purity:98, SMILES: O=C(NC1=CC(C(F)(F)F)=CC=C1N2CCCCC2)C3=CC=NC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pleconaril, CAS:153168-05-9, Molecular Weight: 381.349, C18H18F3N3O3, Purity:98, SMILES: FC(C1=NC(C2=CC(C)=C(OCCCC3=CC(C)=NO3)C(C)=C2)=NO1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ufenamate, CAS:67330-25-0, Molecular Weight: 337.3362, C18H18F3NO2, Purity:98, SMILES: O=C(OCCCC)C1=CC=CC=C1NC2=CC=CC(C(F)(F)F)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Etofenamate, CAS:30544-47-9, Molecular Weight: 369.335, C18H18F3NO4, Purity:98, SMILES: O=C(OCCOCCO)C1=CC=CC=C1NC2=CC=CC(C(F)(F)F)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
THK5351, CAS:1707147-26-9, Molecular Weight: 327.3528232, C18H18FN3O2, Purity:98, SMILES: O[C@@H](COC1=CC=C2N=C(C3=CC=C(NC)N=C3)C=CC2=C1)CF, HPLC, NMR, LCMS is ok, stock more than 10g. |
THK5351 (R enantiomer), CAS:, Molecular Weight: 327.3528232, C18H18FN3O2, Purity:98, SMILES: CNC1=NC=C(C2=NC3=CC=C(OC[C@H](CF)O)C=C3C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
TPX-0005, CAS:1802220-02-5, Molecular Weight: 355.3662232, C18H18FN5O2, Purity:98, SMILES: O=C1NC[C@H](C)OC2=CC=C(F)C=C2[C@@H](C)NC3=NC4=C1C=NN4C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
BAY-1143572, CAS:1414943-88-6, Molecular Weight: 387.4312, C18H18FN5O2S, Purity:98, SMILES: N=S(CC1=CC(NC2=NC(C3=CC=C(F)C=C3OC)=NC=N2)=CC=C1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
FITM, CAS:932737-65-0, Molecular Weight: 371.4318232, C18H18FN5OS, Purity:98, SMILES: O=C(N(C)C1=NC(C2=NC=NC(NC(C)C)=C2)=CS1)C3=CC=C(F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
9-(Benzyloxy)-3-(2-hydroxyethyl)-2-methyl-4H-pyrido[1,2-a]pyrimidin-4-one, CAS:1008796-22-2, Molecular Weight: 310.3471, C18H18N2O3, Purity:93, SMILES: OCCc1c(C)nc2n(c1=O)cccc2OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
SU5408, CAS:15966-93-5, Molecular Weight: 310.34712, C18H18N2O3, Purity:98, SMILES: O=C(C1=C(C)NC(/C=C2C(NC3=C\2C=CC=C3)=O)=C1C)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
TSU-68, CAS:252916-29-3, Molecular Weight: 310.3471, C18H18N2O3, Purity:98, SMILES: CC1=C(/C=C2C3=CC=CC=C3NC/2=O)NC(C)=C1CCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Scriptaid, CAS:287383-59-9, Molecular Weight: 326.3465, C18H18N2O4, Purity:98, SMILES: O=C(NO)CCCCCN(C(C1=CC=CC2=CC=CC3=C12)=O)C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fatostatin A, CAS:125256-00-0, Molecular Weight: 294.4139, C18H18N2S, Purity:98, SMILES: CCCC1=NC=CC(C2=NC(C3=CC=C(C)C=C3)=CS2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tris(4-aminophenyl)amine, CAS:1490808, Molecular Weight: 290.3623, C18H18N4, Purity:95, SMILES: Nc1ccc(cc1)N(c1ccc(cc1)N)c1ccc(cc1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
WZ811, CAS:55778-02-4, Molecular Weight: 290.3623, C18H18N4, Purity:98, SMILES: C1(CNC2=NC=CC=C2)=CC=C(CNC3=NC=CC=C3)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
LDC000067, CAS:1073485-20-7, Molecular Weight: 370.4255, C18H18N4O3S, Purity:98, SMILES: O=S(CC1=CC=CC(NC2=NC=NC(C3=CC=CC=C3OC)=C2)=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
BAY 57-1293, CAS:348086-71-5, Molecular Weight: 402.4905, C18H18N4O3S2, Purity:98, SMILES: O=C(N(C1=NC(C)=C(S(=O)(N)=O)S1)C)CC2=CC=C(C3=NC=CC=C3)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Collagen proline hydroxylase inhibitor, CAS:223666-07-7, Molecular Weight: 354.3599, C18H18N4O4, Purity:98, SMILES: O=C1C([N+]([O-])=O)=CNC2=C1C=CC3=C2N=CC(C(N(CC)CCC)=O)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefamandole, CAS:34444-01-4, Molecular Weight: 462.5027, C18H18N6O5S2, Purity:98, SMILES: O=C(C(N12)=C(CSC3=NN=NN3C)CS[C@]2([H])[C@H](NC([C@H](O)C4=CC=CC=C4)=O)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ceftriaxone, CAS:73384-59-5, Molecular Weight: 554.5799, C18H18N8O7S3, Purity:98, SMILES: O=C(C(N12)=C(CSC(N(C)NC3=O)=NC3=O)CS[C@]2([H])[C@H](NC(/C(C4=CSC(N)=N4)=N\OC)=O)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4,4'-bis(oxiran-2-ylmethyl)-1,1'-biphenyl, CAS:81591-83-5, Molecular Weight: 266.3343, C18H18O2, Purity:95, SMILES: C(C1CO1)c1ccc(cc1)-c1ccc(CC2CO2)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dienestrol, CAS:84-17-3, Molecular Weight: 266.3343, C18H18O2, Purity:98, SMILES: C/C=C(C1=CC=C(O)C=C1)/C(C2=CC=C(O)C=C2)=C/C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Honokiol, CAS:35354-74-6, Molecular Weight: 266.3343, C18H18O2, Purity:98, SMILES: OC1=C(CC=C)C=C(C2=CC(CC=C)=CC=C2O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Magnolol, CAS:528-43-8, Molecular Weight: 266.3343, C18H18O2, Purity:98, SMILES: OC1=CC=C(CC=C)C=C1C2=CC(CC=C)=CC=C2O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(E)-PHENETHYL 3-(3-HYDROXY-4-METHOXYPHENYL)ACRYLATE, CAS:117292-80-5, Molecular Weight: 298.3331, C18H18O4, Purity:95, SMILES: COC1=C(O)C=C(\C=C\C(=O)OCCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(3,4-Dimethoxyphenyl)-1-(2-hydroxy-3-methylphenyl)prop-2-en-1-one, CAS:1313738-74-7, Molecular Weight: 298.3331, C18H18O4, Purity:95, SMILES: COc1cc(/C=C/C(=O)c2cccc(c2O)C)ccc1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2R,3R-dibenzyl 2,3-dihydroxysuccinate, CAS:622-00-4, Molecular Weight: 330.3319, C18H18O6, Purity:95, SMILES: O[C@H]([C@@H](O)C(=O)OCC1=CC=CC=C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S,3S-dibenzyl 2,3-dihydroxysuccinate, CAS:4136-22-5, Molecular Weight: 330.3319, C18H18O6, Purity:95, SMILES: O[C@@H]([C@H](O)C(=O)OCC1=CC=CC=C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(3S-2-(4-bromo-2-fluorobenzyl-3-methyl-6-phenyl-1,2-thiazinane 1,1-dioxide, CAS:1642303-04-5, Molecular Weight: 412.316, C18H19BrFNO2S, Purity:95, SMILES: C[C@H]1CCC(C2=CC=CC=C2)S(=O)(=O)N1CC1=C(F)C=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-2,2-diphenyl-2-(pyrrolidin-3-yl)acetonitrile hydrobromide, CAS:194602-27-2, Molecular Weight: 343.261, C18H19BrN2, Purity:95, SMILES: N#CC(C1=CC=CC=C1)(C2=CC=CC=C2)[C@H]3CNCC3.[H]Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4'-(bromomethyl)-[1,1'-biphenyl]-2-carboxylate, CAS:114772-40-6, Molecular Weight: 347.246, C18H19BrO2, Purity:95, SMILES: CC(C)(C)OC(=O)c1ccccc1-c1ccc(CBr)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
TY-52156, CAS:934369-14-9, Molecular Weight: 364.269, C18H19Cl2N3O, Purity:98, SMILES: ClC1=CC=C(/N=C(NNC2=CC=C(Cl)C=C2)/C(C(C)(C)C)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Felodipine, CAS:72509-76-3, Molecular Weight: 384.2538, C18H19Cl2NO4, Purity:98, SMILES: O=C(C1=C(C)NC(C)=C(C(OC)=O)C1C2=CC=CC(Cl)=C2Cl)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
CDK-IN-2, CAS:1269815-17-9, Molecular Weight: 363.8138, C18H19ClFN3O2, Purity:98, SMILES: FC1=CC(C2=CC(NC([C@H]3CNCCC3)=O)=NC=C2Cl)=C(C=C1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Thieno[2,3-d]pyridazine-7-carboxamide, 2-(3-fluorophenyl)-4-[(3S)-3-piperidinylamino]-, hydrochloride, CAS:1278405-51-8, Molecular Weight: 407.8927632, C18H19ClFN5OS, Purity:98, SMILES: O=C(C1=NN=C(N[C@@H]2CNCCC2)C3=C1SC(C4=CC=CC(F)=C4)=C3)N.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
BIBX 1382, CAS:196612-93-8, Molecular Weight: 387.8418, C18H19ClFN7, Purity:98, SMILES: ClC1=CC(NC2=NC=NC3=CN=C(NC(CC4)CCN4C)N=C23)=CC=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Clozapine, CAS:5786-21-0, Molecular Weight: 326.8233, C18H19ClN4, Purity:98, SMILES: CN1CCN(CC1)C2=NC3=CC(Cl)=CC=C3NC4=CC=CC=C42, HPLC, NMR, LCMS is ok, stock more than 10g. |
Clozapine (N-oxide), CAS:34233-69-7, Molecular Weight: 342.8227, C18H19ClN4O, Purity:98, SMILES: [O-][N+]1(C)CCN(C2=NC3=CC(Cl)=CC=C3NC4=CC=CC=C42)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
CMK, CAS:821794-90-5, Molecular Weight: 358.8221, C18H19ClN4O2, Purity:98, SMILES: NC1=C(C2=NC=N1)C(C3=CC=C(C=C3)C)=C(N2CCCO)C(CCl)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
TC-G-1008, CAS:1621175-65-2, Molecular Weight: 418.90046, C18H19ClN6O2S, Purity:98, SMILES: CS(=O)(NC1=CC=C(CNC2=NC(NC)=NC(C3=NC=CC=C3)=C2)C(Cl)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-Desmethyl Clomipramine (D3 hydrochloride), CAS:1189971-04-7, Molecular Weight: 340.3052, C18H19D3Cl2N2, Purity:98, SMILES: ClC1=CC2=C(C=C1)CCC3=C(C=CC=C3)N2CCCNC([2H])([2H])[2H].[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Enalaprilat D5, CAS:349554-00-3, Molecular Weight: 353.4244, C18H19D5N2O5, Purity:98, SMILES: #022eDvFeSzs5+hFKS6/eI9FYI9O+jI/eihPK1DPK1DPKEJpeIzs5+hFKS8rPE8r eI9FwTDFKjqi+jIreihpwkhbK1DFKjqi+jIreihpwkhbK1DFwlqi+jI= , HPLC, NMR, LCMS is ok, stock more than 10g. |
GDC-0077, CAS:2060571-02-8, Molecular Weight: 407.3713664, C18H19F2N5O4, Purity:98, SMILES: C[C@@H](C(N)=O)NC1=CC=C(C2=NC(N3[C@H](C(F)F)COC3=O)=CN2CCO4)C4=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
WAY 316606, CAS:915759-45-4, Molecular Weight: 448.4797, C18H19F3N2O4S2, Purity:98, SMILES: O=S(C1=CC(S(=O)(C2=CC=CC=C2)=O)=CC=C1C(F)(F)F)(NC3CCNCC3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Decernotinib, CAS:944842-54-0, Molecular Weight: 392.3783, C18H19F3N6O, Purity:98, SMILES: C[C@](C(NCC(F)(F)F)=O)(CC)NC1=NC(C2=CNC3=NC=CC=C32)=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S-5-(4-((2-fluorobenzyloxyphenylpyrrolidine-2-carboxamide, CAS:0, Molecular Weight: 314.3541, C18H19FN2O2, Purity:95, SMILES: NC(=O)[C@@H]1CCC(N1)C1=CC=C(OCC2=CC=CC=C2F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
CNV1014802, CAS:934240-30-9, Molecular Weight: 314.3541, C18H19FN2O2, Purity:98, SMILES: O=C([C@H]1N[C@@H](C2=CC=C(OCC3=CC=CC=C3F)C=C2)CC1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
benzyl (3-fluoro-4-thiomorpholinophenylcarbamate, CAS:168828-71-5, Molecular Weight: 346.419, C18H19FN2O2S, Purity:95, SMILES: FC1=C(C=CC(NC(=O)OCC2=CC=CC=C2)=C1)N1CCSCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
FMK, CAS:821794-92-7, Molecular Weight: 342.3675, C18H19FN4O2, Purity:98, SMILES: FCC(C1=C(C2=C(N=CN=C2N1CCCO)N)C3=CC=C(C=C3)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
IB-MECA, CAS:152918-18-8, Molecular Weight: 510.2857, C18H19IN6O4, Purity:98, SMILES: O[C@H]1[C@H](N2C=NC3=C(NCC4=CC=CC(I)=C4)N=CN=C23)O[C@H](C(NC)=O)[C@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1,5-Methano-1H-3-benzazepine, 2,3,4,5-tetrahydro-3-(phenylmethyl)-, CAS:230615-48-2, Molecular Weight: 249.3502, C18H19N, Purity:95, SMILES: c1ccc(cc1)CN1CC2CC(C1)c1c2cccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4'-Pentyl-[1,1'-biphenyl]-4-carbonitrile, CAS:40817-08-1, Molecular Weight: 249.3502, C18H19N, Purity:98, SMILES: CCCCCc1ccc(cc1)-c1ccc(cc1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-arylisoquinolinamine derivative, CAS:1029008-71-6, Molecular Weight: 293.3629, C18H19N3O, Purity:98, SMILES: NC1=NC(C2=CC=CC(OC)=C2)=CC(C=C3)=C1C=C3N(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ondansetron, CAS:99614-02-5, Molecular Weight: 293.3629, C18H19N3O, Purity:98, SMILES: O=C1C(CN2C=CN=C2C)CCC(N3C)=C1C4=C3C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diacetazotol, CAS:83-63-6, Molecular Weight: 309.36236, C18H19N3O2, Purity:98, SMILES: CC(N(C(C)=O)C1=CC=C(/N=N/C2=CC=CC=C2C)C=C1C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
VU0152100, CAS:409351-28-6, Molecular Weight: 341.42736, C18H19N3O2S, Purity:98, SMILES: CC1=C2C(SC(C(NCC3=CC=C(OC)C=C3)=O)=C2N)=NC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
FGH10019, CAS:1046045-61-7, Molecular Weight: 373.4924, C18H19N3O2S2, Purity:98, SMILES: CS(=O)(NC1=CC=C(C2=CSC(C3=CC(CCC)=NC=C3)=N2)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rosiglitazone, CAS:122320-73-4, Molecular Weight: 357.4268, C18H19N3O3S, Purity:98, SMILES: O=C(N1)SC(CC2=CC=C(OCCN(C)C3=NC=CC=C3)C=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
L-655708, CAS:130477-52-0, Molecular Weight: 341.3611, C18H19N3O4, Purity:98, SMILES: COC1=CC=C(C2=C1)N3C=NC(C(OCC)=O)=C3[C@@]4([H])N(CCC4)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nitroxazepine, CAS:47439-36-1, Molecular Weight: 341.36116, C18H19N3O4, Purity:98, SMILES: O=C1N(CCCN(C)C)C2=CC=CC=C2OC3=CC=C([N+]([O-])=O)C=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
1,3-Dioxane-4,6-Dione, 5-[[[1-[(4-MethoxyphenylMethyl]-1H-Pyrazol-5-Yl]Amino]Methylene]-2,2-Dimethyl-, CAS:949556-46-1, Molecular Weight: 357.3606, C18H19N3O5, Purity:95, SMILES: COC1=CC=C(CN2N=CC=C2NC=C2C(=O)OC(C)(C)OC2=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Voreloxin, CAS:175414-77-4, Molecular Weight: 401.4396, C18H19N5O4S, Purity:98, SMILES: O=C(C1=CN(C2=NC=CS2)C3=C(C=CC(N4C[C@H](OC)[C@@H](NC)C4)=N3)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
LY2606368, CAS:1234015-52-1, Molecular Weight: 365.38916, C18H19N7O2, Purity:98, SMILES: NCCCOC(C=CC=C1OC)=C1C2=CC(NC3=NC=C(C#N)N=C3)=NN2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fosbretabulin (disodium), CAS:168555-66-6, Molecular Weight: 440.292, C18H19Na2O8P, Purity:98, SMILES: COC1=C(OC)C(OC)=CC(/C=C\C2=CC=C(OC)C(OP([O-])([O-])=O)=C2)=C1.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-2,2-diphenyl-2-(pyrrolidin-3-yl)acetic acid, CAS:1050646-75-7, Molecular Weight: 281.349, C18H19NO2, Purity:95, SMILES: O=C(O)C(C1=CC=CC=C1)(C2=CC=CC=C2)[C@H]3CNCC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
TRANS-1-BENZYL-4-PHENYLPYRROLIDINE-3-CARBOXYLIC ACID, CAS:80896-73-7, Molecular Weight: 281.349, C18H19NO2, Purity:95, SMILES: OC(=O)[C@@H]1CN(CC2=CC=CC=C2)C[C@H]1C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(9H-Fluoren-9-yl)methyl (3-hydroxypropyl)carbamate, CAS:157887-82-6, Molecular Weight: 297.3484, C18H19NO3, Purity:97, SMILES: OCCCNC(=O)OCC1c2ccccc2c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Poloxin, CAS:321688-88-4, Molecular Weight: 297.3484, C18H19NO3, Purity:98, SMILES: O=C(C(C(C)C)=C/1)C=C(C)C1=N/OC(C2=CC=CC=C2C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
CPA inhibitor, CAS:223532-02-3, Molecular Weight: 313.3477, C18H19NO4, Purity:98, SMILES: O=C(N(CC(C(O)=O)CC1=CC=CC=C1)O)CC2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Norisoboldine, CAS:23599-69-1, Molecular Weight: 313.3477, C18H19NO4, Purity:98, SMILES: OC1=C(OC)C=C2CCN[C@@]3([H])CC4=CC(O)=C(OC)C=C4C1=C23, HPLC, NMR, LCMS is ok, stock more than 10g. |
Z-L-phenylalanine methyl ester, CAS:35909-92-3, Molecular Weight: 313.3478, C18H19NO4, Purity:95, SMILES: COC(=O)[C@H](Cc1ccccc1)NC(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S-Benzyl 2-(((BenzyloxyCarbonylAmino-3-Hydroxypropanoate, CAS:21209-51-8, Molecular Weight: 329.3472, C18H19NO5, Purity:95, SMILES: OC[C@H](NC(=O)OCC1=CC=CC=C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-((((9H-Fluoren-9-yl)methoxy)carbonyl)(methyl)amino)acetic acid hydrate, CAS:212651-47-3, Molecular Weight: 329.3472, C18H19NO5, Purity:95, SMILES: OC(=O)CN(C(=O)OCC1c2ccccc2c2c1cccc2)C.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Duloxetine, CAS:116539-59-4, Molecular Weight: 297.4146, C18H19NOS, Purity:98, SMILES: CNCC[C@H](OC1=CC=CC2=C1C=CC=C2)C3=CC=CS3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Duloxetine metabolite Para-Naphthol Duloxetine, CAS:949095-98-1, Molecular Weight: 297.4146, C18H19NOS, Purity:98, SMILES: OC1=CC=C(C(CCNC)C2=CC=CS2)C3=CC=CC=C31, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R)-1-Methyl-3,3-diphenylhexahydropyrrolo[1,2-c][1,3,2]oxazaborole, CAS:112022-83-0, Molecular Weight: 277.169, C18H20BNO, Purity:98, SMILES: [H][C@]12CCCN1B(C)OC2(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-2,2-diphenyl-2-(pyrrolidin-3-yl)acetic acid (hydrobromide), CAS:1415566-36-7, Molecular Weight: 362.261, C18H20BrNO2, Purity:95, SMILES: O=C(O)C(C1=CC=CC=C1)(C2=CC=CC=C2)[C@H]3CNCC3.[H]Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(3-Piperidin-4-Ylmethyl-Phenoxy-5-Trifluoromethyl-Pyridine Hydrochloride, CAS:1373029-08-3, Molecular Weight: 372.812, C18H20ClF3N2O, Purity:95, SMILES: Cl.FC(F)(F)C1=CC=C(OC2=CC(CC3CCNCC3)=CC=C2)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Triflupromazine (hydrochloride), CAS:1098-60-8, Molecular Weight: 388.878, C18H20ClF3N2S, Purity:98, SMILES: FC(C(C=C1N2CCCN(C)C)=CC=C1SC3=C2C=CC=C3)(F)F.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
CNV1014802 (hydrochloride), CAS:934240-31-0, Molecular Weight: 350.815, C18H20ClFN2O2, Purity:98, SMILES: O=C([C@H]1N[C@@H](C2=CC=C(OCC3=CC=CC=C3F)C=C2)CC1)N.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ondansetron (Hydrochloride), CAS:99614-01-4, Molecular Weight: 329.8239, C18H20ClN3O, Purity:98, SMILES: O=C1C(CN2C=CN=C2C)CCC(N3C)=C1C4=C3C=CC=C4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pyrido[1,2-a]indol-6(7H)-one, 8,9-dihydro-10-methyl-7-[(5-methyl-1H-imidazol-4-yl)methyl]-, monohydrochloride, CAS:129299-81-6, Molecular Weight: 329.8239, C18H20ClN3O, Purity:98, SMILES: O=C1C(CC2=C(C)N=CN2)CCC(N31)=C(C)C4=C3C=CC=C4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
CCT128930, CAS:885499-61-6, Molecular Weight: 341.8379, C18H20ClN5, Purity:98, SMILES: ClC1=CC=C(C=C1)CC2(CCN(CC2)C3=NC=NC4=C3C=CN4)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Voreloxin (Hydrochloride), CAS:175519-16-1, Molecular Weight: 437.9005, C18H20ClN5O4S, Purity:98, SMILES: [H]Cl.O=C(C1=CN(C2=NC=CS2)C3=C(C=CC(N4C[C@H](OC)[C@@H](NC)C4)=N3)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Laurolitsine (hydrochloride), CAS:, Molecular Weight: 349.8087, C18H20ClNO4, Purity:98, SMILES: OC1=C(OC)C2=C3C(CCN[C@@]3([H])CC4=CC(O)=C(OC)C=C24)=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Duloxetine (hydrochloride), CAS:136434-34-9, Molecular Weight: 333.8755, C18H20ClNOS, Purity:98, SMILES: CNCC[C@H](OC1=CC=CC2=C1C=CC=C2)C3=CC=CS3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Levofloxacin, CAS:100986-85-4, Molecular Weight: 361.3675, C18H20FN3O4, Purity:98, SMILES: O=C(C(C1=O)=CN2[C@@H](C)COC3=C(N4CCN(C)CC4)C(F)=CC1=C23)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Levofloxacin, CAS:100986-85-4, Molecular Weight: 361.3675, C18H20FN3O4, Purity:99, SMILES: C[C@H]1COc2c(N3CCN(C)CC3)c(F)cc3c2n1cc(C(O)=O)c3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ofloxacin, CAS:82419-36-1, Molecular Weight: 361.3675, C18H20FN3O4, Purity:98, SMILES: O=C(C(C1=O)=CN2C(C)COC3=C(N4CCN(C)CC4)C(F)=CC1=C23)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PF06650833, CAS:1817626-54-2, Molecular Weight: 361.3675, C18H20FN3O4, Purity:98, SMILES: NC(C1=C(OC)C=C2C(C=CN=C2OC[C@@H]3[C@H](CC)[C@H](F)C(N3)=O)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Levofloxacin (hydrate), CAS:138199-71-0, Molecular Weight: 370.38, C18H20FN3O4 . 0.5H2O, Purity:98, SMILES: O=C(C(C1=O)=CN2[C@@H](C)COC3=C(N4CCN(C)CC4)C(F)=CC1=C23)O.[0.5H2O], HPLC, NMR, LCMS is ok, stock more than 10g. |
Trelagliptin, CAS:865759-25-7, Molecular Weight: 357.3821, C18H20FN5O2, Purity:98, SMILES: N#CC1=CC=C(F)C=C1CN(C(N2C)=O)C(N3C[C@H](N)CCC3)=CC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Mianserin, CAS:24219-97-4, Molecular Weight: 264.3648, C18H20N2, Purity:98, SMILES: CN(CC1)CC2N1C3=CC=CC=C3CC4=CC=CC=C24, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,2-diphenyl-2-(pyrrolidin-3-yl)acetamide, CAS:103887-32-7, Molecular Weight: 280.3642, C18H20N2O, Purity:95, SMILES: NC(=O)C(c1ccccc1)(c1ccccc1)C1CNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R)-benzyl methyl(1,2,3,4-tetrahydroquinolin-3-yl)carbamate, CAS:166742-98-9, Molecular Weight: 296.3636, C18H20N2O2, Purity:95, SMILES: O=C(N([C@H]1CNc2c(C1)cccc2)C)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Vinconate, CAS:70704-03-9, Molecular Weight: 296.3636, C18H20N2O2, Purity:98, SMILES: O=C(C1=CCC2N(CC)CCC3=C2N1C4=C3C=CC=C4)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Liranaftate, CAS:88678-31-3, Molecular Weight: 328.4286, C18H20N2O2S, Purity:98, SMILES: S=C(OC1=CC=C2CCCCC2=C1)N(C3=NC(OC)=CC=C3)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
L-4,4'-Biphenylalanine, CAS:155760-02-4, Molecular Weight: 328.3624, C18H20N2O4, Purity:95, SMILES: N[C@H](C(=O)O)Cc1ccc(cc1)c1ccc(cc1)C[C@@H](C(=O)O)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
TCS 359, CAS:301305-73-7, Molecular Weight: 360.4274, C18H20N2O4S, Purity:98, SMILES: O=C(C1=C(NC(C2=CC=C(OC)C(OC)=C2)=O)SC3=C1CCCC3)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nitrendipine, CAS:39562-70-4, Molecular Weight: 360.3612, C18H20N2O6, Purity:98, SMILES: O=C(C1=C(C)NC(C)=C(C(OC)=O)C1C2=CC=CC([N+]([O-])=O)=C2)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rabeprazole (sodium), CAS:117976-90-6, Molecular Weight: 381.4245, C18H20N3NaO3S, Purity:98, SMILES: O=S(C1=NC2=CC=CC=C2N1)CC3=NC=CC(OCCCOC)=C3C.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl 3-(((1H-benzo[d][1,2,3]triazol-1-yl)methyl)(benzyl)amino)propanoate, CAS:, Molecular Weight: 324.377, C18H20N4O2, Purity:95, SMILES: COC(=O)CCN(Cn1nnc2c1cccc2)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nitracrine, CAS:4533-39-5, Molecular Weight: 324.377, C18H20N4O2, Purity:98, SMILES: O=[N+](C1=CC=CC2=NC3=CC=CC=C3C(NCCCN(C)C)=C21)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
SCH00013, CAS:217963-18-3, Molecular Weight: 324.377, C18H20N4O2, Purity:98, SMILES: N#CC1=CC=C(C(O)CN2CC=C(C(CC3)=NNC3=O)CC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Imiquimod (maleate), CAS:896106-16-4, Molecular Weight: 356.3758, C18H20N4O4, Purity:98, SMILES: NC1=NC2=CC=CC=C2C3=C1N=CN3CC(C)C.O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
CYC-116, CAS:693228-63-6, Molecular Weight: 368.456, C18H20N6OS, Purity:98, SMILES: CC1=C(SC(N)=N1)C2=NC(NC3=CC=C(C=C3)N4CCOCC4)=NC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diethylstilbestrol, CAS:56-53-1, Molecular Weight: 268.3502, C18H20O2, Purity:98, SMILES: OC1=CC=C(/C(CC)=C(CC)/C2=CC=C(O)C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Equilin, CAS:474-86-2, Molecular Weight: 268.3502, C18H20O2, Purity:98, SMILES: C[C@]1([C@](CC2)([H])C3=CCC4=C(C=CC(O)=C4)[C@@]3([H])CC1)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(4-(benzyloxyphenyl-3-methylbutanoic acid, CAS:121108-85-8, Molecular Weight: 284.3496, C18H20O3, Purity:95, SMILES: CC(C)C(C(O)=O)C1=CC=C(OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
TMS, CAS:24144-92-1, Molecular Weight: 300.349, C18H20O4, Purity:98, SMILES: COC1=CC=C(/C=C/C2=CC(OC)=CC(OC)=C2)C(OC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Combretastatin A4, CAS:117048-59-6, Molecular Weight: 316.3484, C18H20O5, Purity:98, SMILES: OC1=CC(/C=C\C2=CC(OC)=C(OC)C(OC)=C2)=CC=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Loureirin B, CAS:119425-90-0, Molecular Weight: 316.3484, C18H20O5, Purity:98, SMILES: O=C(C1=CC=C(O)C=C1)CCC2=C(OC)C=C(OC)C=C2OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
SDZ281-977, CAS:150779-71-8, Molecular Weight: 316.3484, C18H20O5, Purity:98, SMILES: O=C(OC)C1=CC(CCC2=CC(OC)=CC=C2OC)=CC=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,4-Difluoro-N-(2-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridin-3-yl)benzenesulfonamide, CAS:1083326-73-1, Molecular Weight: 426.243, C18H21BF2N2O5S, Purity:90, SMILES: COc1ncc(cc1NS(=O)(=O)c1ccc(cc1F)F)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-Biphenylboronic acid pinacol ester, CAS:912844-88-3, Molecular Weight: 280.169, C18H21BO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cccc(c1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-Biphenylboronic acid pinacol ester, CAS:144432-80-4, Molecular Weight: 280.169, C18H21BO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1ccc(cc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4,4,5,5-Tetramethyl-2-(4-phenoxyphenyl)-1,3,2-dioxaborolane, CAS:269410-26-6, Molecular Weight: 296.169, C18H21BO3, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1ccc(cc1)Oc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
DMP 696, CAS:202578-52-7, Molecular Weight: 410.2976, C18H21Cl2N5O2, Purity:98, SMILES: CC1=NN2C(N=C(C)N=C2NC(COC)COC)=C1C3=CC=C(Cl)C=C3Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
LY2606368 (dihydrochloride), CAS:1234015-54-3, Molecular Weight: 438.31104, C18H21Cl2N7O2, Purity:98, SMILES: NCCCOC(C=CC=C1OC)=C1C2=CC(NC3=NC=C(C#N)N=C3)=NN2.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Mianserin (hydrochloride), CAS:21535-47-7, Molecular Weight: 300.8257, C18H21ClN2, Purity:98, SMILES: CN(CC1)CC2N1C3=CC=CC=C3CC4=CC=CC=C24.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK4112, CAS:1216744-19-2, Molecular Weight: 396.8883, C18H21ClN2O4S, Purity:98, SMILES: ClC1=CC=C(CN(CC2=CC=C([N+]([O-])=O)S2)CC(OC(C)(C)C)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
R547, CAS:741713-40-6, Molecular Weight: 441.4522, C18H21F2N5O4S, Purity:98, SMILES: O=S(N1CCC(NC2=NC(N)=C(C(C3=C(C(F)=CC=C3OC)F)=O)C=N2)CC1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diethyl 1-benzyl-5,5-difluoro-4-oxopiperidine-2,3-dicarboxylate, CAS:, Molecular Weight: 369.3598, C18H21F2NO5, Purity:95, SMILES: CCOC(=O)C1N(Cc2ccccc2)CC(C(=O)C1C(=O)OCC)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Racemic-(2S,3aS,6aS-ethyl 1-benzyl-5-(2,2,2-trifluoroacetyloctahydropyrrolo[3,4-b]pyrrole-2-carboxylate, CAS:0, Molecular Weight: 370.3661, C18H21F3N2O3, Purity:95, SMILES: CCOC(=O)[C@@H]1C[C@H]2CN(C[C@H]2N1CC1=CC=CC=C1)C(=O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
NVP-BKM120, CAS:944396-07-0, Molecular Weight: 410.3936, C18H21F3N6O2, Purity:98, SMILES: FC(F)(C1=C(C2=CC(N3CCOCC3)=NC(N4CCOCC4)=N2)C=NC(N)=C1)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
IU1, CAS:314245-33-5, Molecular Weight: 300.3705, C18H21FN2O, Purity:98, SMILES: CC1=CC(C(CN2CCCC2)=O)=C(C)N1C3=CC=C(F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
IDO-IN-5, CAS:1402837-79-9, Molecular Weight: 316.3699, C18H21FN2O2, Purity:98, SMILES: O[C@H](CC1)CC[C@]1([H])[C@H](O)C[C@H]2N3C(C4=C2C(F)=CC=C4)=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
IDO-IN-6, CAS:1402837-76-6, Molecular Weight: 316.3699, C18H21FN2O2, Purity:98, SMILES: O[C@H](CC1)CC[C@]1([H])[C@@H](O)C[C@@H]2N3C(C4=C2C(F)=CC=C4)=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
IDO-IN-8, CAS:1402837-77-7, Molecular Weight: 316.3699, C18H21FN2O2, Purity:98, SMILES: O[C@H](CC1)CC[C@]1([H])[C@@H](O)C[C@H]2N3C(C4=C2C(F)=CC=C4)=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Navoximod, CAS:1402837-78-8, Molecular Weight: 316.3699, C18H21FN2O2, Purity:98, SMILES: O[C@H](CC1)CC[C@]1([H])[C@H](O)C[C@@H]2N3C(C4=C2C(F)=CC=C4)=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzyl-1',2'-Dihydrospiro[Piperidine-4,3'-Pyrrolo[2,3-B]Pyridine], CAS:845552-76-3, Molecular Weight: 279.3794, C18H21N3, Purity:95, SMILES: C(N1CCC2(CNC3=NC=CC=C23)CC1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Spiro[1-azabicyclo[2.2.2]octane-3,5'(4'H)-oxazole], 2'-(1-methyl-1H-indol-3-yl)-, CAS:128199-93-9, Molecular Weight: 295.37884, C18H21N3O, Purity:98, SMILES: CN1C=C(C(O2)=NCC32CN4CCC3CC4)C5=C1C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzyl-4-(4-nitrobenzyl)piperazine, CAS:148120-37-0, Molecular Weight: 311.3782, C18H21N3O2, Purity:95, SMILES: [O-][N+](=O)c1ccc(cc1)CN1CCN(CC1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
DY131, CAS:95167-41-2, Molecular Weight: 311.3782, C18H21N3O2, Purity:98, SMILES: O=C(N/N=C/C1=CC=C(N(CC)CC)C=C1)C2=CC=C(O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-[[[4-(3-Methoxypropoxy)-3-methylpyridine-2-yl ]methyl]thio]-1H-benzimidazole, CAS:117977-21-6, Molecular Weight: 343.443, C18H21N3O2S, Purity:95, SMILES: COCCCOc1ccnc(c1C)CSc1nc2c([nH]1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(4-((1H-imidazol-1-yl)methyl)phenyl)-N-(tert-butyl)thiophene-2-sulfonamide, CAS:2089650-46-2, Molecular Weight: 375.508, C18H21N3O2S2, Purity:95, SMILES: CC(C)(C)NS(=O)(=O)c1sccc1-c1ccc(Cn2ccnc2)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rabeprazole, CAS:117976-89-3, Molecular Weight: 359.4426, C18H21N3O3S, Purity:98, SMILES: O=S(C1=NC2=CC=CC=C2N1)CC3=NC=CC(OCCCOC)=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
S3337, CAS:108499-48-5, Molecular Weight: 359.44264, C18H21N3O3S, Purity:98, SMILES: CCNC1=CC=CC=C1CS(C2=NC3=CC(OC)=C(OC)C=C3N2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ethacridine (lactate), CAS:1837-57-6, Molecular Weight: 343.37704, C18H21N3O4, Purity:98, SMILES: CC(O)C(O)=O.NC1=CC2=NC3=CC=C(OCC)C=C3C(N)=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefprozil (monohydrate), CAS:121123-17-9, Molecular Weight: 407.4408, C18H21N3O6S, Purity:98, SMILES: OC(C(N1[C@@]2([H])[C@H](NC([C@@H](C3=CC=C(O)C=C3)N)=O)C1=O)=C(CS2)/C=C/C)=O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tenovin-3, CAS:1011301-27-1, Molecular Weight: 327.4438, C18H21N3OS, Purity:98, SMILES: O=C(NC(NC1=CC=C(N)C=C1)=S)C2=CC=C(C(C)(C)C)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Alogliptin, CAS:850649-61-5, Molecular Weight: 339.3916, C18H21N5O2, Purity:98, SMILES: O=C(C=C(N1C[C@H](N)CCC1)N(C2=O)CC3=C(C#N)C=CC=C3)N2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
AZD-5438, CAS:602306-29-6, Molecular Weight: 371.4566, C18H21N5O2S, Purity:98, SMILES: O=S(C1=CC=C(NC2=NC(C3=CN=C(N3C(C)C)C)=CC=N2)C=C1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
DprE1-IN-1, CAS:1494675-86-3, Molecular Weight: 355.3911, C18H21N5O3, Purity:98, SMILES: O=C(C1=CN(CC2=NC=NC(OC)=C2C)C3=CC(C)=CN=C31)NCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
HC-030031, CAS:349085-38-7, Molecular Weight: 355.3911, C18H21N5O3, Purity:98, SMILES: O=C1C2=C(N=CN2CC(NC3=CC=C(C(C)C)C=C3)=O)N(C)C(N1C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
N6-(2-Phenylethyl)adenosine, CAS:20125-39-7, Molecular Weight: 371.39044, C18H21N5O4, Purity:98, SMILES: OC[C@@H]1[C@H]([C@H]([C@H](N2C=NC3=C2N=CN=C3NCCC4=CC=CC=C4)O1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
AB-MECA, CAS:152918-26-8, Molecular Weight: 399.4038, C18H21N7O4, Purity:98, SMILES: O[C@H]1[C@H](N2C=NC3=C(NCC4=CC=C(N)C=C4)N=CN=C23)O[C@H](C(NC)=O)[C@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-[[Bis(PhenylmethylAmino]Methyl] Cyclopropanol, CAS:428855-17-8, Molecular Weight: 267.3654, C18H21NO, Purity:95, SMILES: OC1(CN(CC2=CC=CC=C2)CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzhydryl-3-(MethoxymethylAzetidine, CAS:955400-19-8, Molecular Weight: 267.3654, C18H21NO, Purity:95, SMILES: COCC1CN(C1)C(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(benzhydrylamino)-3-methylbutan-2-one, CAS:159556-71-5, Molecular Weight: 267.3654, C18H21NO, Purity:99, SMILES: CC(=O)C(C)(C)NC(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Azacyclonol, CAS:115-46-8, Molecular Weight: 267.3654, C18H21NO, Purity:98, SMILES: OC(C1=CC=CC=C1)(C2CCNCC2)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
(3-(dibenzylamino)oxetan-3-yl)methanol, CAS:, Molecular Weight: 283.3648, C18H21NO2, Purity:95, SMILES: OCC1(COC1)N(Cc1ccccc1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzyl-4-(2-HydroxyphenylPiperidin-4-Ol, CAS:474396-94-6, Molecular Weight: 283.3648, C18H21NO2, Purity:95, SMILES: OC1=CC=CC=C1C1(O)CCN(CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ethyl 2-(dibenzylamino)acetate, CAS:77385-90-1, Molecular Weight: 283.3648, C18H21NO2, Purity:98, SMILES: CCOC(=O)CN(Cc1ccccc1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
TERT-BUTYL 4-CYCLOPROPYLNAPHTHALEN-1-YLCARBAMATE, CAS:1533519-91-3, Molecular Weight: 283.3648, C18H21NO2, Purity:95, SMILES: CC(C)(C)OC(=O)Nc1ccc(C2CC2)c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(dibenzylamino)-3-methylthietane 1,1-dioxide, CAS:1936219-91-8, Molecular Weight: 315.43, C18H21NO2S, Purity:95, SMILES: CC1(CS(=O)(=O)C1)N(Cc1ccccc1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cephalotaxlen, CAS:24316-19-6, Molecular Weight: 315.3636, C18H21NO4, Purity:98, SMILES: O[C@H]1[C@](C(C=C(OCO2)C2=C3)=C3CCN4CCC5)([H])[C@]45C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
diethyl 2-acetamido-2-(benzo[b]thiophen-3-ylmethylmalonate, CAS:23906-20-9, Molecular Weight: 363.428, C18H21NO5S, Purity:95, SMILES: CCOC(=O)C(CC1=CSC2=CC=CC=C12)(NC(C)=O)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S-tert-butyl 2-(5-(4-bromophenyl-1H-imidazol-2-ylpyrrolidine-1-carboxylate, CAS:1007882-04-3, Molecular Weight: 392.29, C18H22BrN3O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC[C@H]1C1=NC=C(N1)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
LY2603618, CAS:911222-45-2, Molecular Weight: 436.303, C18H22BrN5O3, Purity:98, SMILES: BrC(C=C1NC(NC2=NC=C(N=C2)C)=O)=C(C=C1OC[C@H]3OCCNC3)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Embramine, CAS:3565-72-8, Molecular Weight: 348.27738, C18H22BrNO, Purity:98, SMILES: CC(C1=CC=CC=C1)(C2=CC=C(Br)C=C2)OCCN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 7-Bromospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-64-2, Molecular Weight: 364.277, C18H22BrNO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C=CC1=C2C(Br)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Bromo-3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-30-2, Molecular Weight: 380.276, C18H22BrNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(=O)C3=C2C=CC(Br)=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Bromo-3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-43-7, Molecular Weight: 380.276, C18H22BrNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(=O)C3=C2C=C(Br)C=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 7-Bromo-3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-52-8, Molecular Weight: 380.276, C18H22BrNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(=O)C3=C2C(Br)=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-Butyl 6-bromo-4-oxospiro[chroman-2,4'-piperidine]-1'-carboxylate, CAS:690632-38-3, Molecular Weight: 396.276, C18H22BrNO4, Purity:95, SMILES: Brc1ccc2c(c1)C(=O)CC1(O2)CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tedatioxetine (hydrobromide), CAS:960151-65-9, Molecular Weight: 364.34298, C18H22BrNS, Purity:98, SMILES: CC1=CC=C(SC2=CC=CC=C2C3CCNCC3)C=C1.[H]Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diclofenac (diethylamine), CAS:78213-16-8, Molecular Weight: 369.2855, C18H22Cl2N2O2, Purity:98, SMILES: O=C(O)CC1=CC=CC=C1NC2=C(Cl)C=CC=C2Cl.CCNCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
NVP-BKM120 (Hydrochloride), CAS:1312445-63-8, Molecular Weight: 446.8545, C18H22ClF3N6O2, Purity:98, SMILES: NC(N=C1)=CC(C(F)(F)F)=C1C2=NC(N3CCOCC3)=NC(N4CCOCC4)=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(4-Phenoxy-Benzyl-Piperidine Hydrochloride, CAS:1172749-25-5, Molecular Weight: 303.826, C18H22ClNO, Purity:95, SMILES: Cl.C(C1CCNCC1)C1=CC=C(OC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Chlorphenoxamine, CAS:77-38-3, Molecular Weight: 303.8264, C18H22ClNO, Purity:98, SMILES: CN(CCOC(C1=CC=CC=C1)(C2=CC=C(C=C2)Cl)C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Chlorospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:855849-89-7, Molecular Weight: 319.826, C18H22ClNO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C=CC1=C2C=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cloquintocet-mexyl, CAS:99607-70-2, Molecular Weight: 335.8252, C18H22ClNO3, Purity:98, SMILES: O=C(OC(C)CCCCC)COC1=C2N=CC=CC2=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Chloro-3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:855849-90-0, Molecular Weight: 335.825, C18H22ClNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(=O)C3=CC=C(Cl)C=C23)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R)-Rivastigmine (D6 tartrate), CAS:194930-00-2, Molecular Weight: 406.4605, C18H22D6N2O8, Purity:98, SMILES: O=C(OC1=CC=CC([C@@H](C)N(C([2H])([2H])[2H])C([2H])([2H])[2H])=C1)N(CC)C.O=C(O)[C@H](O)[C@@H](O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Efinaconazole, CAS:164650-44-6, Molecular Weight: 348.3903, C18H22F2N4O, Purity:98, SMILES: C[C@@H](N1CCC(CC1)=C)[C@@](O)(C2=CC=C(F)C=C2F)CN3N=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
AZD-5069, CAS:878385-84-3, Molecular Weight: 476.5179, C18H22F2N4O5S2, Purity:98, SMILES: O=S(N1CCC1)(NC2=NC(SCC3=CC=CC(F)=C3F)=NC(O[C@H](C)[C@@H](O)CO)=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
AS1842856, CAS:836620-48-5, Molecular Weight: 347.384, C18H22FN3O3, Purity:98, SMILES: O=C(C1=CN(CC)C2=C(C(N)=C(F)C(NC3CCCCC3)=C2)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Fluorospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-59-5, Molecular Weight: 303.3712, C18H22FNO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C=CC1=C2C=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-acetamido-2,4,6-triiodo-5-(N-methylacetamido)-N-((3R,4R,5S,6R)-2,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-3-yl)benzamide, CAS:31112-62-6, Molecular Weight: 789.096, C18H22I3N3O8, Purity:95, SMILES: CN(C(C)=O)c1c(I)c(NC(C)=O)c(I)c(C(=O)N[C@H]2C(O)O[C@H](CO)[C@@H](O)[C@@H]2O)c1I, HPLC, NMR, LCMS is ok, stock more than 10g. |
NLG919, CAS:1402836-58-1, Molecular Weight: 282.3801, C18H22N2O, Purity:98, SMILES: OC(C1CCCCC1)CC(C2=C3C=CC=C2)N4C3=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tyrphostin A9, CAS:10537-47-0, Molecular Weight: 282.3801, C18H22N2O, Purity:98, SMILES: N#C/C(C#N)=C/C1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(1H-indol-3-yl)-3,6-dihydropyridine-1(2H)-carboxylate, CAS:155302-27-5, Molecular Weight: 298.3795, C18H22N2O2, Purity:95, SMILES: O=C(N1CCC(=CC1)c1c[nH]c2c1cccc2)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ro 28-1675, CAS:300353-13-3, Molecular Weight: 378.5089, C18H22N2O3S2, Purity:98, SMILES: O=C(NC1=NC=CS1)[C@H](CC2CCCC2)C3=CC=C(S(=O)(C)=O)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
6-tert-butyl 2-ethyl 7,8-dihydropyrrolo[3,2-e]indole-2,6(3H-dicarboxylate, CAS:0, Molecular Weight: 330.3783, C18H22N2O4, Purity:95, SMILES: CCOC(=O)C1=CC2=C(N1)C=CC1=C2CCN1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2',4'-Dioxo-2',4'-Dihydro-1'H-Spiro[Piperidine-4,3'-Quinoline]-1-Carboxylate, CAS:1160247-78-8, Molecular Weight: 330.3783, C18H22N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(=O)NC1=CC=CC=C1C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-(Tert-Butoxycarbonyl-2-Oxospiro[Indoline-3,4'-Piperidine]-5-Carboxylic Acid, CAS:946135-52-0, Molecular Weight: 346.3777, C18H22N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(=O)NC1=CC=C(C=C21)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Vortioxetine, CAS:508233-74-7, Molecular Weight: 298.4457, C18H22N2S, Purity:98, SMILES: CC1=CC=C(SC2=CC=CC=C2N3CCNCC3)C(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diquafosol (tetrasodium), CAS:211427-08-6, Molecular Weight: 878.23, C18H22N4Na4O23P4, Purity:98, SMILES: O[C@H]1[C@H](N(C=CC2=O)C(N2)=O)O[C@H](COP(OP(OP(OP(OC[C@H]3O[C@@H](N(C=CC4=O)C(N4)=O)[C@H](O)[C@@H]3O)([O-])=O)([O-])=O)([O-])=O)([O-])=O)[C@H]1O.[Na+].[Na+].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
6-(4-Methylpiperazin-1-yl)-4-(o-tolyl)nicotinamide, CAS:342417-01-0, Molecular Weight: 310.3935, C18H22N4O, Purity:95, SMILES: CN1CCN(CC1)c1cc(c(cn1)C(N)=O)-c1ccccc1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Peficitinib, CAS:944118-01-8, Molecular Weight: 326.3929, C18H22N4O2, Purity:98, SMILES: O[C@](C[C@@H]1C[C@H]2C3)(C2)C[C@@H]3[C@H]1NC4=C5C(NC=C5)=NC=C4C(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
ethyl 3-(3-amino-4-(methylamino)-N-(pyridin-2-yl)benzamido)propanoate, CAS:212322-56-0, Molecular Weight: 342.3923, C18H22N4O3, Purity:95, SMILES: CCOC(=O)CCN(C(=O)c1ccc(NC)c(N)c1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
SAR131675, CAS:1433953-83-3, Molecular Weight: 358.3917, C18H22N4O4, Purity:98, SMILES: O=C1C(C(NC)=O)=C(N)N(CC)C2=NC(C#C[C@@](COC)(C)O)=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
N6-[2-(4-Aminophenyl)ethyl]adenosine, CAS:89705-21-5, Molecular Weight: 386.4051, C18H22N6O4, Purity:98, SMILES: OC[C@@H]1[C@H]([C@H]([C@H](N2C=NC3=C2N=CN=C3NCCC4=CC=C(N)C=C4)O1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
GDC-0084, CAS:1382979-44-3, Molecular Weight: 382.4197, C18H22N8O2, Purity:98, SMILES: NC1=NC=C(C2=NC(N3CCOCC3)=C4N=C(C(C)(C)OCC5)N5C4=N2)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-Methylbenzylidene camphor, CAS:36861-47-9, Molecular Weight: 254.3667, C18H22O, Purity:98, SMILES: CC1(C)[C@@H]2CC[C@]1(C)C(/C2=C\C3=CC=C(C)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Estrone, CAS:53-16-7, Molecular Weight: 270.3661, C18H22O2, Purity:98, SMILES: C[C@]1([C@](CC2)([H])[C@]3([H])CCC4=C(C=CC(O)=C4)[C@@]3([H])CC1)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Estrone, CAS:53-16-7, Molecular Weight: 270.3661, C18H22O2, Purity:96, SMILES: [H][C@@]12CCC(=O)[C@@]1(C)CC[C@]1([H])c3ccc(O)cc3CC[C@@]21[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
Nordihydroguaiaretic acid, CAS:500-38-9, Molecular Weight: 302.3649, C18H22O4, Purity:98, SMILES: CC(CC1=CC=C(O)C(O)=C1)C(C)CC2=CC=C(O)C(O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(2-(benzyloxyethoxyethyl 4-methylbenzenesulfonate, CAS:98627-22-6, Molecular Weight: 350.429, C18H22O5S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OCCOCCOCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1 -(3,4-Dimethoxyphenyl)-2-(2- methoxyphenoxy)propane-1 ,3-diol, CAS:10535-17-8, Molecular Weight: 334.3637, C18H22O6, Purity:95, SMILES: COc1ccccc1OC(CO)C(O)c1ccc(OC)c(OC)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Vortioxetine (hydrobromide), CAS:960203-27-4, Molecular Weight: 379.3576, C18H23BrN2S, Purity:98, SMILES: CC1=CC=C(SC2=CC=CC=C2N3CCNCC3)C(C)=C1.[H]Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bucladesine (calcium salt), CAS:938448-87-4, Molecular Weight: 488.42, C18H23Ca0.5N5O8P, Purity:98, SMILES: O=C(CCC)O[C@H]1[C@H](N2C(N=CN=C3NC(CCC)=O)=C3N=C2)O[C@@](CO4)([H])[C@@]1([H])OP4([O-])=O.[0.5Ca2+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Phenoxybenzamine (hydrochloride), CAS:63-92-3, Molecular Weight: 340.2873, C18H23Cl2NO, Purity:98, SMILES: CC(COC1=CC=CC=C1)N(CCCl)CC2=CC=CC=C2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
YL0919, CAS:1339058-04-6, Molecular Weight: 334.8404, C18H23ClN2O2, Purity:98, SMILES: O=C1C=CC=CN1CC2(O)CCN(CC3=CC=CC=C3)CC2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Thiazinamium chloride, CAS:4320-13-2, Molecular Weight: 334.90662, C18H23ClN2S, Purity:98, SMILES: C[N+](C)(C)C(C)CN1C2=C(C=CC=C2)SC3=CC=CC=C13.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
CRT0066101 dihydrochloride, CAS:1883545-60-5, Molecular Weight: 374.8678, C18H23ClN6O, Purity:98, SMILES: N[C@H](CC)CNC1=NC(C2=C(O)C=CC(C3=CN(C)N=C3)=C2)=NC=C1.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
β-Apo-13-carotenone D3, CAS:86530-28-1, Molecular Weight: 261.416925334, C18H23D3O, Purity:98, SMILES: O=C(/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C)C([2H])([2H])[2H], HPLC, NMR, LCMS is ok, stock more than 10g. |
SRT3109, CAS:1204707-71-0, Molecular Weight: 475.5331, C18H23F2N5O4S2, Purity:98, SMILES: FC1=C(F)C=CC=C1CSC2=NC(NS(=O)(N3CCC3)=O)=CC(N[C@@H]([C@@H](O)CO)C)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
SRT3190, CAS:1204707-73-2, Molecular Weight: 475.5331, C18H23F2N5O4S2, Purity:98, SMILES: OC[C@@H]([C@@H](NC1=CC(NS(N2CCC2)(=O)=O)=NC(SCC3=C(C(F)=CC=C3)F)=N1)C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
EP1013, CAS:223568-55-6, Molecular Weight: 382.3834232, C18H23FN2O6, Purity:98, SMILES: O=C(O)C[C@H](NC([C@H](C(C)C)NC(OCC1=CC=CC=C1)=O)=O)C(CF)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Eperezolid, CAS:165800-04-4, Molecular Weight: 394.3974, C18H23FN4O5, Purity:98, SMILES: O=C(O[C@H]1CNC(C)=O)N(C1)C2=CC(F)=C(C=C2)N3CCN(CC3)C(CO)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-tert-butyl 2-((5-phenyl-1,3,4-oxadiazol-2-yl)methyl)pyrrolidine-1-carboxylate, CAS:483314-82-5, Molecular Weight: 329.3935, C18H23N3O3, Purity:99, SMILES: CC(C)(C)OC(=O)N1CCC[C@H]1Cc1nnc(o1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(4-(Tert-ButoxycarbonylPiperazin-1-YlIndolizine-6-Carboxylic Acid, CAS:1251009-25-2, Molecular Weight: 345.3929, C18H23N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC1)C1=CC=C2C=CC(=CN12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Phentolamine (mesylate), CAS:65-28-1, Molecular Weight: 377.4579, C18H23N3O4S, Purity:98, SMILES: CS(O)(=O)=O.CC1=CC=C(N(C2=CC(O)=CC=C2)CC3=NCCN3)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ethacridine (lactate monohydrate), CAS:6402-23-9, Molecular Weight: 361.3923, C18H23N3O5, Purity:98, SMILES: CC(O)C(O)=O.NC1=CC2=NC3=CC=C(OCC)C=C3C(N)=C2C=C1.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bucladesine (sodium salt), CAS:16980-89-5, Molecular Weight: 491.3675, C18H23N5NaO8P, Purity:98, SMILES: O=C(CCC)O[C@H]1[C@H](N2C(N=CN=C3NC(CCC)=O)=C3N=C2)O[C@@](CO4)([H])[C@@]1([H])OP4([O-])=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Fenethylline, CAS:3736-08-1, Molecular Weight: 341.4075, C18H23N5O2, Purity:98, SMILES: O=C(N1C)N(C)C2=C(N(CCNC(C)CC3=CC=CC=C3)C=N2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PSB-12379, CAS:1802226-78-3, Molecular Weight: 515.3508, C18H23N5O9P2, Purity:98, SMILES: O[C@@H]([C@H]1O)[C@@H](COP(CP(O)(O)=O)(O)=O)O[C@H]1N(C=N2)C3=C2C(NCC4=CC=CC=C4)=NC=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl Spiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:137419-24-0, Molecular Weight: 285.3807, C18H23NO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C=CC1=C2C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:241819-85-2, Molecular Weight: 301.3801, C18H23NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(=O)CC1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:159634-59-0, Molecular Weight: 301.3801, C18H23NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(=O)C3=C2C=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-(Tert-ButoxycarbonylSpiro[Cyclopentane-1,3'-Indoline]-5'-Carboxylic Acid, CAS:0, Molecular Weight: 317.3795, C18H23NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(CCCC2)C2=C1C=CC(=C2)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bis(2,4-dimethoxybenzyl)amine, CAS:20781-23-1, Molecular Weight: 317.3795, C18H23NO4, Purity:95, SMILES: COc1cc(OC)ccc1CNCc1ccc(cc1OC)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cocaethylene, CAS:529-38-4, Molecular Weight: 317.37952, C18H23NO4, Purity:98, SMILES: O=C([C@@H]1[C@@](N2C)([H])CC[C@@]2([H])C[C@@H]1OC(C3=CC=CC=C3)=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 4-Oxospiro[Chroman-2,4'-Piperidine]-1'-Carboxylate, CAS:849928-22-9, Molecular Weight: 317.3795, C18H23NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CC(=O)C1=C(O2)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(2-Ethoxycarbonyl-acetyl)-piperidine-1-carboxylic acid benzyl ester, CAS:167414-75-7, Molecular Weight: 333.3789, C18H23NO5, Purity:97, SMILES: CCOC(=O)CC(=O)C1CCN(CC1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pentanoic acid, 2-[(1,3-dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]-4-methyl-, 1,1-dimethylethyl ester, (2R)-, CAS:380886-35-1, Molecular Weight: 333.3789, C18H23NO5, Purity:95, SMILES: CC(C[C@H](C(=O)OC(C)(C)C)ON1C(=O)c2c(C1=O)cccc2)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Hydroxy-4-Oxospiro[Chroman-2,4'-Piperidine]-1'-Carboxylate, CAS:911227-79-7, Molecular Weight: 333.3789, C18H23NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CC(=O)C1=C(O)C=CC=C1O2, HPLC, NMR, LCMS is ok, stock more than 10g. |
(1R,2S,4S-4-(((BenzyloxyCarbonylAminoCyclohexane-1,2-Diyl Diacetate, CAS:0, Molecular Weight: 349.3783, C18H23NO6, Purity:95, SMILES: CC(=O)O[C@@H]1CC[C@@H](C[C@@H]1OC(C)=O)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(1S,2R,4S-4-(((BenzyloxyCarbonylAminoCyclohexane-1,2-Diyl Diacetate, CAS:0, Molecular Weight: 349.3783, C18H23NO6, Purity:95, SMILES: CC(=O)O[C@H]1CC[C@@H](C[C@H]1OC(C)=O)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
AMPPD, CAS:122341-56-4, Molecular Weight: 382.3448, C18H23O7P, Purity:98, SMILES: COC1(C2=CC(OP(O)(O)=O)=CC=C2)C3(C(C4)CC5CC4CC3C5)OO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Bromo-3-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-Yl-1H-Pyrrolo[2,3-C]Pyridine-1-Carboxylate, CAS:1632996-84-9, Molecular Weight: 423.109, C18H24BBrN2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1C=C(B2OC(C)(C)C(C)(C)O2)C2=CC(Br)=NC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-((Tetrahydro-2H-Pyran-4-YlOxy-5-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-YlBenzonitrile, CAS:1292317-54-4, Molecular Weight: 329.198, C18H24BNO4, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=C(OC2CCOCC2)C(=C1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Bromo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-40-4, Molecular Weight: 366.293, C18H24BrNO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CCC3=CC(Br)=CC=C23)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Bromo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-39-1, Molecular Weight: 366.293, C18H24BrNO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CCC3=C2C=C(Br)C=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 7-Bromo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-38-0, Molecular Weight: 366.293, C18H24BrNO2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CCC3=C2C(Br)=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bretylium (tosylate), CAS:61-75-6, Molecular Weight: 414.3571, C18H24BrNO3S, Purity:98, SMILES: C[N+](C)(CC)CC1=CC=CC=C1Br.O=S(C2=CC=C(C)C=C2)([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methscopolamine (bromide), CAS:155-41-9, Molecular Weight: 398.2915, C18H24BrNO4, Purity:98, SMILES: C[N+]1([C@@H]2[C@H](O3)[C@H]3[C@H]1C[C@@H](OC([C@@H](C4=CC=CC=C4)CO)=O)C2)C.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Pancopride, CAS:121650-80-4, Molecular Weight: 349.8551, C18H24ClN3O2, Purity:98, SMILES: O=C(NC1CN2CCC1CC2)C3=CC(Cl)=C(N)C=C3OCC4CC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ondansetron (hydrochloride dihydrate), CAS:103639-04-9, Molecular Weight: 365.8545, C18H24ClN3O3, Purity:98, SMILES: O=C1C(CN2C=CN=C2C)CCC(N3C)=C1C4=C3C=CC=C4.[H]Cl.O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Orphenadrine (hydrochloride), CAS:341-69-5, Molecular Weight: 305.8423, C18H24ClNO, Purity:98, SMILES: CC1=CC=CC=C1C(C2=CC=CC=C2)OCCN(C)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,6-Methano-3-benzazocine-6,8(1H)-diol, 3-(3-butyn-1-yl)-2,3,4,5-tetrahydro-11,11-dimethyl-, hydrochloride, CAS:88531-67-3, Molecular Weight: 321.84166, C18H24ClNO2, Purity:98, SMILES: OC12CCN(CCC#C)C(C2(C)C)CC3=CC=C(O)C=C13.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dobutamine (hydrochloride), CAS:49745-95-1, Molecular Weight: 337.8411, C18H24ClNO3, Purity:98, SMILES: OC1=CC=C(CCNC(C)CCC2=CC=C(O)C=C2)C=C1O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 5-(Benzyloxycarbonylamino)-3,3-difluoropiperidine-1-carboxylate, CAS:, Molecular Weight: 370.391, C18H24F2N2O4, Purity:95, SMILES: O=C(NC1CN(CC(C1)(F)F)C(=O)OC(C)(C)C)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pefloxacin (mesylate), CAS:70458-95-6, Molecular Weight: 429.4631, C18H24FN3O6S, Purity:98, SMILES: O=C(C1=CN(CC)C2=C(C=C(F)C(N3CCN(C)CC3)=C2)C1=O)O.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ioversol, CAS:87771-40-2, Molecular Weight: 807.1113, C18H24I3N3O9, Purity:98, SMILES: O=C(C1=C(I)C(N(C(CO)=O)CCO)=C(I)C(C(NCC(O)CO)=O)=C1I)NCC(O)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
4,4'-Di-tert-butyl-2,2'-bipyridine, CAS:72914-19-3, Molecular Weight: 268.3966, C18H24N2, Purity:95, SMILES: CC(c1ccnc(c1)c1nccc(c1)C(C)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-tert-butyl-2-(4-tert-butylpyridin-2-yl)pyridine, CAS:72914-19-3, Molecular Weight: 268.3966, C18H24N2, Purity:95, SMILES: CC(C)(C)C1=CC(=NC=C1)C1=NC=CC(=C1)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(1H-indol-3-yl)piperidine-1-carboxylate, CAS:155302-28-6, Molecular Weight: 300.3954, C18H24N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C1=CNC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(1H-Indol-3-yl)piperidine-1-carboxylate, CAS:155302-28-6, Molecular Weight: 300.3954, C18H24N2O2, Purity:95, SMILES: O=C(N1CCC(CC1)c1c[nH]c2c1cccc2)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-Benzyl-1-oxo-2,5-diaza-spiro[3.4]octane-5-carboxylic acid tert-butyl, CAS:1206970-01-5, Molecular Weight: 316.3948, C18H24N2O3, Purity:93, SMILES: O=C(N1CCCC21CN(C2=O)Cc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
6-Oxo-9-Phenyl-2,7-Diaza-Spiro[4.4]Nonane-2-Carboxylic Acid Tert-Butyl Ester, CAS:1290627-02-9, Molecular Weight: 316.3948, C18H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)C(CNC2=O)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rcemic-(5S,9S-Tert-Butyl 2-Oxo-9-Phenyl-1,7-Diazaspiro[4.4]Nonane-7-Carboxylate, CAS:1251003-15-2, Molecular Weight: 316.3948, C18H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H](C2=CC=CC=C2)[C@@]2(CCC(=O)N2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 1-Oxo-2,3-Dihydro-1H-Spiro[Isoquinoline-4,4'-Piperidine]-1'-Carboxylate, CAS:1032143-15-9, Molecular Weight: 316.3948, C18H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CNC(=O)C1=C2C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2'-Oxo-2',3'-Dihydro-1'H-Spiro[Piperidine-4,4'-Quinoline]-1-Carboxylate, CAS:1032143-13-7, Molecular Weight: 316.3948, C18H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CC(=O)NC1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2'-Oxo-2',4'-Dihydro-1'H-Spiro[Piperidine-4,3'-Quinoline]-1-Carboxylate, CAS:769106-43-6, Molecular Weight: 316.3948, C18H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CC1=C(NC2=O)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3-Oxo-1-Phenyl-2,7-Diazaspiro[3.5]Nonane-7-Carboxylate, CAS:1013033-83-4, Molecular Weight: 316.3948, C18H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(NC2=O)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 4-(2-Oxoindolin-3-YlPiperidine-1-Carboxylate, CAS:228111-39-5, Molecular Weight: 316.3948, C18H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C1C(=O)NC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Oxo-4-Phenyl-2,7-Diazaspiro[4.4]Nonane-2-Carboxylate, CAS:1341034-79-4, Molecular Weight: 316.3948, C18H24N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC(C2=CC=CC=C2)C2(CCNC2=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Oxo-7-[(1S-1-Phenylethyl]-4,7-Diazabicyclo[3.2.0]Heptane-4-Carboxylate, CAS:1133325-57-1, Molecular Weight: 316.3948, C18H24N2O3, Purity:95, SMILES: C[C@H](N1C2CCN(C2C1=O)C(=O)OC(C)(C)C)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
K145, CAS:1309444-75-4, Molecular Weight: 348.4597, C18H24N2O3S, Purity:98, SMILES: O=C(N(CCN)C/1=O)SC1=C/CCC2=CC=C(OCCCC)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cis-3-Benzyl6-Tert-Butyl3,6-Diazabicyclo[3.2.0]Heptane-3,6-Dicarboxylate, CAS:848593-18-0, Molecular Weight: 332.3942, C18H24N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2CN(C[C@H]12)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2-Oxo-2,3-Dihydro-1H-Spiro[Benzo[E][1,4]Oxazepine-5,4'-Piperidine]-1'-Carboxylate, CAS:1251001-25-8, Molecular Weight: 332.3942, C18H24N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)OCC(=O)NC1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl N-[(4-cyanophenyl)methyl]-N-[(2-methylpropan-2-yl)oxycarbonyl]carbamate, CAS:172348-74-2, Molecular Weight: 332.3942, C18H24N2O4, Purity:99, SMILES: O=C(OC(C)(C)C)N(C(OC(C)(C)C)=O)CC1=CC=C(C#N)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cis-5-Benzyl 1-Tert-Butyl Tetrahydro-1H-Pyrrolo[3,4-C]Isoxazole-1,5(3H-Dicarboxylate, CAS:1250993-12-4, Molecular Weight: 348.3936, C18H24N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1OC[C@H]2CN(C[C@@H]12)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R)-4-((benzyloxy)carbonyl)-1-(tert-butoxycarbonyl)piperazine-2-carboxylic acid, CAS:138775-02-7, Molecular Weight: 364.393, C18H24N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(C[C@@H]1C(O)=O)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Meptyldinocap, CAS:131-72-6, Molecular Weight: 364.393, C18H24N2O6, Purity:98, SMILES: C/C=C/C(OC1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1C(C)CCCCCC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-1-Boc-N-4-Cbz-2-Piperazine Carboxylic Acid, CAS:149057-19-2, Molecular Weight: 364.393, C18H24N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC1C(O)=O)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tyrphostin AG 879, CAS:148741-30-4, Molecular Weight: 316.461, C18H24N2OS, Purity:98, SMILES: S=C(N)/C(C#N)=C/C1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Granisetron, CAS:109889-09-0, Molecular Weight: 312.4094, C18H24N4O, Purity:98, SMILES: CN1N=C(C(N[C@H]2C[C@H](N3C)CCC[C@H]3C2)=O)C4=CC=CC=C41, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-METHYL-4-(2-PROPOXY-BENZOYLAMINO)-5-PROPYL-2H-PYRAZOLE-3-CARBOXYLIC ACID AMIDE, CAS:139756-04-0, Molecular Weight: 344.4082, C18H24N4O3, Purity:95, SMILES: CCCOC1=CC=CC=C1C(=O)NC1=C(N(C)N=C1CCC)C(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PSN632408, CAS:857652-30-3, Molecular Weight: 360.4076, C18H24N4O4, Purity:98, SMILES: O=C(OC(C)(C)C)N1CCC(CC1)OCC2=NC(C3=CC=NC=C3)=NO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pexacerfont, CAS:459856-18-9, Molecular Weight: 340.4228, C18H24N6O, Purity:98, SMILES: CC[C@H](NC1=NC(C)=NC2=C(C3=CC=C(OC)N=C3C)C(C)=NN21)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
PRT-060318, CAS:1194961-19-7, Molecular Weight: 340.4228, C18H24N6O, Purity:98, SMILES: O=C(C1=CN=C(N[C@H]2[C@@H](N)CCCC2)N=C1NC3=CC=CC(C)=C3)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
RWJ-445167, CAS:226566-43-4, Molecular Weight: 436.4854, C18H24N6O5S, Purity:98, SMILES: O=C(NCCONC(N)=N)CN1C(C)=CC=C(NS(=O)(C2=CC=CC(C)=C2)=O)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
ABTS (diammonium salt), CAS:30931-67-0, Molecular Weight: 548.6797, C18H24N6O6S4, Purity:98, SMILES: CCN1C(C=CC(S(=O)([O-])=O)=C2)=C2S/C1=N/N=C(SC3=C4C=CC(S(=O)([O-])=O)=C3)\N4CC.[NH4+].[NH4+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Bakuchiol, CAS:10309-37-2, Molecular Weight: 256.3826, C18H24O, Purity:98, SMILES: OC1=CC=C(/C=C/[C@](C)(C=C)CC/C=C(C)\C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(+)-19-Norandrost-4-ene-3,17-dione, CAS:734-32-7, Molecular Weight: 272.382, C18H24O2, Purity:95, SMILES: C[C@]12CC[C@H]3[C@@H](CCC4=CC(=O)CC[C@H]34)[C@@H]1CCC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Estradiol, CAS:50-28-2, Molecular Weight: 272.382, C18H24O2, Purity:98, SMILES: C[C@@]1([C@H]2O)[C@](CC2)([H])[C@@](CCC3=C4C=CC(O)=C3)([H])[C@]4([H])CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Estriol, CAS:50-27-1, Molecular Weight: 288.3813, C18H24O3, Purity:98, SMILES: C[C@@]1([C@H]2O)[C@](C[C@H]2O)([H])[C@@](CCC3=C4C=CC(O)=C3)([H])[C@]4([H])CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
dibutyl 2-benzylidenemalonate, CAS:59832-50-7, Molecular Weight: 304.3808, C18H24O4, Purity:95, SMILES: CCCCOC(=O)C(=CC1=CC=CC=C1)C(=O)OCCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-(oxan-2-yl)-4-(tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-indazole, CAS:956388-05-9, Molecular Weight: 328.214, C18H25BN2O3, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cccc2c1cnn2C1CCCCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-(Tetrahydro-2H-pyran-2-yl)-1H-indazole-5-boronic acid pinacol ester, CAS:1082525-64-1, Molecular Weight: 328.214, C18H25BN2O3, Purity:90, SMILES: CC1(C)OB(OC1(C)C)c1ccc2c(c1)cnn2C1CCCCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl-1H-indazole-1-carboxylate, CAS:890839-29-9, Molecular Weight: 344.213, C18H25BN2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1N=CC2=C1C=C(C=C2)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ethyl 1-[4-(tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]cyclopropane-1-carboxylate, CAS:1257213-52-7, Molecular Weight: 316.2, C18H25BO4, Purity:95, SMILES: CCOC(=O)C1(CC1)c1ccc(cc1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3-Amino-7-Bromo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-58-4, Molecular Weight: 381.307, C18H25BrN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(N)C3=C2C(Br)=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefotiam (hydrochloride), CAS:66309-69-1, Molecular Weight: 598.55, C18H25Cl2N9O4S3, Purity:98, SMILES: O=C(C(N12)=C(CSC3=NN=NN3CCN(C)C)CS[C@]2([H])[C@H](NC(CC4=CSC(N)=N4)=O)C1=O)O.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
ALS-8176, CAS:1445385-02-3, Molecular Weight: 433.859, C18H25ClFN3O6, Purity:98, SMILES: ClC[C@@]1(COC(C(C)C)=O)[C@@H](OC(C(C)C)=O)[C@@H](F)[C@H](N2C(N=C(N)C=C2)=O)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
K145 (hydrochloride), CAS:1449240-68-9, Molecular Weight: 384.9207, C18H25ClN2O3S, Purity:98, SMILES: O=C(N(CCN)C/1=O)SC1=C/CCC2=CC=C(OCCCC)C=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Granisetron (Hydrochloride), CAS:107007-99-8, Molecular Weight: 348.8703, C18H25ClN4O, Purity:98, SMILES: CN1N=C(C(N[C@H]2C[C@H](N3C)CCC[C@H]3C2)=O)C4=CC=CC=C41.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 3,3-difluoro-5-methyl-4-(tosyloxy)piperidine-1-carboxylate, CAS:, Molecular Weight: 405.457, C18H25F2NO5S, Purity:95, SMILES: CC1CN(CC(C1OS(=O)(=O)c1ccc(cc1)C)(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bestatin (trifluoroacetate), CAS:223763-80-2, Molecular Weight: 422.3961096, C18H25F3N2O6, Purity:98, SMILES: FC(F)(C(O)=O)F.CC(C)C[C@@H](C(O)=O)NC([C@@H](O)[C@H](N)CC1=CC=CC=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Enazadrem, CAS:107361-33-1, Molecular Weight: 299.4106, C18H25N3O, Purity:98, SMILES: OC1=C(C)N=C(NCCCCCCC2=CC=CC=C2)N=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Saxagliptin, CAS:361442-04-8, Molecular Weight: 315.41, C18H25N3O2, Purity:98, SMILES: N#C[C@@H]1C[C@]2([H])[C@](C2)([H])N1C([C@H]([C@@]34C[C@@H]5C[C@H](C4)C[C@](C5)(O)C3)N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 3-cyano-3-((2,4-dimethoxybenzylaminoazetidine-1-carboxylate, CAS:0, Molecular Weight: 347.4088, C18H25N3O4, Purity:95, SMILES: COC1=CC(OC)=C(CNC2(CN(C2)C(=O)OC(C)(C)C)C#N)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(2-(4-(hydroxymethyl)-1H-pyrazol-1-yl)pyridin-4-yl)piperazine-1-carboxylate, CAS:1449117-76-3, Molecular Weight: 359.4228, C18H25N5O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC1)C1=CC(=NC=C1)N1C=C(CO)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
MI-2, CAS:1271738-62-5, Molecular Weight: 375.5546, C18H25N5S2, Purity:98, SMILES: CCCC1=CC2=C(N3CCN(C4=NCC(C)(C)S4)CC3)N=CN=C2S1, HPLC, NMR, LCMS is ok, stock more than 10g. |
MI-3, CAS:1271738-59-0, Molecular Weight: 375.5546, C18H25N5S2, Purity:98, SMILES: CC(C)C1=CC2=C(N3CCN(C4=NCC(C)(C)S4)CC3)N=CN=C2S1, HPLC, NMR, LCMS is ok, stock more than 10g. |
RO9021, CAS:1446790-62-0, Molecular Weight: 355.4374, C18H25N7O, Purity:98, SMILES: NC(C1=C(NC2=CC=C(C)C(C)=N2)C=C(N[C@H]3[C@@H](N)CCCC3)N=N1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
LY 178002, CAS:107889-32-7, Molecular Weight: 319.4616, C18H25NO2S, Purity:98, SMILES: O=C1NCS/C1=C/C2=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Isobutyl 2-isobutoxyquinoline-1(2H)-carboxylate, CAS:38428-14-7, Molecular Weight: 303.396, C18H25NO3, Purity:97, SMILES: CC(C)COC1C=Cc2ccccc2N1C(=O)OCC(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3-Hydroxy-3-Phenyl-8-Azabicyclo[3.2.1]Octane-8-Carboxylate, CAS:1307254-47-2, Molecular Weight: 303.396, C18H25NO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C2CCC1CC(O)(C2)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 4-((4-Formylpiperidin-1-YlMethylBenzoate, CAS:1401966-71-9, Molecular Weight: 303.396, C18H25NO3, Purity:95, SMILES: CC(C)(C)OC(=O)C1=CC=C(CN2CCC(CC2)C=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(4-Methylbenzoyl)piperidine-1-carboxylate, CAS:912768-78-6, Molecular Weight: 303.396, C18H25NO3, Purity:95, SMILES: Cc1ccc(cc1)C(=O)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
kb-NB77-78, CAS:1350622-33-1, Molecular Weight: 331.4815, C18H25NO3Si, Purity:98, SMILES: O=C1OC2=CC=C(O[Si](C)(C(C)(C)C)C)C=C2C3=C1NCCC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-(tert-Butyloxycarbonyl)-3-benzylpiperidine-3-carboxylic acid, CAS:170838-83-2, Molecular Weight: 319.3954, C18H25NO4, Purity:99, SMILES: O=C(N1CCCC(C1)(Cc1ccccc1)C(=O)O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
1,3-Piperidinedicarboxylic acid, 3-(phenylmethyl)-, 1-(1,1-dimethylethyl) ester, (3R)-, CAS:339539-81-0, Molecular Weight: 319.3954, C18H25NO4, Purity:99, SMILES: CC(C)(C)OC(=O)N1CCC[C@@](Cc2ccccc2)(C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-Cbz-2-Piperidinecarboxylic acid t-butyl ester, CAS:71170-89-3, Molecular Weight: 319.3954, C18H25NO4, Purity:95, SMILES: O=C(C1CCCCN1C(=O)OCc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Estradiol 3-sulfamate, CAS:172377-52-5, Molecular Weight: 351.4604, C18H25NO4S, Purity:98, SMILES: C[C@@]1([C@H]2O)[C@](CC2)([H])[C@@](CCC3=C4C=CC(OS(N)(=O)=O)=C3)([H])[C@]4([H])CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4,7-Bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2,1,3-benzothiadiazole, CAS:934365-16-9, Molecular Weight: 388.097, C18H26B2N2O4S, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1ccc(c2c1nsn2)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2,3,6-tetrahydropyridine, CAS:1048976-83-5, Molecular Weight: 299.216, C18H26BNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CCN(CC1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-benzyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2,3,6-tetrahydropyridine, CAS:1313738-80-5, Molecular Weight: 299.216, C18H26BNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CCCN(CC2=CC=CC=C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)-1-tosyl-1,2,3,6-tetrahydropyridine, CAS:1256360-46-9, Molecular Weight: 363.279, C18H26BNO4S, Purity:97, SMILES: Cc1ccc(cc1)S(=O)(=O)N1CCC(=CC1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4,7-DIBROMO-5,6-BIS(HEXYLOXY)BENZO[C][1,2,5]THIADIAZOLE, CAS:1190978-94-9, Molecular Weight: 494.284, C18H26Br2N2O2S, Purity:95, SMILES: CCCCCCOC1=C(Br)C2=NSN=C2C(Br)=C1OCCCCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dextromethorphan (hydrobromide), CAS:125-69-9, Molecular Weight: 352.3091, C18H26BrNO, Purity:98, SMILES: COC1=CC([C@](CCN2C)(CCCC3)[C@@]3([H])[C@]2([H])C4)=C4C=C1.Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tans-tert-butyl (2-((4-bromobenzyloxycyclohexylcarbamate, CAS:0, Molecular Weight: 384.308, C18H26BrNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H]1CCCC[C@H]1OCC1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Prucalopride, CAS:179474-81-8, Molecular Weight: 367.8703, C18H26ClN3O3, Purity:98, SMILES: ClC1=C(N)C(CCO2)=C2C(C(NC3CCN(CCCOC)CC3)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl ((1S,2S-2-((3-ChlorobenzylOxyCyclohexylCarbamate, CAS:0, Molecular Weight: 339.857, C18H26ClNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@H]1CCCC[C@@H]1OCC1=CC(Cl)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Trans-tert-butyl (2-((3-chlorobenzyloxycyclohexylcarbamate, CAS:0, Molecular Weight: 339.857, C18H26ClNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@H]1CCCC[C@@H]1OCC1=CC(Cl)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
R-7128, CAS:940908-79-2, Molecular Weight: 399.4139, C18H26FN3O6, Purity:98, SMILES: O=C1N=C(C=CN1[C@@H]([C@@](C)([C@@H]2OC(C(C)C)=O)F)O[C@@H]2COC(C(C)C)=O)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl ((1R,2R-2-((2-FluorobenzylOxyCyclohexylCarbamate, CAS:0, Molecular Weight: 323.4023, C18H26FNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H]1CCCC[C@H]1OCC1=CC=CC=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl ((1R,2R-2-((3-FluorobenzylOxyCyclohexylCarbamate, CAS:0, Molecular Weight: 323.4023, C18H26FNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H]1CCCC[C@H]1OCC1=CC(F)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Racemic-(4R,5S-Tert-Butyl 4-Phenyl-2,7-Diazaspiro[4.4]Nonane-2-Carboxylate, CAS:1330766-05-6, Molecular Weight: 302.4112, C18H26N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H](C2=CC=CC=C2)[C@]2(CCNC2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2',4'-Dihydro-1'H-Spiro[Piperidine-4,3'-Quinoline]-1-Carboxylate, CAS:1160247-77-7, Molecular Weight: 302.4112, C18H26N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CNC1=C(C2)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3,4-Dihydro-2H-Spiro[Isoquinoline-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-65-3, Molecular Weight: 302.4112, C18H26N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)NCCC1=CC=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(2,3-dihydro-1H-indol-1-yl)piperidine-1-carboxylate, CAS:400828-91-3, Molecular Weight: 302.4112, C18H26N2O2, Purity:95, SMILES: O=C(N1CCC(CC1)N1CCc2c1cccc2)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(indolin-1-yl)piperidine-1-carboxylate, CAS:400828-91-3, Molecular Weight: 302.4112, C18H26N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)N1CCC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Benzyl-2,5-Diazabicyclo[2.2.2]Octane-2-Carboxylate, CAS:0, Molecular Weight: 302.4112, C18H26N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CCC1CN2CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 5-Methylspiro[Indoline-3,4'-Piperidine]-1-Carboxylate, CAS:878376-82-0, Molecular Weight: 302.4112, C18H26N2O2, Purity:95, SMILES: CC1=CC=C2N(CC3(CCNCC3)C2=C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cis-Tert-Butyl 4-Benzylhexahydropyrrolo[3,4-B][1,4]Oxazine-6(2H-Carboxylate, CAS:138027-01-7, Molecular Weight: 318.4106, C18H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2OCCN(CC3=CC=CC=C3)[C@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl (1-benzoyl-4-methylpiperidin-4-yl)carbamate, CAS:1262787-56-3, Molecular Weight: 318.4106, C18H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)NC1(C)CCN(CC1)C(=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 4-Aminospiro[Chroman-2,4'-Piperidine]-1'-Carboxylate, CAS:1160247-73-3, Molecular Weight: 318.4106, C18H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CC(N)C1=CC=CC=C1O2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Trans-Tert-Butyl 4-Benzylhexahydropyrrolo[3,4-B][1,4]Oxazine-6(2H-Carboxylate, CAS:0, Molecular Weight: 318.4106, C18H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2OCCN(CC3=CC=CC=C3)[C@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R-Benzyl 3-((Tert-ButoxycarbonylAminoPiperidine-1-Carboxylate, CAS:485820-12-0, Molecular Weight: 334.41, C18H26N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H]1CCCN(C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzyl-4-(Boc-amino)piperidine-4-carboxylic acid, CAS:150435-81-7, Molecular Weight: 334.41, C18H26N2O4, Purity:97, SMILES: O=C(NC1(CCN(CC1)Cc1ccccc1)C(=O)O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
benzyl 3-(tert-butoxycarbonylamino)piperidine-1-carboxylate, CAS:406213-47-6, Molecular Weight: 334.41, C18H26N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)NC1CCCN(C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl 3-(tert-butoxycarbonylamino)piperidine-1-carboxylate, CAS:406213-47-6, Molecular Weight: 334.41, C18H26N2O4, Purity:95, SMILES: O=C(OC(C)(C)C)NC1CCCN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cbz-Leu-Abu-OH, CAS:144249-05-8, Molecular Weight: 350.4094, C18H26N2O5, Purity:95, SMILES: CCC(NC(=O)[C@H](CC(C)C)NC(=O)OCc1ccccc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3,5-Dihydro-2H-Spiro[Benzo[B][1,4,5]Oxathiazocine-4,4'-Piperidine]-1'-Carboxylate 1,1-Dioxide, CAS:1251004-16-6, Molecular Weight: 382.474, C18H26N2O5S, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CNS(=O)(=O)C1=C(OC2)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetraethyl 2,2'-bipyridine-4,4'-bisphosphonate, CAS:174397-53-6, Molecular Weight: 428.3564, C18H26N2O6P2, Purity:95, SMILES: CCOP(=O)(c1ccnc(c1)c1nccc(c1)P(=O)(OCC)OCC)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
GV-58, CAS:1402821-41-3, Molecular Weight: 374.5036, C18H26N6OS, Purity:98, SMILES: CC[C@@H](NC1=NC(NCC2=CC=C(C)S2)=C3N=CN(CCC)C3=N1)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
β-Apo-13-carotenone, CAS:17974-57-1, Molecular Weight: 258.39844, C18H26O, Purity:98, SMILES: CC(/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Octinoxate, CAS:5466-77-3, Molecular Weight: 290.3972, C18H26O3, Purity:98, SMILES: O=C(OCC(CC)CCCC)/C=C/C1=CC=C(OC)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(3,5-Dihydroxy-2-octanoyl-phenyl)-acetic acid ethyl ester, CAS:321661-62-5, Molecular Weight: 322.396, C18H26O5, Purity:95, SMILES: CCCCCCCC(=O)C1=C(O)C=C(O)C=C1CC(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cytosporone B, CAS:321661-62-5, Molecular Weight: 322.396, C18H26O5, Purity:98, SMILES: O=C(OCC)CC1=CC(O)=CC(O)=C1C(CCCCCCC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S,3S,4aS,5R,8S,8aR-5-(Benzyloxy-2,3-Dimethoxy-2,3-Dimethylhexahydro-2H-Pyrano[3,4-B][1,4]Dioxin-8-Ol, CAS:1084896-38-7, Molecular Weight: 354.3948, C18H26O7, Purity:95, SMILES: CO[C@@]1(C)O[C@@H]2[C@@H](O)CO[C@@H](OCC3=CC=CC=C3)[C@H]2O[C@]1(C)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
ETHYL 1-(4-(4,4,5,5-TETRAMETHYL-1,3,2-DIOXABOROLAN-2-YL)PHENYL)CYCLOPROPANECARBOXYLATE, CAS:1257213-52-7, Molecular Weight: 334.215, C18H27BO5, Purity:95, SMILES: CCOC(=O)C1(CC1)C1=CC=C(C=C1)B(O)OC(C)(C)C(C)(C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl [2,4'-Bipiperidine]-1-Carboxylate Hydrochloride, CAS:0, Molecular Weight: 338.872, C18H27ClN2O2, Purity:95, SMILES: Cl.O=C(OCC1=CC=CC=C1)N1CCCCC1C1CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 4-chloro-1-[tris(propan-2-yl)silyl]-1H-pyrrolo[2,3-b]pyridine-5-carboxylate, CAS:685513-97-7, Molecular Weight: 366.958, C18H27ClN2O2Si, Purity:98, SMILES: COC(=O)c1cnc2c(c1Cl)ccn2[Si](C(C)C)(C(C)C)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cis-Tert-Butyl 4-Benzylhexahydropyrrolo[3,4-B][1,4]Oxazine-6(2H-Carboxylate Hydrochloride, CAS:0, Molecular Weight: 354.872, C18H27ClN2O3, Purity:95, SMILES: Cl.CC(C)(C)OC(=O)N1C[C@@H]2OCCN(CC3=CC=CC=C3)[C@@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 4-Aminospiro[Chroman-2,4'-Piperidine]-1'-Carboxylate Hydrochloride, CAS:1243481-60-8, Molecular Weight: 354.872, C18H27ClN2O3, Purity:95, SMILES: Cl.CC(C)(C)OC(=O)N1CCC2(CC1)CC(N)C1=CC=CC=C1O2, HPLC, NMR, LCMS is ok, stock more than 10g. |
(4-N-Boc-Amino-Piperidin-1-Yl-Phenyl-Acetic Acid Hydrochloride, CAS:0, Molecular Weight: 370.871, C18H27ClN2O4, Purity:95, SMILES: Cl.CC(C)(C)OC(=O)NC1CCN(CC1)C(C(O)=O)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
M2 ion channel blocker, CAS:1190215-03-2, Molecular Weight: 317.4259, C18H27N3O2, Purity:98, SMILES: O=C(OC)[C@H](CC1C=NC=N1)NCC2(C[C@H]3C4)C[C@H]4C[C@H](C3)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
YYA-021, CAS:144217-65-2, Molecular Weight: 317.4259, C18H27N3O2, Purity:98, SMILES: O=C(NC1=CC=C(C)C=C1)C(NC2CC(C)(C)NC(C)(C)C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Saxagliptin (hydrate), CAS:945667-22-1, Molecular Weight: 333.4253, C18H27N3O3, Purity:98, SMILES: N[C@@H]([C@@]1(C[C@H]2C3)C[C@@]3(O)C[C@H](C2)C1)C(N([C@@H](C4)C#N)[C@@H]5[C@H]4C5)=O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
CEP dipeptide 1, CAS:816432-15-2, Molecular Weight: 381.4235, C18H27N3O6, Purity:98, SMILES: O=C(O)CCC1=CC=CN1CCCC[C@H](NC(CNC(C)=O)=O)C(OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sumatriptan (succinate), CAS:103628-48-4, Molecular Weight: 413.4885, C18H27N3O6S, Purity:98, SMILES: O=C(O)CCC(O)=O.O=S(CC1=CC2=C(NC=C2CCN(C)C)C=C1)(NC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Leucomethylene blue (Mesylate), CAS:1236208-20-0, Molecular Weight: 477.6185, C18H27N3O6S3, Purity:98, SMILES: CN(C)C1=CC(SC2=CC(N(C)C)=CC=C2N3)=C3C=C1.CS(=O)(O)=O.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(3-methyl-4,5-dihydro-1H-pyrazol-4-yl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indole, CAS:, Molecular Weight: 329.512, C18H27N3OSi, Purity:95, SMILES: CC1=NNCC1C2=CC=CC3=C2C=CN3COCC[Si](C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
INS37217, CAS:318250-11-2, Molecular Weight: 865.28200512, C18H27N5Na4O21P4, Purity:98, SMILES: O[C@H]1[C@H](N2C(NC(C=C2)=O)=O)O[C@H](COP(OP(OP(OP(OC[C@H]3O[C@@H](N4C(N=C(N)C=C4)=O)C[C@@H]3O)(O)=O)(O)=O)(O)=O)(O)=O)[C@H]1O.[4Na], HPLC, NMR, LCMS is ok, stock more than 10g. |
Capsaicin, CAS:404-86-4, Molecular Weight: 305.4119, C18H27NO3, Purity:98, SMILES: CC(C)/C=C/CCCCC(NCC1=CC=C(O)C(OC)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 4-((4-(HydroxymethylPiperidin-1-YlMethylBenzoate, CAS:1401966-70-8, Molecular Weight: 305.4119, C18H27NO3, Purity:95, SMILES: CC(C)(C)OC(=O)C1=CC=C(CN2CCC(CO)CC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2R,6S)-tert-butyl2-(benzyloxymethyl)-6-(hydroxymethyl)morpholine-4-carboxylate, CAS:, Molecular Weight: 337.4107, C18H27NO5, Purity:95, SMILES: O=C(N1C[C@H](COCC2=CC=CC=C2)O[C@H](CO)C1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-Tert-Butoxycarbonyl-4-(4-ToluenesulfonyloxymethylPiperidine, CAS:166815-96-9, Molecular Weight: 369.476, C18H27NO5S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OCC1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 3-hydroxy-4-((tosyloxymethylpiperidine-1-carboxylate, CAS:0, Molecular Weight: 385.475, C18H27NO6S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OCC1CCN(CC1O)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2-boronophenyl)boronic acid, CAS:269410-07-3, Molecular Weight: 330.035, C18H28B2O4, Purity:95, SMILES: OB(O)c1ccccc1B(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1,3-Phenyldiboronic acid, pinacol ester, CAS:196212-27-8, Molecular Weight: 330.035, C18H28B2O4, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cccc(c1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
1,4-Benzenediboronic acid bis(pinacol) ester, CAS:99770-93-1, Molecular Weight: 330.035, C18H28B2O4, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1ccc(cc1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dextromethorphan (hydrobromide hydrate), CAS:6700-34-1, Molecular Weight: 370.3244, C18H28BrNO2, Purity:98, SMILES: COC1=CC([C@](CCN2C)(CCCC3)[C@@]3([H])[C@]2([H])C4)=C4C=C1.O.Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
VU0357017 (hydrochloride), CAS:1135242-13-5, Molecular Weight: 369.8862, C18H28ClN3O3, Purity:98, SMILES: O=C(N1CCC(NCCNC(C2=CC=CC=C2C)=O)CC1)OCC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Hydroxychloroquine sulfate, CAS:747-36-4, Molecular Weight: 433.95, C18H28ClN3O5S, Purity:95, SMILES: OS(O)(=O)=O.CCN(CCO)CCCC(C)NC1=C2C=CC(Cl)=CC2=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dyclonine (hydrochloride), CAS:536-43-6, Molecular Weight: 325.8734, C18H28ClNO2, Purity:98, SMILES: O=C(C1=CC=C(OCCCC)C=C1)CCN2CCCCC2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
ZD8321, CAS:182073-77-4, Molecular Weight: 423.4272296, C18H28F3N3O5, Purity:98, SMILES: COC(N[C@@H](C(C)C)C(N1[C@@H](CCC1)C(N[C@@H](C(C)C)C(C(F)(F)F)=O)=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pefloxacin (mesylate dihydrate), CAS:149676-40-4, Molecular Weight: 465.4936, C18H28FN3O8S, Purity:98, SMILES: O=C(C1=CN(CC)C2=C(C=C(F)C(N3CCN(C)CC3)=C2)C1=O)O.CS(=O)(O)=O.O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
SB-269970, CAS:201038-74-6, Molecular Weight: 352.4915, C18H28N2O3S, Purity:98, SMILES: OC1=CC=CC(S(=O)(N2[C@@H](CCN3CCC(C)CC3)CCC2)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R-methyl 2-(benzylamino-3-((tert-butoxycarbonylamino-3-methylbutanoate, CAS:0, Molecular Weight: 336.4259, C18H28N2O4, Purity:95, SMILES: COC(=O)[C@H](NCC1=CC=CC=C1)C(C)(C)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Enalaprilat (dihydrate), CAS:84680-54-6, Molecular Weight: 384.4241, C18H28N2O7, Purity:98, SMILES: O=C(O)[C@H]1N(C([C@H](C)N[C@H](C(O)=O)CCC2=CC=CC=C2)=O)CCC1.O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rivastigmine (tartrate), CAS:129101-54-8, Molecular Weight: 400.4235, C18H28N2O8, Purity:98, SMILES: O=C(OC1=CC=CC([C@@H](N(C)C)C)=C1)N(CC)C.O=C(O)[C@H](O)[C@@H](O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dimemorfan (phosphate), CAS:36304-84-4, Molecular Weight: 353.392982, C18H28NO4P, Purity:98, SMILES: O=P(O)(O)O.CN1[C@](CC2=CC=C(C)C=C32)([H])[C@](CCCC4)([H])[C@]34CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
12-phenyldodecanoic acid, CAS:14507-27-8, Molecular Weight: 276.4137, C18H28O2, Purity:95, SMILES: OC(=O)CCCCCCCCCCCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
12-Phenyldodecanoic acid, CAS:14507-27-8, Molecular Weight: 276.4137, C18H28O2, Purity:95, SMILES: OC(=O)CCCCCCCCCCCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl 3-(3,5-di-tert-butyl-4-hydroxyphenyl)propanoate, CAS:6386-38-5, Molecular Weight: 292.4131, C18H28O3, Purity:98, SMILES: COC(=O)CCc1cc(c(O)c(c1)C(C)(C)C)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(4-Ethylpiperazin-1-yl)phenylboronic acid pinacol ester, CAS:656257-45-3, Molecular Weight: 316.246, C18H29BN2O2, Purity:95, SMILES: CCN1CCN(CC1)c1ccc(cc1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bupivacaine (hydrochloride), CAS:18010-40-7, Molecular Weight: 324.8887, C18H29ClN2O, Purity:98, SMILES: O=C(C1N(CCCC)CCCC1)NC2=C(C)C=CC=C2C.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Levobupivacaine (hydrochloride), CAS:27262-48-2, Molecular Weight: 324.8887, C18H29ClN2O, Purity:98, SMILES: O=C([C@H]1N(CCCC)CCCC1)NC2=C(C)C=CC=C2C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
SB-269970 (hydrochloride), CAS:261901-57-9, Molecular Weight: 388.9525, C18H29ClN2O3S, Purity:98, SMILES: OC1=CC=CC(S(=O)(N2[C@@H](CCN3CCC(C)CC3)CCC2)=O)=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Acebutolol (hydrochloride), CAS:34381-68-5, Molecular Weight: 372.8869, C18H29ClN2O4, Purity:98, SMILES: CCCC(NC1=CC=C(OCC(O)CNC(C)C)C(C(C)=O)=C1)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
H-Lys(Z)-OtBu.HCl, CAS:5978-22-3, Molecular Weight: 372.887, C18H29ClN2O4, Purity:97, SMILES: Cl.CC(C)(C)OC(=O)[C@@H](N)CCCCNC(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-((Tert-ButyldimethylsilylOxy-N-(4-ChlorophenylPiperidine-1-Carbothioamide, CAS:0, Molecular Weight: 385.039, C18H29ClN2OSSi, Purity:95, SMILES: CC(C)(C)[Si](C)(C)OC1CCN(CC1)C(=S)NC1=CC=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diethyl 2,2'-(1-(tert-butoxycarbonyl)-4,4-difluoropiperidine-3,5-diyl)diacetate, CAS:, Molecular Weight: 393.4228, C18H29F2NO6, Purity:95, SMILES: CCOC(=O)CC1CN(CC(C1(F)F)CC(=O)OCC)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Unable to generate chemical name, CAS:128625-52-5, Molecular Weight: 521.4004, C18H29F6N6OP2, Purity:95, SMILES: F[P+](F)(F)(F)(F)F.C1CCN(C1)P(On1nnc2ccccc12)(N1CCCC1)N1CCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bambuterol, CAS:81732-65-2, Molecular Weight: 367.44, C18H29N3O5, Purity:98, SMILES: OC(C1=CC(OC(N(C)C)=O)=CC(OC(N(C)C)=O)=C1)CNC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
CA-074, CAS:134448-10-5, Molecular Weight: 383.43936, C18H29N3O6, Purity:98, SMILES: O=C(N1[C@@H](CCC1)C(O)=O)[C@@]([C@@H](C)CC)([H])NC([C@@H]2[C@@H](C(NCCC)=O)O2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Val-cit-PAB-OH, CAS:159857-79-1, Molecular Weight: 379.4539, C18H29N5O4, Purity:98, SMILES: N[C@@H](C(C)C)C(N[C@@H](CCCNC(N)=O)C(NC1=CC=C(CO)C=C1)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ketocaine, CAS:1092-46-2, Molecular Weight: 291.42836, C18H29NO2, Purity:98, SMILES: CCCC(C1=CC=CC=C1OCCN(C(C)C)C(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Penbutolol (sulfate), CAS:38363-32-5, Molecular Weight: 340.47, C18H29NO2 . 1/2 H2O4S, Purity:98, SMILES: O[C@@H](CNC(C)(C)C)COC1=CC=CC=C1C2CCCC2.[0.5H2SO4], HPLC, NMR, LCMS is ok, stock more than 10g. |
Betaxolol, CAS:63659-18-7, Molecular Weight: 307.4278, C18H29NO3, Purity:98, SMILES: OC(CNC(C)C)COC1=CC=C(CCOCC2CC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Guaiapate, CAS:852-42-6, Molecular Weight: 323.42716, C18H29NO4, Purity:98, SMILES: COC1=CC=CC=C1OCCOCCOCCN2CCCCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bambuterol (hydrochloride), CAS:81732-46-9, Molecular Weight: 403.9009, C18H30ClN3O5, Purity:98, SMILES: OC(C1=CC(OC(N(C)C)=O)=CC(OC(N(C)C)=O)=C1)CNC(C)(C)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Betaxolol (hydrochloride), CAS:63659-19-8, Molecular Weight: 343.8887, C18H30ClNO3, Purity:98, SMILES: OC(CNC(C)C)COC1=CC=C(CCOCC2CC2)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Levobetaxolol (hydrochloride), CAS:116209-55-3, Molecular Weight: 343.8887, C18H30ClNO3, Purity:98, SMILES: O[C@@H](CNC(C)C)COC1=CC=C(CCOCC2CC2)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
(±)-Sibutramine (methanesulfonate), CAS:676598-10-0, Molecular Weight: 375.9537, C18H30ClNO3S, Purity:98, SMILES: ClC1=CC=C(C2(C(N(C)C)CC(C)C)CCC2)C=C1.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cicloprolol (hydrochloride), CAS:63686-79-3, Molecular Weight: 359.8881, C18H30ClNO4, Purity:98, SMILES: OC(CNC(C)C)COC1=CC=C(OCCOCC2CC2)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Butacaine, CAS:149-16-6, Molecular Weight: 306.443, C18H30N2O2, Purity:98, SMILES: CCCCN(CCCOC(C1=CC=C(N)C=C1)=O)CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,5,8,11,14-pentaoxahexadecan-16-yl 4-methylbenzenesulfonate, CAS:80755-67-5, Molecular Weight: 406.491, C18H30O8S, Purity:95, SMILES: COCCOCCOCCOCCOCCOS(=O)(=O)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Gadobutrol, CAS:770691-21-9, Molecular Weight: 604.7101, C18H31GdN4O9, Purity:98, SMILES: OCC1[N]2(CC[N]3(C4)CC[N]5(C6)CC[N]7(C8)CC2)[Gd+3]357([O-]C4=O)([O-]C8=O)([O-]C6=O)O([H])C1CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,4,6-Tri-tert-butylaniline, , CAS:961-38-6, Molecular Weight: 261.4454, C18H31N, Purity:95, SMILES: CC(C)(C)C1=CC(=C(N)C(=C1)C(C)(C)C)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rapastinel, CAS:117928-94-6, Molecular Weight: 413.4686, C18H31N5O6, Purity:98, SMILES: O=C(N(CCC1)[C@@H]1C(N[C@H](C(N)=O)[C@H](O)C)=O)[C@H](CCC2)N2C([C@@H](N)[C@H](O)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(3S,5S)-1-benzyl-3-(tert-butyldimethylsilyloxy)-5-hydroxymethylpyrrolidine, CAS:635299-82-0, Molecular Weight: 321.5297, C18H31NO2Si, Purity:97, SMILES: CC(C)(C)[Si](C)(C)O[C@H]1C[C@@H](CO)N(Cc2ccccc2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-benzyl-5-((tert-butyldimethylsilyl)oxy)piperidin-3-ol, CAS:2070014-70-7, Molecular Weight: 321.5297, C18H31NO2Si, Purity:95, SMILES: CC(C)(C)[Si](C)(C)OC1CC(O)CN(Cc2ccccc2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-SUCCINIMIDYL MYRISTATE, CAS:69888-86-4, Molecular Weight: 325.443, C18H31NO4, Purity:95, SMILES: CCCCCCCCCCCCCC(=O)ON1C(=O)CCC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(E-Tert-Butyl 4-(2-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-YlVinylPiperidine-1-Carboxylate, CAS:1160924-51-5, Molecular Weight: 337.262, C18H32BNO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)\C=C\B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 3,3-dimethyl-4-(tetramethyl-1,3,2-dioxaborolan-2-yl)-1,2,3,6-tetrahydropyridine-1-carboxylate, CAS:1228962-22-8, Molecular Weight: 337.262, C18H32BNO4, Purity:95, SMILES: O=C(N1CC=C(C(C1)(C)C)B1OC(C(O1)(C)C)(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Chloroquine (diphosphate), CAS:50-63-5, Molecular Weight: 515.862504, C18H32ClN3O8P2, Purity:98, SMILES: O=P(O)(O)O.O=P(O)(O)O.CC(NC1=CC=NC2=CC(Cl)=CC=C12)CCCN(CC)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Di-Tert-Butyl 2,8-Diazaspiro[4.5]Decane-2,8-Dicarboxylate, CAS:0, Molecular Weight: 340.4577, C18H32N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)CCN(CC2)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
D-(+)-Melezitose, CAS:597-12-6, Molecular Weight: 504.43708, C18H32O16, Purity:98, SMILES: OC[C@@]1([C@H]([C@H](O)[C@@H](CO)O1)O[C@@]2([H])O[C@@H]([C@@H](O)[C@H](O)[C@H]2O)CO)O[C@H]3O[C@@H]([C@@H](O)[C@H](O)[C@H]3O)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
D-(+)-Raffinose (pentahydrate), CAS:17629-30-0, Molecular Weight: 504.4371, C18H32O16, Purity:95, SMILES: OC[C@H]1O[C@@](CO)(O[C@H]2O[C@H](CO[C@H]3O[C@H](CO)[C@H](O)[C@H](O)[C@H]3O)[C@@H](O)[C@H](O)[C@H]2O)[C@@H](O)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Manninotriose, CAS:13382-86-0, Molecular Weight: 504.4371, C18H32O16, Purity:98, SMILES: O[C@@H]([C@@H](O)[C@H](O)[C@@H](O)C=O)CO[C@H]([C@@H]([C@@H](O)[C@H]1O)O)O[C@@H]1CO[C@H]([C@@H]([C@@H](O)[C@H]2O)O)O[C@@H]2CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
α-Hydroxylinoleic acid, CAS:57818-44-7, Molecular Weight: 296.44488, C18H32O3, Purity:98, SMILES: CCCCC/C=C\C/C=C\CCCCCCC(O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-Tetradecylthiophene , CAS:110851-66-6, Molecular Weight: 280.512, C18H32S, Purity:95, SMILES: CCCCCCCCCCCCCCC1=CSC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tricyclohexylphosphonium tetrafluoroborate, CAS:58656-04-5, Molecular Weight: 368.241, C18H34BF4P, Purity:98, SMILES: F[B-](F)(F)F.C1CCC(CC1)[PH+](C1CCCCC1)C1CCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Clindamycin (hydrochloride), CAS:21462-39-5, Molecular Weight: 461.444, C18H34Cl2N2O5S, Purity:98, SMILES: C[C@H](Cl)[C@@]([C@@]([C@@H]([C@H](O)[C@H]1O)O)([H])O[C@@H]1SC)([H])NC([C@@H]2C[C@@H](CCC)CN2C)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Clindamycin (phosphate), CAS:24729-96-2, Molecular Weight: 504.9629, C18H34ClN2O8PS, Purity:98, SMILES: CCC[C@H]1CN(C)[C@H](C(N[C@@]([H])([C@@]2([H])O[C@H](SC)[C@H](OP(O)(O)=O)[C@@H](O)[C@H]2O)[C@@H](Cl)C)=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
McN3716, CAS:69207-52-9, Molecular Weight: 298.46076, C18H34O3, Purity:98, SMILES: O=C(C1(CCCCCCCCCCCCCC)OC1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Octadecanedioic acid, CAS:871-70-5, Molecular Weight: 314.4602, C18H34O4, Purity:95, SMILES: OC(=O)CCCCCCCCCCCCCCCCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Lincomycin (hydrochloride), CAS:859-18-7, Molecular Weight: 442.9983, C18H35ClN2O6S, Purity:98, SMILES: C[C@@H](O)[C@@]([C@@]([C@@H]([C@H](O)[C@H]1O)O)([H])O[C@@H]1SC)([H])NC([C@@H]2C[C@@H](CCC)CN2C)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Kryptofix 222, CAS:23978-09-8, Molecular Weight: 376.4882, C18H36N2O6, Purity:95, SMILES: C1COCCN2CCOCCOCCN(CCO1)CCOCCOCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Octadecanal, CAS:638-66-4, Molecular Weight: 268.4778, C18H36O, Purity:95, SMILES: CCCCCCCCCCCCCCCCCC=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl Heptadecanoate, CAS:1731-92-6, Molecular Weight: 284.4772, C18H36O2, Purity:95, SMILES: CCCCCCCCCCCCCCCCC(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Lincomycin (hydrochloride hydrate), CAS:7179-49-9, Molecular Weight: 461.0136, C18H37ClN2O7S, Purity:98, SMILES: C[C@@H](O)[C@](NC([C@H]1N(C)C[C@H](CCC)C1)=O)([H])[C@@]2([H])O[C@H](SC)[C@H](O)[C@@H](O)[C@H]2O.Cl.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bekanamycin, CAS:4696-76-8, Molecular Weight: 483.5139, C18H37N5O10, Purity:98, SMILES: O[C@H]1[C@](O[C@H]2[C@H](N)C[C@H](N)[C@@H](O[C@@]3([H])O[C@H](CN)[C@@H](O)[C@H](O)[C@H]3N)[C@@H]2O)([H])O[C@H](CO)[C@@H](O)[C@@H]1N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tobramycin, CAS:32986-56-4, Molecular Weight: 467.5145, C18H37N5O9, Purity:98, SMILES: O[C@@H]([C@@H]1O[C@@]([C@@H](C[C@@H]2O)N)([H])O[C@@H]2CN)[C@H]([C@@H](C[C@@H]1N)N)O[C@@]([C@@H]([C@@H](N)[C@@H]3O)O)([H])O[C@@H]3CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-dodecyl-2,6-dimethylmorpholine, CAS:1704-28-5, Molecular Weight: 283.4925, C18H37NO, Purity:95, SMILES: CCCCCCCCCCCCN1CC(C)OC(C)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Palmitoylethanolamide, CAS:544-31-0, Molecular Weight: 299.4919, C18H37NO2, Purity:95, SMILES: CCCCCCCCCCCCCCCC(=O)NCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Kanamycin (sulfate), CAS:25389-94-0, Molecular Weight: 582.57712, C18H38N4O15S, Purity:98, SMILES: OS(O)(=O)=O.O[C@H]1[C@](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H](O[C@@]3([H])O[C@H](CO)[C@@H](O)[C@H](N)[C@H]3O)[C@H]2O)([H])O[C@H](CN)[C@@H](O)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Kanamycin A sulfate, CAS:25389-94-0, Molecular Weight: 582.577, C18H38N4O15S, Purity:98, SMILES: OS(O)(=O)=O.NC[C@H]1O[C@H](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H](O[C@H]3O[C@H](CO)[C@@H](O)[C@H](N)[C@H]3O)[C@H]2O)[C@H](O)[C@@H](O)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Octadecanol, CAS:112-92-5, Molecular Weight: 270.4937, C18H38O, Purity:95, SMILES: CCCCCCCCCCCCCCCCCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Hypromellose, CAS:9004-65-3, Molecular Weight: 478.4859, C18H38O14, Purity:98, SMILES: OC[C@H]1O[C@@H](O[C@H]2C(O)[C@@H](O)[C@H](OC)O[C@@H]2CO)[C@H](O)C(O)[C@@H]1OC.CO.CC(O)CO.[n], HPLC, NMR, LCMS is ok, stock more than 10g. |
(3R,4S,5R,6R)-3,4,5-tris((trimethylsilyl)oxy)-6-(((trimethylsilyl)oxy)methyl)tetrahydro-2H-pyran-2-one, CAS:32384-65-9, Molecular Weight: 466.8645, C18H42O6Si4, Purity:98, SMILES: C[Si](C)(C)OC[C@H]1OC(=O)[C@H](O[Si](C)(C)C)[C@@H](O[Si](C)(C)C)[C@@H]1O[Si](C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,2',2'',2'''-(1,4,8,11-tetraazacyclotetradecane-1,4,8,11-tetrayl)tetraacetic acid tetrahydrochloride tetrahydrate, CAS:314041-07-1, Molecular Weight: 650.374, C18H44Cl4N4O12, Purity:95, SMILES: O.O.O.O.Cl.Cl.Cl.Cl.OC(=O)CN1CCCN(CC(O)=O)CCN(CC(O)=O)CCCN(CC(O)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
β-Amyloid (1-40), CAS:131438-79-4, Molecular Weight: 4329.82, C194H295N53O58S, Purity:98, SMILES: [DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV], HPLC, NMR, LCMS is ok, stock more than 10g. |
STO-609, CAS:52029-86-4, Molecular Weight: 314.2943, C19H10N2O3, Purity:98, SMILES: O=C(C1=C2C3=C(C4=NC5=CC=CC=C5N4C(C3=CC=C2)=O)C=C1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rafoxanide, CAS:22662-39-1, Molecular Weight: 626.0105, C19H11Cl2I2NO3, Purity:98, SMILES: O=C(NC1=CC=C(OC2=CC=C(Cl)C=C2)C(Cl)=C1)C3=CC(I)=CC(I)=C3O, HPLC, NMR, LCMS is ok, stock more than 10g. |
CX-4945 (sodium salt), CAS:1309357-15-0, Molecular Weight: 371.7523, C19H11ClN3NaO2, Purity:98, SMILES: O=C(C1=CC=C2C3=C(C(NC4=CC=CC(Cl)=C4)=NC2=C1)C=CN=C3)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Cyantraniliprole D3, CAS:, Molecular Weight: 476.728945334, C19H11D3BrClN6O2, Purity:98, SMILES: CC1=CC(C#N)=CC(C(NC([2H])([2H])[2H])=O)=C1NC(C2=CC(Br)=NN2C3=C(Cl)C=CC=N3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
KIN1148, CAS:1428729-56-9, Molecular Weight: 361.44014, C19H11N3OS2, Purity:98, SMILES: O=C(NC1=NC2=CC=C3C(N=CS3)=C2S1)C4=CC5=C(C=C4)C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
SB 216763, CAS:280744-09-4, Molecular Weight: 371.2168, C19H12Cl2N2O2, Purity:98, SMILES: O=C(NC1=O)C(C2=CC=C(C=C2Cl)Cl)=C1C3=CN(C4=C3C=CC=C4)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
CX-4945, CAS:1009820-21-6, Molecular Weight: 349.7705, C19H12ClN3O2, Purity:98, SMILES: O=C(C1=CC=C2C3=C(C(NC4=CC=CC(Cl)=C4)=NC2=C1)C=CN=C3)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
BTB06584, CAS:219793-45-0, Molecular Weight: 417.8197, C19H12ClNO6S, Purity:98, SMILES: ClC1=CC=C(C(OC2=C([N+]([O-])=O)C=CC(S(C3=CC=CC=C3)(=O)=O)=C2)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
VX-702, CAS:745833-23-2, Molecular Weight: 404.3178, C19H12F4N4O2, Purity:98, SMILES: O=C(N)C1=CC=C(N=C1C2=CC=C(C=C2F)F)N(C3=C(C=CC=C3F)F)C(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
AMZ30, CAS:1313613-09-0, Molecular Weight: 461.4435, C19H12FN3O6S2, Purity:98, SMILES: O=S(C1=CC([N+]([O-])=O)=CC=C1)(N2C(/C=C(S(=O)(C3=CC=C(F)C=C3)=O)\C#N)=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
FICZ, CAS:172922-91-7, Molecular Weight: 284.3114, C19H12N2O, Purity:98, SMILES: O=CC1=C2C(NC3=C2C=CC=C3)=CC4=C1NC5=C4C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-Phenyl-9H-Fluoren-9-One, CAS:3096-49-9, Molecular Weight: 256.298, C19H12O, Purity:95, SMILES: O=C1C2=CC=CC=C2C2=C1C=C(C=C2)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diacerein, CAS:13739-02-1, Molecular Weight: 368.2938, C19H12O8, Purity:98, SMILES: O=C(C(C=C1C2=O)=CC(OC(C)=O)=C1C(C3=C2C=CC=C3OC(C)=O)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
9-Bromo-9-phenyl-9H-fluorene, CAS:55135-66-5, Molecular Weight: 321.211, C19H13Br, Purity:98, SMILES: BrC1(c2ccccc2-c2ccccc12)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(4-Bromophenyl)-1-phenylbenzimidazole, CAS:2620-76-0, Molecular Weight: 349.224, C19H13BrN2, Purity:97, SMILES: Brc1ccc(cc1)c1nc2c(n1c1ccccc1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
CTEP, CAS:871362-31-1, Molecular Weight: 391.7742, C19H13ClF3N3O, Purity:98, SMILES: FC(F)(F)OC1=CC=C(N2C(C)=C(C#CC3=CC(Cl)=NC=C3)N=C2C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
INT, CAS:146-68-9, Molecular Weight: 505.69629, C19H13ClIN5O2, Purity:98, SMILES: IC1=CC=C(N2N=C(C3=CC=CC=C3)N=[N+]2C4=CC=C([N+]([O-])=O)C=C4)C=C1.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Antifungal agent 1, CAS:1265166-14-0, Molecular Weight: 352.77112, C19H13ClN2O3, Purity:98, SMILES: O=C(C=C1NC2=CC=C(Cl)C=C2)C(N(C)C3=C4C=C(O)C=C3)=C4C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Praziquantel D11, CAS:1246343-36-1, Molecular Weight: 323.4738, C19H13D11N2O2, Purity:98, SMILES: O=C1N2CCC3=C(C=CC=C3)C2CN(C(C4([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C4([2H])[2H])=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
JNJ-38877605, CAS:943540-75-8, Molecular Weight: 377.3502, C19H13F2N7, Purity:98, SMILES: FC(F)(C1=NN=C2C=CC(C3=CN(C)N=C3)=NN21)C4=CC5=C(N=CC=C5)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
AM-2099, CAS:1443373-17-8, Molecular Weight: 466.4567, C19H13F3N4O3S2, Purity:98, SMILES: COC1=CC(C(F)(F)F)=CC=C1C2=NC=NC3=CC(S(=O)(NC4=NC=CS4)=O)=CC=C32, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,6-bis(1H-benzo[d]imidazol-2-yl)pyridine, CAS:28020-73-7, Molecular Weight: 311.34, C19H13N5, Purity:95, SMILES: c1cc(nc(c1)-c1nc2ccccc2[nH]1)-c1nc2ccccc2[nH]1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Phenol Red (sodium salt), CAS:34487-61-1, Molecular Weight: 376.3583, C19H13NaO5S, Purity:98, SMILES: O=S1(OC(C2=CC=C([O-])C=C2)(C3=CC=C(O)C=C3)C4=CC=CC=C41)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
NQDI-1, CAS:175026-96-7, Molecular Weight: 319.3108, C19H13NO4, Purity:98, SMILES: O=C(C1=C2C3=C(NC1=O)C=CC=C3C(C4=C2C=CC=C4)=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cyantraniliprole, CAS:736994-63-1, Molecular Weight: 473.7104, C19H14BrClN6O2, Purity:98, SMILES: O=C(C1=CC(Br)=NN1C2=NC=CC=C2Cl)NC3=C(C(NC)=O)C=C(C#N)C=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
NITD609, CAS:1193314-23-6, Molecular Weight: 390.2384, C19H14Cl2FN3O, Purity:98, SMILES: FC1=C(Cl)C=C(NC2=C3C[C@H](C)N[C@@]2(C4=C(C=CC(Cl)=C4)N5)C5=O)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Vismodegib, CAS:879085-55-9, Molecular Weight: 421.2971, C19H14Cl2N2O3S, Purity:98, SMILES: O=C(C1=CC=C(C=C1Cl)S(=O)(C)=O)NC2=CC=C(C(C3=NC=CC=C3)=C2)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
A 839977, CAS:870061-27-1, Molecular Weight: 413.2601, C19H14Cl2N6O, Purity:98, SMILES: ClC1=C(Cl)C(N2N=NN=C2NCC3=CC=CC=C3OC4=NC=CC=C4)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
8-CHLORO-2-(2-(QUINOLIN-2-YL)ETHYL)PHTHALAZIN-1(2H)-ONE, CAS:1433204-04-6, Molecular Weight: 335.787, C19H14ClN3O, Purity:95, SMILES: Clc1cccc2cnn(CCc3ccc4ccccc4n3)c(=O)c12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Coptisine (chloride), CAS:6020-18-4, Molecular Weight: 355.7718, C19H14ClNO4, Purity:98, SMILES: C1(C(CC[N+]2=C1C=C(C=C3)C(C4=C3OCO4)=C2)=C5)=CC6=C5OCO6.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
BMN-673, CAS:1207456-01-6, Molecular Weight: 380.3509, C19H14F2N6O, Purity:98, SMILES: O=C1NN=C2C3=C1C=C(F)C=C3N[C@H](C4=CC=C(F)C=C4)[C@H]2C5=NC=NN5C, HPLC, NMR, LCMS is ok, stock more than 10g. |
BMN-673 (8R,9S), CAS:1207456-00-5, Molecular Weight: 380.3509, C19H14F2N6O, Purity:98, SMILES: O=C1NN=C2C3=C1C=C(F)C=C3N[C@@H](C4=CC=C(F)C=C4)[C@@H]2C5=NC=NN5C, HPLC, NMR, LCMS is ok, stock more than 10g. |
GLPG0492, CAS:1215085-92-9, Molecular Weight: 389.328, C19H14F3N3O3, Purity:98, SMILES: N#CC1=CC=C(N(C(N(C)[C@]2(CO)C3=CC=CC=C3)=O)C2=O)C=C1C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
GLPG0492 (R enantiomer), CAS:1215085-93-0, Molecular Weight: 389.328, C19H14F3N3O3, Purity:98, SMILES: N#CC1=CC=C(N(C(N(C)[C@]2(C3=CC=CC=C3)CO)=O)C2=O)C=C1C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
T56-LIMKi, CAS:924473-59-6, Molecular Weight: 389.328, C19H14F3N3O3, Purity:98, SMILES: O=C(C1=CC(C)=NO1)NC2=CC=CC(C(NC3=CC=CC(C(F)(F)F)=C3)=O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
EAI045, CAS:1942114-09-1, Molecular Weight: 383.3961, C19H14FN3O3S, Purity:98, SMILES: O=C(C(C1=C(O)C=CC(F)=C1)N2C(C(C=CC=C3)=C3C2)=O)NC4=NC=CS4, HPLC, NMR, LCMS is ok, stock more than 10g. |
TUG-770, CAS:1402601-82-4, Molecular Weight: 307.3183632, C19H14FNO2, Purity:98, SMILES: FC1=C(CCC(O)=O)C=CC(C#CC2=C(CC#N)C=CC=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tideglusib, CAS:865854-05-3, Molecular Weight: 334.3917, C19H14N2O2S, Purity:98, SMILES: O=C(N(SC1=O)C2=C3C=CC=CC3=CC=C2)N1CC4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
RG108, CAS:48208-26-0, Molecular Weight: 334.32546, C19H14N2O4, Purity:98, SMILES: O=C(N1[C@H](C(O)=O)CC2=CNC3=C2C=CC=C3)C4=CC=CC=C4C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ubiquitin Isopeptidase Inhibitor I, G5, CAS:108477-18-5, Molecular Weight: 414.3887, C19H14N2O7S, Purity:98, SMILES: O=C(/C(C1)=C/C2=CC=C([N+]([O-])=O)C=C2)/C(CS1(=O)=O)=C/C3=CC=C([N+]([O-])=O)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Coptisine, CAS:3486-66-6, Molecular Weight: 320.3182, C19H14NO4+, Purity:98, SMILES: C1(C(CC[N+]2=C1C=C(C=C3)C(C4=C3OCO4)=C2)=C5)=CC6=C5OCO6, HPLC, NMR, LCMS is ok, stock more than 10g. |
GlyH-101, CAS:328541-79-3, Molecular Weight: 493.1487, C19H15Br2N3O3, Purity:98, SMILES: O=C(N/N=C/C1=CC(Br)=C(O)C(Br)=C1O)CNC2=CC3=CC=CC=C3C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-[[5-Bromo-2-[[(2,4-dichlorophenyl)methyl]oxy]phenyl]methyl]-5-methyl-1H-pyrazole-3-carboxylic acid, CAS:851204-35-8, Molecular Weight: 470.144, C19H15BrCl2N2O3, Purity:98, SMILES: O=C(C1=NN(CC2=CC(Br)=CC=C2OCC3=CC=C(Cl)C=C3Cl)C(C)=C1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
WQ 2743, CAS:189280-13-5, Molecular Weight: 498.2533096, C19H15BrF3N5O3, Purity:98, SMILES: O=C(C1=CN(C2=NC(N)=C(F)C=C2F)C3=C(C=C(F)C(N4CC(NC)C4)=C3Br)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(chloromethanetriyl)tribenzene, CAS:76-83-5, Molecular Weight: 278.775, C19H15Cl, Purity:95, SMILES: ClC(c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
BMS-303141, CAS:943962-47-8, Molecular Weight: 424.2977, C19H15Cl2NO4S, Purity:98, SMILES: O=S(C1=CC(Cl)=CC(Cl)=C1O)(NC2=CC(C3=CC=CC=C3)=CC=C2OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Phosphinic acid, P-[1-(5-chlorobenzo[b]thien-3-yl)-2-[[(1E)-2-(3,4-difluorophenyl)ethenyl]amino]-2-oxoethyl]-P-methyl-, CAS:936366-22-2, Molecular Weight: 441.8158684, C19H15ClF2NO3PS, Purity:98, SMILES: O=P(C)(C(C1=CSC2=CC=C(Cl)C=C21)C(N/C=C/C3=CC=C(F)C(F)=C3)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rebamipide, CAS:90098-04-7, Molecular Weight: 370.7864, C19H15ClN2O4, Purity:98, SMILES: OC(C(NC(C1=CC=C(Cl)C=C1)=O)CC(C2=CC=CC=C2N3)=CC3=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,3,5-Triphenyl-2H-tetrazolium chloride, CAS:298-96-4, Molecular Weight: 334.802, C19H15ClN4, Purity:95, SMILES: c1ccc(cc1)c1nn[n+](n1c1ccccc1)c1ccccc1.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetrazolium Red, CAS:298-96-4, Molecular Weight: 334.8022, C19H15ClN4, Purity:98, SMILES: C1(C2=CC=CC=C2)=NN(C3=CC=CC=C3)[N+](C4=CC=CC=C4)=N1.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
MLN120B, CAS:783348-36-7, Molecular Weight: 366.801, C19H15ClN4O2, Purity:98, SMILES: O=C(C1=CC=CN=C1C)NC2=C(OC)C(Cl)=CC3=C2NC4=C3C=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
TBA-354, CAS:1257426-19-9, Molecular Weight: 436.3414, C19H15F3N4O5, Purity:98, SMILES: FC(F)(F)OC1=CC=C(C2=CC=C(CO[C@H]3CN4C(OC3)=NC([N+]([O-])=O)=C4)C=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
6-amino-2-(1-(2-fluorobenzyl)-1H-pyrazolo[3,4-b]pyridin-3-yl)-7-methyl-7H-purin-8(9H)-one, CAS:, Molecular Weight: 390.3738, C19H15FN8O, Purity:95, SMILES: O=C1N(C)C2=C(N)N=C(C3=NN(CC4=CC=CC=C4F)C5=NC=CC=C53)N=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-METHOXY-4-(5-(PYRIDIN-4-YL)-1H-BENZO[D]IMIDAZOL-1-YL)PHENOL, CAS:1799434-47-1, Molecular Weight: 317.3413, C19H15N3O2, Purity:95, SMILES: COc1cc(ccc1O)-n1cnc2cc(ccc12)-c1ccncc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-METHOXY-5-(5-(PYRIDIN-4-YL)-1H-BENZO[D]IMIDAZOL-1-YL)PHENOL, CAS:1799439-07-8, Molecular Weight: 317.3413, C19H15N3O2, Purity:95, SMILES: COc1ccc(cc1O)-n1cnc2cc(ccc12)-c1ccncc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
CP21R7, CAS:125314-13-8, Molecular Weight: 317.3413, C19H15N3O2, Purity:98, SMILES: O=C1C(C2=CN(C)C3=CC=CC=C23)=C(C4=CC(N)=CC=C4)C(N1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Mcl1-IN-2, CAS:292057-76-2, Molecular Weight: 333.4069, C19H15N3OS, Purity:98, SMILES: OC1=C(N=CC=C2)C2=CC=C1C(NC3=CC=CC=N3)C4=CC=CS4, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-(N,N-Diphenylamino)benzaldehyde, CAS:833249, Molecular Weight: 273.3285, C19H15NO, Purity:98, SMILES: O=Cc1ccc(cc1)N(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ezutromid, CAS:945531-77-1, Molecular Weight: 337.3923, C19H15NO3S, Purity:98, SMILES: O=S(C1=CC=C(OC(C2=CC=C3C=CC=CC3=C2)=N4)C4=C1)(CC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PSB-12062, CAS:55476-47-6, Molecular Weight: 337.3923, C19H15NO3S, Purity:98, SMILES: O=S(N1C2=C(C=CC=C2)OC3=CC=CC=C13)(C4=CC=C(C)C=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-(9-Fluorenylmethoxycarbonyloxy)succinimide, CAS:82911-69-1, Molecular Weight: 337.3261, C19H15NO5, Purity:95, SMILES: O=C(OCC1c2ccccc2-c2ccccc12)ON1C(=O)CCC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Acenocoumarol, CAS:152-72-7, Molecular Weight: 353.3255, C19H15NO6, Purity:98, SMILES: O=C1C(C(C2=CC=C([N+]([O-])=O)C=C2)CC(C)=O)=C(O)C3=CC=CC=C3O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
SPB, CAS:858128-57-1, Molecular Weight: 385.3243, C19H15NO8, Purity:98, SMILES: O=C(ON1C(CCC1=O)=O)CCCOC2=C(O3)C(C=CC3=O)=CC4=C2OC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(Diphenylphosphino)benzoic acid, CAS:17261-28-8, Molecular Weight: 306.295, C19H15O2P, Purity:97, SMILES: OC(=O)c1ccccc1P(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3,3'-(2,7-dibromo-9H-fluorene-9,9-diyldipropanoic acid, CAS:0, Molecular Weight: 468.136, C19H16Br2O4, Purity:95, SMILES: OC(=O)CCC1(CCC(O)=O)C2=C(C=CC(Br)=C2)C2=C1C=C(Br)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
ZD-4190, CAS:413599-62-9, Molecular Weight: 459.2717432, C19H16BrFN6O2, Purity:98, SMILES: COC1=CC2=C(NC3=CC=C(Br)C=C3F)N=CN=C2C=C1OCCN4N=NC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-((5-(Benzyloxy-2-BromophenoxyMethylPyridine, CAS:0, Molecular Weight: 370.24, C19H16BrNO2, Purity:95, SMILES: BrC1=C(OCC2=CC=NC=C2)C=C(OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Flucloxacillin (sodium), CAS:1847-24-1, Molecular Weight: 475.85361248, C19H16ClFN3NaO5S, Purity:98, SMILES: [O-]C([C@@H]1N(C2=O)[C@]([C@@H]2NC(C(C(C(C(F)=CC=C3)=C3Cl)=NO4)=C4C)=O)([H])SC1(C)C)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
7-CHLORO-5-METHYL-2-(2-(QUINOLIN-2-YL)ETHYL)-2,3-DIHYDRO-1H-PYRROLO[3,4-C]PYRIDINE-1,6(5H)-DIONE, CAS:1628618-33-6, Molecular Weight: 353.802, C19H16ClN3O2, Purity:95, SMILES: O=C1N(CCc2ccc3c(n2)cccc3)Cc2c1c(Cl)c(=O)n(c2)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
N,N-dibenzyl-2-chloro-9H-purin-6-amine, CAS:496955-47-6, Molecular Weight: 349.817, C19H16ClN5, Purity:95, SMILES: ClC1=NC(N(CC2=CC=CC=C2)CC2=CC=CC=C2)=C2N=CNC2=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
VR23, CAS:1624602-30-7, Molecular Weight: 477.8782, C19H16ClN5O6S, Purity:98, SMILES: O=S(N1CCN(C2=CC=NC3=CC(Cl)=CC=C23)CC1)(C4=CC=C([N+]([O-])=O)C=C4[N+]([O-])=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
A-803467, CAS:944261-79-4, Molecular Weight: 357.7876, C19H16ClNO4, Purity:98, SMILES: O=C(C1=CC=C(C2=CC=C(Cl)C=C2)O1)NC3=CC(OC)=CC(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Indomethacin, CAS:53-86-1, Molecular Weight: 357.78764, C19H16ClNO4, Purity:98, SMILES: COC1=CC=C(N(C(C2=CC=C(Cl)C=C2)=O)C(C)=C3CC(O)=O)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
GPR120 modulator 1, CAS:1050506-75-6, Molecular Weight: 389.8526, C19H16ClNO4S, Purity:98, SMILES: O=C(O)COC1=CC=C(OCC2=NC(C3=CC=CC=C3Cl)=CS2)C=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
A7132, CAS:100490-21-9, Molecular Weight: 386.3521464, C19H16F2N4O3, Purity:98, SMILES: O=C(C1=CN(C2=CC=C(F)C=C2)C3=C(C=C(F)C(N4CCNCC4)=N3)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
BMS 433796, CAS:935525-13-6, Molecular Weight: 402.3515, C19H16F2N4O4, Purity:98, SMILES: O=C(N(C)N=CC1=C2C=CC=C1)[C@H]2NC(NC([C@@H](O)C3=CC(F)=CC(F)=C3)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Vericiguat, CAS:1350653-20-1, Molecular Weight: 426.3795, C19H16F2N8O2, Purity:98, SMILES: O=C(OC)NC1=C(N)N=C(C2=NN(CC3=CC=CC=C3F)C4=NC=C(F)C=C42)N=C1N, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-4,4,4-trifluorobutanoic acid, CAS:181128-48-3, Molecular Weight: 379.3298, C19H16F3NO4, Purity:95, SMILES: OC(=O)[C@H](CC(F)(F)F)NC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
CFMTI, CAS:864864-17-5, Molecular Weight: 349.3616, C19H16FN5O, Purity:98, SMILES: O=C1N(C2CC2)CC3=C1C=CC(C4=C(C)N(C5=CC=CN=C5F)N=N4)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK180736A, CAS:817194-38-0, Molecular Weight: 365.3611, C19H16FN5O2, Purity:98, SMILES: CC(N1)=C(C(NC2=CC=C(NN=C3)C3=C2)=O)C(C4=CC=C(F)C=C4)NC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1(2H)-Pyridinecarboxylic acid, 2-(4-fluorophenyl)-3,4-dihydro-4-oxo-, phenylmethyl ester, CAS:414910-19-3, Molecular Weight: 325.3336, C19H16FNO3, Purity:95, SMILES: Fc1ccc(cc1)C1CC(=O)C=CN1C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Lificiguat, CAS:170632-47-0, Molecular Weight: 304.3425, C19H16N2O2, Purity:98, SMILES: OCC1=CC=C(C2=NN(CC3=CC=CC=C3)C4=C2C=CC=C4)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ELR510444, CAS:1233948-35-0, Molecular Weight: 368.4725, C19H16N2O2S2, Purity:98, SMILES: O=S(C1=CC=C(C)C=C1)(NC2=CC(C3=CC=C(C#N)S3)=CC=C2C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PNU-74654, CAS:113906-27-7, Molecular Weight: 320.34194, C19H16N2O3, Purity:98, SMILES: O=C(N/N=C/C1=CC=C(C)O1)C2=CC=CC=C2OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
EL-102, CAS:1233948-61-2, Molecular Weight: 384.472, C19H16N2O3S2, Purity:98, SMILES: O=S(C1=CC=C(OC)C=C1)(NC2=CC(C3=CSC(C#N)=C3)=CC=C2C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
FG-4592, CAS:808118-40-3, Molecular Weight: 352.3407, C19H16N2O5, Purity:98, SMILES: O=C(O)CNC(C1=C(O)C2=C(C(C)=N1)C=C(OC3=CC=CC=C3)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
IOX2, CAS:931398-72-0, Molecular Weight: 352.3407, C19H16N2O5, Purity:98, SMILES: O=C(O)CNC(C1=C(O)C2=C(N(CC3=CC=CC=C3)C1=O)C=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PI-103, CAS:371935-74-9, Molecular Weight: 348.3553, C19H16N4O3, Purity:98, SMILES: OC1=CC(C2=NC3=C(C(N4CCOCC4)=N2)OC5=C3C=CC=N5)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ceftiofur (sodium), CAS:104010-37-9, Molecular Weight: 545.5444, C19H16N5NaO7S3, Purity:98, SMILES: [O-]C(C(N12)=C(CSC(C3=CC=CO3)=O)CS[C@]2([H])[C@H](NC(/C(C4=CSC(N)=N4)=N\OC)=O)C1=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Zibotentan, CAS:186497-07-4, Molecular Weight: 424.4331, C19H16N6O4S, Purity:98, SMILES: O=S(NC1=NC=C(C)N=C1OC)(C2=CC=CN=C2C3=CC=C(C4=NN=CO4)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PF-04217903, CAS:956905-27-4, Molecular Weight: 372.3833, C19H16N8O, Purity:98, SMILES: OCCN1N=CC(C2=NC3=C(N=C2)N=NN3CC4=CC5=CC=CN=C5C=C4)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Warfarin sodium(8% Isopropanol), CAS:129-06-6, Molecular Weight: 331.3177, C19H16NaO4, Purity:95, SMILES: [Na].CC(=O)CC(c1ccccc1)c1c(O)c2ccccc2oc1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bisdemethoxycurcumin, CAS:33171-05-0, Molecular Weight: 308.3279, C19H16O4, Purity:98, SMILES: OC1=CC=C(/C=C/C(CC(/C=C/C2=CC=C(O)C=C2)=O)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Warfarin, CAS:81-81-2, Molecular Weight: 308.3279, C19H16O4, Purity:98, SMILES: O=C1C(C(C2=CC=CC=C2)CC(C)=O)=C(O)C3=CC=CC=C3O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Efloxate, CAS:119-41-5, Molecular Weight: 324.3273, C19H16O5, Purity:98, SMILES: O=C(OCC)COC1=CC=C2C(C=C(C3=CC=CC=C3)OC2=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
MK-8245 (Trifluoroacetate), CAS:1415559-41-9, Molecular Weight: 581.2725, C19H17BrF4N6O6, Purity:98, SMILES: O=C(CN1N=C(N=N1)C2=CC(N3CCC(CC3)OC4=CC(F)=CC=C4Br)=NO2)O.FC(C(O)=O)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
KM11060, CAS:774549-97-2, Molecular Weight: 422.3282, C19H17Cl2N3O2S, Purity:98, SMILES: O=S(N1CCN(C2=CC=NC3=CC(Cl)=CC=C23)CC1)(C4=CC=C(Cl)C=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
MI 2 (MALT1 inhibitor), CAS:1047953-91-2, Molecular Weight: 455.7223, C19H17Cl3N4O3, Purity:98, SMILES: O=C(NC1=CC=C(N2N=C(OCCOC)N=C2C3=CC=C(Cl)C(Cl)=C3)C=C1)CCl, HPLC, NMR, LCMS is ok, stock more than 10g. |
MBX 102, CAS:24136-23-0, Molecular Weight: 415.7908, C19H17ClF3NO4, Purity:98, SMILES: O=C(OCCNC(C)=O)[C@@H](C1=CC=C(Cl)C=C1)OC2=CC=CC(C(F)(F)F)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
PRX-08066, CAS:866206-54-4, Molecular Weight: 401.8882, C19H17ClFN5S, Purity:98, SMILES: N#CC1=CC(CN2CCC(NC3=C(C=C(Cl)S4)C4=NC=N3)CC2)=CC=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Laquinimod, CAS:248281-84-7, Molecular Weight: 356.8029, C19H17ClN2O3, Purity:98, SMILES: O=C(C1=C(O)C2=C(N(C)C1=O)C=CC=C2Cl)N(CC)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
AZD1981, CAS:802904-66-1, Molecular Weight: 388.8679, C19H17ClN2O3S, Purity:98, SMILES: O=C(O)CN1C(C)=C(SC2=CC=C(Cl)C=C2)C3=C1C=CC=C3NC(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Glafenine, CAS:3820-67-5, Molecular Weight: 372.8023, C19H17ClN2O4, Purity:98, SMILES: O=C(OCC(O)CO)C1=CC=CC=C1NC2=CC=NC3=CC(Cl)=CC=C23, HPLC, NMR, LCMS is ok, stock more than 10g. |
Quizalofop-p-ethyl, CAS:100646-51-3, Molecular Weight: 372.8023, C19H17ClN2O4, Purity:98, SMILES: C[C@@H](OC1=CC=C(OC2=NC3=CC=C(Cl)C=C3N=C2)C=C1)C(OCC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
VER-50589, CAS:747413-08-7, Molecular Weight: 388.8017, C19H17ClN2O5, Purity:98, SMILES: O=C(C1=NOC(C2=CC(Cl)=C(O)C=C2O)=C1C3=CC=C(OC)C=C3)NCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
JQ-1 (carboxylic acid), CAS:202592-23-2, Molecular Weight: 400.8819, C19H17ClN4O2S, Purity:98, SMILES: ClC1=CC=C(C(C2=C(N3C4=NN=C3C)SC(C)=C2C)=N[C@H]4CC(O)=O)C=C1 , HPLC, NMR, LCMS is ok, stock more than 10g. |
PI-103 (Hydrochloride), CAS:371935-79-4, Molecular Weight: 384.8163, C19H17ClN4O3, Purity:98, SMILES: OC1=CC(C2=NC3=C(OC4=C3C=CC=N4)C(N5CCOCC5)=N2)=CC=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
ORM-15341, CAS:1297537-33-7, Molecular Weight: 396.8303, C19H17ClN6O2, Purity:98, SMILES: ClC1=C(C#N)C=CC(C2=NN(C[C@H](C)NC(C3=NNC(C(C)=O)=C3)=O)C=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cabotegravir, CAS:1051375-10-0, Molecular Weight: 405.3522, C19H17F2N3O5, Purity:98, SMILES: FC1=C(CNC(C2=CN3C(C(N([C@@H](C)CO4)[C@@]4([H])C3)=O)=C(O)C2=O)=O)C=CC(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fevipiprant, CAS:872365-14-5, Molecular Weight: 426.4095, C19H17F3N2O4S, Purity:98, SMILES: O=C(O)CC1=C(C)N(CC2=CC=C(S(=O)(C)=O)C=C2C(F)(F)F)C3=NC=CC=C31, HPLC, NMR, LCMS is ok, stock more than 10g. |
Enasidenib, CAS:1446502-11-9, Molecular Weight: 473.375, C19H17F6N7O, Purity:98, SMILES: CC(O)(C)CNC1=NC(C2=NC(C(F)(F)F)=CC=C2)=NC(NC3=CC(C(F)(F)F)=NC=C3)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nelociguat, CAS:625115-52-8, Molecular Weight: 408.3891, C19H17FN8O2, Purity:98, SMILES: O=C(OC)NC1=C(N)N=C(C2=NN(CC3=CC=CC=C3F)C4=NC=CC=C42)N=C1N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Triphenylmethanamine, CAS:5824-40-8, Molecular Weight: 259.345, C19H17N, Purity:95, SMILES: NC(c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Parecoxib (Sodium), CAS:198470-85-8, Molecular Weight: 392.4041, C19H17N2NaO4S, Purity:98, SMILES: CCC([N-]S(=O)(C1=CC=C(C2=C(C)ON=C2C3=CC=CC=C3)C=C1)=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Evodiamine, CAS:518-17-2, Molecular Weight: 303.3578, C19H17N3O, Purity:98, SMILES: O=C1C2=CC=CC=C2N(C)[C@](N1CC3)([H])C4=C3C5=CC=CC=C5N4, HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK'872, CAS:1346546-69-7, Molecular Weight: 383.48718, C19H17N3O2S2, Purity:98, SMILES: O=S(C1=CC=C2N=CC=C(NC3=CC=C(SC=N4)C4=C3)C2=C1)(C(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
LED209, CAS:245342-14-7, Molecular Weight: 383.4872, C19H17N3O2S2, Purity:98, SMILES: O=S(C1=CC=C(NC(NC2=CC=CC=C2)=S)C=C1)(NC3=CC=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
ML167, CAS:1285702-20-6, Molecular Weight: 335.3566, C19H17N3O3, Purity:98, SMILES: OCC1=CC=C(C2=CC3=C(NCC4=CC=C(C)O4)N=CN=C3C=C2)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
A-804598, CAS:1125758-85-1, Molecular Weight: 315.37178, C19H17N5, Purity:98, SMILES: C[C@@H](C1=CC=CC=C1)N/C(NC#N)=N\C2=CC=CC3=C2C=CC=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nafamostat, CAS:81525-10-2, Molecular Weight: 347.3706, C19H17N5O2, Purity:98, SMILES: O=C(OC1=CC=C2C=C(C(N)=N)C=CC2=C1)C3=CC=C(NC(N)=N)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
MLN1117, CAS:1268454-23-4, Molecular Weight: 363.37, C19H17N5O3, Purity:98, SMILES: O=C(C1=CN=C2C=CC(C3=CC=C(OC(N)=N4)C4=C3)=CN21)N5CCOCC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefamandole (nafate), CAS:42540-40-9, Molecular Weight: 512.4946, C19H17N6NaO6S2, Purity:98, SMILES: O=C(C(N12)=C(CSC3=NN=NN3C)CS[C@]2([H])[C@H](NC([C@H](OC=O)C4=CC=CC=C4)=O)C1=O)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
ETC-159, CAS:1638250-96-0, Molecular Weight: 391.3834, C19H17N7O3, Purity:98, SMILES: O=C(NC1=CC=C(C2=CC=CC=C2)N=N1)CN3C=NC4=C3C(N(C)C(N4C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefozopran, CAS:113359-04-9, Molecular Weight: 515.5256, C19H17N9O5S2, Purity:98, SMILES: [O-]C(C(N1[C@@]2([H])[C@H](NC(/C(C3=NSC(N)=N3)=N\OC)=O)C1=O)=C(CS2)C[N+]4=C(C=CC=N5)N5C=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tanshinone IIA sulfonate (sodium), CAS:69659-80-9, Molecular Weight: 396.39, C19H17NaO6S, Purity:98, SMILES: O=S(C1=C(C)C(C(C(C2=C3C=CC4=C2CCCC4(C)C)=O)=O)=C3O1)([O-])=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(4-Morpholino-8-Phenyl-4H-1-Benzopyran-4-One, CAS:154447-36-6, Molecular Weight: 307.3432, C19H17NO3, Purity:95, SMILES: O=C1C=C(OC2=C(C=CC=C12)C1=CC=CC=C1)N1CCOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
LY294002, CAS:154447-36-6, Molecular Weight: 307.3432, C19H17NO3, Purity:98, SMILES: O=C1C=C(OC2=C1C=CC=C2C3=CC=CC=C3)N4CCOCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
SF1670, CAS:345630-40-2, Molecular Weight: 307.3432, C19H17NO3, Purity:98, SMILES: CC(C)(C)C(NC(C=C1C2=O)=CC=C1C3=C(C2=O)C=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetrahydrocoptisine, CAS:4312-32-7, Molecular Weight: 323.3426, C19H17NO4, Purity:98, SMILES: C1(C(CCN2CC3=C4OCOC4=CC=C3CC21)=C5)=CC6=C5OCO6, HPLC, NMR, LCMS is ok, stock more than 10g. |
SF2523, CAS:1174428-47-7, Molecular Weight: 371.40698, C19H17NO5S, Purity:98, SMILES: O=C1C=C(N2CCOCC2)OC3=C1SC=C3C4=CC=C(OCCO5)C5=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Incyclinide, CAS:15866-90-7, Molecular Weight: 371.3408, C19H17NO7, Purity:98, SMILES: O=C(C(C1=O)=C(O)C[C@]2([H])C[C@]3([H])CC4=C(C(C3=C(O)[C@@]21O)=O)C(O)=CC=C4)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nedocromil, CAS:69049-73-6, Molecular Weight: 371.3408, C19H17NO7, Purity:98, SMILES: O=C(C1=CC(C2=CC3=C(N(CC)C(C(O)=O)=CC3=O)C(CCC)=C2O1)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tolnaftate, CAS:2398-96-1, Molecular Weight: 307.4094, C19H17NOS, Purity:98, SMILES: S=C(OC1=CC=C2C=CC=CC2=C1)N(C)C3=CC=CC(C)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
WP1130, CAS:856243-80-6, Molecular Weight: 384.2697, C19H18BrN3O, Purity:98, SMILES: BrC1=CC=CC(/C=C(C(N[C@H](C2=CC=CC=C2)CCC)=O)\C#N)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyltriphenylphosphonium bromide, CAS:1779-49-3, Molecular Weight: 357.224, C19H18BrP, Purity:95, SMILES: C[P+](c1ccccc1)(c1ccccc1)c1ccccc1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Glafenine (hydrochloride), CAS:65513-72-6, Molecular Weight: 409.26322, C19H18Cl2N2O4, Purity:98, SMILES: [H]Cl.O=C(OCC(O)CO)C1=CC=CC=C1NC2=CC=NC3=CC(Cl)=CC=C23, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dicloxacillin (Sodium hydrate), CAS:13412-64-1, Molecular Weight: 510.3235, C19H18Cl2N3NaO6S, Purity:98, SMILES: [O-]C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC(C3=C(C)ON=C3C4=C(Cl)C=CC=C4Cl)=O)N1C2=O)=O.[Na+].O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Butoconazole (nitrate), CAS:64872-77-1, Molecular Weight: 474.7885, C19H18Cl3N3O3S, Purity:98, SMILES: ClC1=C(SC(CCC2=CC=C(Cl)C=C2)CN3C=CN=C3)C(Cl)=CC=C1.O[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sitafloxacin, CAS:127254-12-0, Molecular Weight: 409.8143, C19H18ClF2N3O3, Purity:98, SMILES: O=C(C1=CN([C@H]2[C@@H](F)C2)C3=C(C=C(F)C(N(C[C@H]4N)CC54CC5)=C3Cl)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sitafloxacin (hydrate), CAS:163253-35-8, Molecular Weight: 409.8143, C19H18ClF2N3O3, Purity:98, SMILES: N[C@H]1C2(CC2)CN(C(C(Cl)=C3N([C@H]4[C@@H](F)C4)C=C(C(O)=O)C5=O)=C(C=C35)F)C1.[1.5 H2O], HPLC, NMR, LCMS is ok, stock more than 10g. |
AZD7545, CAS:252017-04-2, Molecular Weight: 478.8698, C19H18ClF3N2O5S, Purity:98, SMILES: O=C(N(C)C)C1=CC=C(S(=O)(C2=CC=C(NC([C@@](C)(O)C(F)(F)F)=O)C(Cl)=C2)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
VER-49009, CAS:558640-51-0, Molecular Weight: 387.8169, C19H18ClN3O4, Purity:98, SMILES: O=C(C1=NNC(C2=CC(Cl)=C(O)C=C2O)=C1C3=CC=C(OC)C=C3)NCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
5-R-Rivaroxaban, CAS:865479-71-6, Molecular Weight: 435.8813, C19H18ClN3O5S, Purity:98, SMILES: O=C(O[C@@H]1CNC(C2=CC=C(Cl)S2)=O)N(C1)C(C=C3)=CC=C3N4C(COCC4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rivaroxaban, CAS:366789-02-8, Molecular Weight: 435.8813, C19H18ClN3O5S, Purity:98, SMILES: O=C(N(C1=CC=C(N2C(COCC2)=O)C=C1)C3)O[C@H]3CNC(C4=CC=C(S4)Cl)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
CPI-203, CAS:1446144-04-2, Molecular Weight: 399.8971, C19H18ClN5OS, Purity:98, SMILES: ClC1=CC=C(C(C2=C(N3C4=NN=C3C)SC(C)=C2C)=N[C@H]4CC(N)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefozopran (hydrochloride), CAS:113981-44-5, Molecular Weight: 551.9865, C19H18ClN9O5S2, Purity:98, SMILES: [H]Cl.[O-]C(C(N1[C@@]2([H])[C@H](NC(/C(C3=NSC(N)=N3)=N\OC)=O)C1=O)=C(CS2)C[N+]4=C(C=CC=N5)N5C=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(±)-Methotrimeprazine (D6), CAS:1189805-51-3, Molecular Weight: 334.5086, C19H18D6N2OS, Purity:98, SMILES: #108vLT3vLw3vRpETcpWJhpETcpWJVzRh2LSvRpETcpWJhpETcpWJVzRh2LSvLw5 vrnmvLTmvLTmvrCbvrTmvLTmvRpPvRdsPUT5T4== , HPLC, NMR, LCMS is ok, stock more than 10g. |
SB-408124, CAS:288150-92-5, Molecular Weight: 356.3692, C19H18F2N4O, Purity:98, SMILES: O=C(NC1=CC(C)=NC2=C(C=C(C=C21)F)F)NC3=CC=C(C=C3)N(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Lasmiditan, CAS:439239-90-4, Molecular Weight: 377.3603, C19H18F3N3O2, Purity:98, SMILES: FC1=CC(F)=C(C(NC2=CC=CC(C(C3CCN(C)CC3)=O)=N2)=O)C(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Andarine, CAS:401900-40-1, Molecular Weight: 441.3579, C19H18F3N3O6, Purity:98, SMILES: O=C([C@@](O)(COC1=CC=C(C=C1)NC(C)=O)C)NC2=CC=C(C(C(F)(F)F)=C2)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rucaparib, CAS:283173-50-2, Molecular Weight: 323.3641, C19H18FN3O, Purity:98, SMILES: FC1=CC2=C3C(CCNC2=O)=C(C4=CC=C(CNC)C=C4)NC3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(Z-2-(4-fluorobenzylidene-4-methyl-3-oxo-N-phenylpentanamide, CAS:693793-71-4, Molecular Weight: 311.3501, C19H18FNO2, Purity:95, SMILES: CC(C)C(=O)C(=C\C1=CC=C(F)C=C1)\C(=O)NC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyltriphenylphosphonium iodide, CAS:2065-66-9, Molecular Weight: 404.2245, C19H18IP, Purity:95, SMILES: C[P+](c1ccccc1)(c1ccccc1)c1ccccc1.[I-], HPLC, NMR, LCMS is ok, stock more than 10g. |
LY 303511, CAS:154447-38-8, Molecular Weight: 306.3584, C19H18N2O2, Purity:98, SMILES: O=C1C=C(N2CCNCC2)OC3=C(C4=CC=CC=C4)C=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
Neuropathiazol, CAS:880090-88-0, Molecular Weight: 338.4234, C19H18N2O2S, Purity:98, SMILES: CN(C1=CC=C(C(OCC)=O)C=C1)C2=CSC(C3=CC=CC=C3)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
AG 555, CAS:133550-34-2, Molecular Weight: 322.3578, C19H18N2O3, Purity:98, SMILES: O=C(NCCCC1=CC=CC=C1)/C(C#N)=C/C2=CC=C(O)C(O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
MSDC 0160, CAS:146062-49-9, Molecular Weight: 370.4222, C19H18N2O4S, Purity:98, SMILES: O=C(N1)SC(CC2=CC=C(OCC(C3=NC=C(CC)C=C3)=O)C=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Parecoxib, CAS:198470-84-7, Molecular Weight: 370.4222, C19H18N2O4S, Purity:98, SMILES: CCC(NS(=O)(C1=CC=C(C2=C(C)ON=C2C3=CC=CC=C3)C=C1)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
GSK0660, CAS:1014691-61-2, Molecular Weight: 418.4866, C19H18N2O5S2, Purity:98, SMILES: O=C(C1=C(S(=O)(NC2=CC=C(NC3=CC=CC=C3)C=C2OC)=O)C=CS1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
INH6, CAS:1001753-24-7, Molecular Weight: 322.424, C19H18N2OS, Purity:98, SMILES: O=C(NC1=NC(C2=C(C)C=C(C)C=C2C)=CS1)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Oxacillin (sodium salt), CAS:1173-88-2, Molecular Weight: 423.4181, C19H18N3NaO5S, Purity:98, SMILES: [O-]C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC(C3=C(C)ON=C3C4=CC=CC=C4)=O)N1C2=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
HUHS015, CAS:1453097-13-6, Molecular Weight: 318.3724, C19H18N4O, Purity:98, SMILES: OC1=C(CC2=CC=CC=C2)C(C)=NN1C3=NC4=CC=C(C)C=C4N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
AZD1080, CAS:612487-72-6, Molecular Weight: 334.37182, C19H18N4O2, Purity:98, SMILES: OC(N1)=C(C2=CC=C(CN3CCOCC3)C=N2)C4=C1C=CC(C#N)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
GDC-0879, CAS:905281-76-7, Molecular Weight: 334.3718, C19H18N4O2, Purity:98, SMILES: O/N=C1C(C=CC(C2=CN(CCO)N=C2C3=CC=NC=C3)=C4)=C4CC/1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pimobendan, CAS:74150-27-9, Molecular Weight: 334.3718, C19H18N4O2, Purity:98, SMILES: O=C1CC(C)C(C2=CC=C3N=C(C4=CC=C(OC)C=C4)NC3=C2)=NN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ilaprazole, CAS:172152-36-2, Molecular Weight: 366.43682, C19H18N4O2S, Purity:98, SMILES: O=S(C1=NC2=CC=C(N3C=CC=C3)C=C2N1)CC4=NC=CC(OC)=C4C, HPLC, NMR, LCMS is ok, stock more than 10g. |
BML-284, CAS:853220-52-7, Molecular Weight: 350.3712, C19H18N4O3, Purity:98, SMILES: NC1=NC(C2=CC=CC(OC)=C2)=CC(NCC3=CC=C(OCO4)C4=C3)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
JK184, CAS:315703-52-7, Molecular Weight: 350.43742, C19H18N4OS, Purity:98, SMILES: CC1=C(C2=CSC(NC3=CC=C(OCC)C=C3)=N2)N4C=CC=CC4=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Isomangiferin, CAS:24699-16-9, Molecular Weight: 422.3396, C19H18O11, Purity:98, SMILES: OC1=CC(O)=C2C(OC3=CC(O)=C(O)C=C3C2=O)=C1[C@@H]([C@@H]([C@@H](O)[C@@H]4O)O)O[C@@H]4CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Mangiferin, CAS:4773-96-0, Molecular Weight: 422.3396, C19H18O11, Purity:98, SMILES: O[C@@H]([C@H](O)[C@@H](CO)O1)[C@@H](O)[C@@H]1C2=C(O)C3=C(C=C2O)OC4=CC(O)=C(O)C=C4C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tanshinone IIA, CAS:568-72-9, Molecular Weight: 294.3444, C19H18O3, Purity:98, SMILES: O=C(C1=C2C=CC3=C1CCCC3(C)C)C(C4=C2OC=C4C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
CB4091, CAS:3447-95-8, Molecular Weight: 358.34202, C19H18O7, Purity:98, SMILES: O=C(OC(C1=C(C)C2=CC(C3=CC(OC3)=O)=CC=C2O1)C)CCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bicyclol, CAS:118159-48-1, Molecular Weight: 390.3408, C19H18O9, Purity:98, SMILES: O=C(C1=CC(OC)=C(OCO2)C2=C1C3=C4OCOC4=C(OC)C=C3CO)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nafamostat (hydrochloride), CAS:80251-32-7, Molecular Weight: 420.2924, C19H19Cl2N5O2, Purity:98, SMILES: O=C(OC1=CC=C2C=C(C(N)=N)C=CC2=C1)C3=CC=C(NC(N)=N)C=C3.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
SB-408124 (Hydrochloride), CAS:1431697-90-3, Molecular Weight: 392.8302, C19H19ClF2N4O, Purity:98, SMILES: O=C(NC1=CC=C(C=C1)N(C)C)NC2=CC(C)=NC(C2=CC(F)=C3)=C3F.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
R1487 (Hydrochloride), CAS:449808-64-4, Molecular Weight: 424.829, C19H19ClF2N4O3, Purity:98, SMILES: O=C1C(OC2=CC=C(F)C=C2F)=CC3=CN=C(NC4CCOCC4)N=C3N1C.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Lasmiditan (hydrochloride), CAS:613677-28-4, Molecular Weight: 413.8213, C19H19ClF3N3O2, Purity:98, SMILES: O=C(NC1=NC(C(C2CCN(C)CC2)=O)=CC=C1)C3=C(F)C=C(F)C=C3F.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
PF-3274167, CAS:900510-03-4, Molecular Weight: 419.8372, C19H19ClFN5O3, Purity:98, SMILES: FC1=CC(Cl)=C(OC2CN(C3=NN=C(COC)N3C4=CC=C(OC)N=C4)C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Desloratadine, CAS:100643-71-8, Molecular Weight: 310.8206, C19H19ClN2, Purity:98, SMILES: ClC1=CC=C2C(CCC3=CC=CN=C3/C2=C4CCNCC/4)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
LY 303511 (hydrochloride), CAS:, Molecular Weight: 342.8194, C19H19ClN2O2, Purity:98, SMILES: O=C1C=C(N2CCNCC2)OC3=C(C4=CC=CC=C4)C=CC=C13.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cloxacillin (sodium monohydrate), CAS:7081-44-9, Molecular Weight: 475.8784, C19H19ClN3NaO6S, Purity:98, SMILES: [O-]C([C@@H]1N2[C@@](SC1(C)C)([H])[C@@H](C2=O)NC(C(C(C(C=CC=C3)=C3Cl)=NO4)=C4C)=O)=O.[Na+].O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pimobendan (hydrochloride), CAS:77469-98-8, Molecular Weight: 370.8328, C19H19ClN4O2, Purity:98, SMILES: O=C1CC(C)C(C2=CC=C3N=C(C4=CC=C(OC)C=C4)NC3=C2)=NN1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
ODM-201, CAS:1297538-32-9, Molecular Weight: 398.8462, C19H19ClN6O2, Purity:98, SMILES: ClC1=C(C#N)C=CC(C2=NN(C[C@H](C)NC(C3=NNC(C(O)C)=C3)=O)C=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
SNS-314, CAS:1146618-41-8, Molecular Weight: 527.04, C19H19ClN6O4S3, Purity:98, SMILES: O=C(NC1=CC=CC(Cl)=C1)NC2=NC=C(S2)CCNC3=C4C(C=CS4)=NC=N3.OS(C)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
6-beta-Naloxol (D5 hydrochloride), CAS:, Molecular Weight: 370.882, C19H19D5ClNO4, Purity:98, SMILES: O[C@@]12[C@]3([C@@H](O4)[C@H](O)CC2)C5=C4C(O)=CC=C5C[C@H]1N(C([2H])([2H])/C([2H])=C([2H])/[2H])CC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rotigotine (D7 Hydrochloride), CAS:, Molecular Weight: 358.977, C19H19D7ClNOS, Purity:98, SMILES: OC1=C(CC[C@H](N(C([2H])([2H])C([2H])([2H])C([2H])([2H])[2H])CCC2=CC=CS2)C3)C3=CC=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
HPGDS inhibitor 1, CAS:1033836-12-2, Molecular Weight: 381.3672728, C19H19F4N3O, Purity:98, SMILES: O=C(NC1CCN(CC(F)(F)F)CC1)C2=CC=C(C3=CC=CC(F)=C3)N=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Brivanib, CAS:649735-46-6, Molecular Weight: 370.3776, C19H19FN4O3, Purity:98, SMILES: FC1=C(OC2=NC=NN3C2=C(C(OC[C@H](O)C)=C3)C)C=CC4=C1C=C(C)N4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Setiptiline, CAS:57262-94-9, Molecular Weight: 261.3609, C19H19N, Purity:98, SMILES: CN1CC2=C(CC1)C3=CC=CC=C3CC4=C2C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Niraparib metabolite M1, CAS:1476777-06-6, Molecular Weight: 321.37306, C19H19N3O2, Purity:98, SMILES: O=C(C1=CC=CC2=CN(C3=CC=C([C@H]4CNCCC4)C=C3)N=C12)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PFI-3, CAS:, Molecular Weight: 321.373, C19H19N3O2, Purity:98, SMILES: OC1=C(C(/C=C/N2[C@H](C3)CN(C4=NC=CC=C4)[C@H]3C2)=O)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
SB-742457, CAS:607742-69-8, Molecular Weight: 353.438, C19H19N3O2S, Purity:98, SMILES: O=S(C1=CC=CC=C1)(C2=CC(C=CC=C3N4CCNCC4)=C3N=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
GBT 440, CAS:1446321-46-5, Molecular Weight: 337.3725, C19H19N3O3, Purity:98, SMILES: OC1=CC=CC(OCC2=C(C3=CC=NN3C(C)C)N=CC=C2)=C1C=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Talampanel, CAS:161832-65-1, Molecular Weight: 337.3725, C19H19N3O3, Purity:98, SMILES: C[C@@H]1CC2=C(C=C(OCO3)C3=C2)C(C4=CC=C(N)C=C4)=NN1C(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nilvadipine, CAS:75530-68-6, Molecular Weight: 385.37066, C19H19N3O6, Purity:98, SMILES: COC(C1=C(C#N)NC(C)=C(C(OC(C)C)=O)C1C2=CC([N+]([O-])=O)=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
E3 ligase Ligand-Linker Conjugates 15, CAS:, Molecular Weight: 417.36946, C19H19N3O8, Purity:98, SMILES: O=C(N(C(CCC1=O)C(N1)=O)C2=O)C(C2=CC=C3)=C3OCC(NCCCC(O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Naphthyl PP1, CAS:221243-82-9, Molecular Weight: 317.3877, C19H19N5, Purity:98, SMILES: CC(N1N=C(C2=C3C=CC=CC3=CC=C2)C4=C(N)N=CN=C41)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
CH-223191, CAS:301326-22-7, Molecular Weight: 333.3871, C19H19N5O, Purity:98, SMILES: O=C(C1=CC=NN1C)NC2=CC=C(/N=N/C3=CC=CC=C3C)C=C2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Disperse Blue 148, CAS:52239-04-0, Molecular Weight: 413.45026, C19H19N5O4S, Purity:98, SMILES: CCN(CCC(OC)=O)C1=CC=C(C=C1)N=NC2=C(C=C([N+]([O-])=O)C=C3)C3=NS2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Folic acid, CAS:59-30-3, Molecular Weight: 441.3975, C19H19N7O6, Purity:98, SMILES: O=C(O)CC[C@@H](C(O)=O)NC(C1=CC=C(NCC2=CN=C3N=C(N)NC(C3=N2)=O)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
ML-098, CAS:878978-76-8, Molecular Weight: 309.3591, C19H19NO3, Purity:98, SMILES: O=C(C1=CN(CCOC2=CC(C)=CC=C2C)C3=C1C=CC=C3)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fmoc-Aib-OH, CAS:94744-50-0, Molecular Weight: 325.3585, C19H19NO4, Purity:97, SMILES: CC(C)(NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fmoc-D-Abu-OH, CAS:170642-27-0, Molecular Weight: 325.3585, C19H19NO4, Purity:98, SMILES: CC[C@H](C(=O)O)NC(=O)OCC1c2ccccc2c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fmoc-D-beta-homoalanine, CAS:201864-71-3, Molecular Weight: 325.3585, C19H19NO4, Purity:95, SMILES: C[C@H](CC(O)=O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fmoc-L-beta-homoalanine, CAS:193954-26-6, Molecular Weight: 325.3585, C19H19NO4, Purity:95, SMILES: C[C@@H](CC(O)=O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fmoc-N-Me-Ala-OH, CAS:84000-07-7, Molecular Weight: 325.3585, C19H19NO4, Purity:95, SMILES: C[C@H](N(C)C(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(3-(3,5-DimethoxyphenoxyPropylIsoindoline-1,3-Dione, CAS:100840-52-6, Molecular Weight: 341.3579, C19H19NO5, Purity:95, SMILES: COC1=CC(OCCCN2C(=O)C3=CC=CC=C3C2=O)=CC(OC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Etersalate, CAS:62992-61-4, Molecular Weight: 357.35726, C19H19NO6, Purity:98, SMILES: O=C(OCCOC1=CC=C(NC(C)=O)C=C1)C2=CC=CC=C2OC(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Indeglitazar, CAS:835619-41-5, Molecular Weight: 389.4223, C19H19NO6S, Purity:98, SMILES: O=C(O)CCC1=CN(S(=O)(C2=CC=C(OC)C=C2)=O)C3=C1C=C(OC)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pimethixene, CAS:314-03-4, Molecular Weight: 293.4259, C19H19NS, Purity:98, SMILES: CN1CC/C(CC1)=C2C3=C(SC4=C\2C=CC=C4)C=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
4,4,5,5-Tetramethyl-2-(4-[4-(TrifluoromethoxyPhenoxy]Phenyl-1,3,2-Dioxaborolane, CAS:1426337-32-7, Molecular Weight: 380.166, C19H20BF3O4, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC=C(OC2=CC=C(OC(F)(F)F)C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Macitentan, CAS:441798-33-0, Molecular Weight: 588.2729, C19H20Br2N6O4S, Purity:98, SMILES: BrC1=CN=C(OCCOC2=C(C3=CC=C(Br)C=C3)C(NS(NCCC)(=O)=O)=NC=N2)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ELN 318463 (racemate), CAS:851599-82-1, Molecular Weight: 471.7957, C19H20BrClN2O3S, Purity:98, SMILES: O=S(C1=CC=C(Cl)C=C1)(N(CC2=CC=C(Br)C=C2)C3C(NCCCC3)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
CXCR2-IN-1, CAS:1873376-49-8, Molecular Weight: 476.3492032, C19H20Cl2FN3O4S, Purity:98, SMILES: ClC1=CC=C(NC(NC2=CC=CC(F)=C2Cl)=O)C(O)=C1S(=O)(C3CCN(C)CC3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-(Piperidin-4-yl)-4'-(trifluoromethyl)biphenyl-2-carboxamide HCl, CAS:, Molecular Weight: 384.823, C19H20ClF3N2O, Purity:95, SMILES: O=C(c1ccccc1c1ccc(cc1)C(F)(F)F)NC1CCNCC1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Clemizole, CAS:442-52-4, Molecular Weight: 325.8352, C19H20ClN3, Purity:98, SMILES: ClC1=CC=C(C=C1)CN2C(CN3CCCC3)=NC4=CC=CC=C24, HPLC, NMR, LCMS is ok, stock more than 10g. |
Siltenzepine, CAS:98374-54-0, Molecular Weight: 389.8328, C19H20ClN3O4, Purity:98, SMILES: O=C1C2=CC=CC=C2N(C(CN(CCO)CCO)=O)C3=CC=C(Cl)C=C3N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
SP2509, CAS:1423715-09-6, Molecular Weight: 437.8972, C19H20ClN3O5S, Purity:98, SMILES: O=C(N/N=C(C1=CC(Cl)=CC=C1O)\C)C2=CC=CC(S(=O)(N3CCOCC3)=O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Naphthyl PP1 (hydrochloride), CAS:956025-47-1, Molecular Weight: 353.8486, C19H20ClN5, Purity:98, SMILES: CC(N1N=C(C2=C3C=CC=CC3=CC=C2)C4=C(N)N=CN=C41)(C)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
SKF 82958, CAS:80751-65-1, Molecular Weight: 329.8206, C19H20ClNO2, Purity:98, SMILES: OC1=C(O)C=C2C(C3=CC=CC=C3)CN(CC=C)CCC2=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bezafibrate, CAS:41859-67-0, Molecular Weight: 361.8194, C19H20ClNO4, Purity:98, SMILES: CC(C)(OC1=CC=C(CCNC(C2=CC=C(Cl)C=C2)=O)C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
ethyl 2-(2-(2-(4-chlorophenoxy)phenyl)-N-methylacetamido)acetate, CAS:1035404-19-3, Molecular Weight: 361.819, C19H20ClNO4, Purity:95, SMILES: CCOC(=O)CN(C(=O)Cc1ccccc1Oc1ccc(cc1)Cl)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
CTS-1027, CAS:193022-04-7, Molecular Weight: 425.8832, C19H20ClNO6S, Purity:98, SMILES: O=C(NO)C1(CCOCC1)CS(=O)(C2=CC=C(C=C2)OC3=CC=C(C=C3)Cl)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Clomipramine D3, CAS:136765-29-2, Molecular Weight: 317.8708, C19H20D3ClN2, Purity:98, SMILES: ClC1=CC2=C(C=C1)CCC3=C(C=CC=C3)N2CCCN(C([2H])([2H])[2H])C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pamapimod, CAS:449811-01-2, Molecular Weight: 406.3833, C19H20F2N4O4, Purity:98, SMILES: O=C1C(OC2=CC=C(F)C=C2F)=CC3=CN=C(NC(CCO)CCO)N=C3N1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Refametinib, CAS:923032-37-5, Molecular Weight: 572.3372, C19H20F3IN2O5S, Purity:98, SMILES: O=S(C1(C[C@H](O)CO)CC1)(NC(C(NC(C(F)=C2)=CC=C2I)=C3F)=C(OC)C=C3F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Refametinib (R enantiomer), CAS:923032-38-6, Molecular Weight: 572.3371796, C19H20F3IN2O5S, Purity:98, SMILES: O=S(C1(C[C@H](CO)O)CC1)(NC(C(NC(C(F)=C2)=CC=C2I)=C3F)=C(OC)C=C3F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Orbifloxacin, CAS:113617-63-3, Molecular Weight: 395.3756, C19H20F3N3O3, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C(F)=C(F)C(N4C[C@H](C)N[C@H](C)C4)=C3F)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
EG00229, CAS:1210945-69-9, Molecular Weight: 611.595, C19H20F3N7O7S3, Purity:98, SMILES: N=C(N)NCCC[C@@H](C(O)=O)NC(C1=C(NS(=O)(C2=CC=CC3=NSN=C32)=O)C=CS1)=O.O=C(O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
SB 242235, CAS:193746-75-7, Molecular Weight: 353.3934, C19H20FN5O, Purity:98, SMILES: COC1=NC=CC(C2=C(C3=CC=C(F)C=C3)N=CN2C4CCNCC4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nitroflurbiprofen, CAS:158836-71-6, Molecular Weight: 361.3642032, C19H20FNO5, Purity:98, SMILES: O=C(OCCCCO[N+]([O-])=O)C(C)C1=CC=C(C2=CC=CC=C2)C(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Phenylbutazone, CAS:50-33-9, Molecular Weight: 308.3743, C19H20N2O2, Purity:98, SMILES: O=C(C1CCCC)N(C2=CC=CC=C2)N(C3=CC=CC=C3)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bindarit, CAS:130641-38-2, Molecular Weight: 324.3737, C19H20N2O3, Purity:98, SMILES: CC(OCC1=NN(CC2=CC=CC=C2)C3=C1C=CC=C3)(C)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dolasetron, CAS:115956-12-2, Molecular Weight: 324.3737, C19H20N2O3, Purity:98, SMILES: O=C(C1=CNC2=C1C=CC=C2)O[C@@H]3C[C@@](CC4C5)([H])[N@](CC4=O)[C@@]5([H])C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pioglitazone, CAS:111025-46-8, Molecular Weight: 356.4387, C19H20N2O3S, Purity:98, SMILES: O=C(N1)SC(CC2=CC=C(OCCC3=NC=C(CC)C=C3)C=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
MPC1304, CAS:86780-90-7, Molecular Weight: 388.3713, C19H20N2O7, Purity:98, SMILES: O=C(C1=C(C)NC(C)=C(C(OCC(C)=O)=O)C1C2=CC=CC=C2[N+]([O-])=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Oxacillin (sodium monohydrate), CAS:7240-38-2, Molecular Weight: 441.4334, C19H20N3NaO6S, Purity:98, SMILES: [O-]C([C@@H]1N(C2=O)[C@]([C@@H]2NC(C(C(C3=CC=CC=C3)=NO4)=C4C)=O)([H])SC1(C)C)=O.[Na+].O, HPLC, NMR, LCMS is ok, stock more than 10g. |
AG14361, CAS:328543-09-5, Molecular Weight: 320.3883, C19H20N4O, Purity:98, SMILES: O=C1NCCN2C3=C1C=CC=C3N=C2C4=CC=C(C=C4)CN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
MK-4827, CAS:1038915-60-4, Molecular Weight: 320.3883, C19H20N4O, Purity:98, SMILES: NC(C1=CC=CC2=CN(C3=CC=C([C@H]4CNCCC4)C=C3)N=C21)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nuvenzepine, CAS:96487-37-5, Molecular Weight: 336.3877, C19H20N4O2, Purity:98, SMILES: O=C1C2=CC=CN=C2N(C(C3CCN(C)CC3)=O)C4=CC=CC=C4N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rispenzepine, CAS:96449-05-7, Molecular Weight: 336.3877, C19H20N4O2, Purity:98, SMILES: O=C1C2=CC=CN=C2N(C(C3CN(C)CCC3)=O)C4=CC=CC=C4N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Elesclomol, CAS:488832-69-5, Molecular Weight: 400.5177, C19H20N4O2S2, Purity:98, SMILES: S=C(C1=CC=CC=C1)N(NC(CC(NN(C(C2=CC=CC=C2)=S)C)=O)=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
E3 ligase Ligand-Linker Conjugates 18, CAS:2098488-36-7, Molecular Weight: 428.3987, C19H20N6O6, Purity:98, SMILES: O=C(N(C(CCC1=O)C(N1)=O)C2=O)C(C2=CC=C3)=C3OCC(NCCCCN=[N+]=[N-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
bis(4-(oxiran-2-ylmethyl)phenyl)methane, CAS:67533-76-0, Molecular Weight: 280.3609, C19H20O2, Purity:95, SMILES: C(C1CO1)c1ccc(Cc2ccc(CC3CO3)cc2)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cryptotanshinone, CAS:35825-57-1, Molecular Weight: 296.3603, C19H20O3, Purity:98, SMILES: O=C(C1=C2C=CC3=C1CCCC3(C)C)C(C4=C2OC[C@@H]4C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Columbianadin, CAS:5058-13-9, Molecular Weight: 328.3591, C19H20O5, Purity:98, SMILES: C/C=C(C)\C(OC(C)([C@@H]1CC2=C(O3)C(C=CC3=O)=CC=C2O1)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(benzyloxy-4-oxo-6-(((tetrahydro-2H-pyran-2-yloxymethyl-4H-pyran-2-carboxylic acid, CAS:0, Molecular Weight: 360.3579, C19H20O7, Purity:95, SMILES: OC(=O)C1=C(OCC2=CC=CC=C2)C(=O)C=C(COC2CCCCO2)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Phenylsulfonyl-7-azaindole-3-boronic acid pinacol ester, CAS:886547-94-0, Molecular Weight: 384.257, C19H21BN2O4S, Purity:95, SMILES: CC1(C)OB(OC1(C)C)c1cn(c2c1cccn2)S(=O)(=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
X-Neu5Ac, CAS:160369-85-7, Molecular Weight: 559.72480928, C19H21BrClN2NaO9, Purity:98, SMILES: [O-]C([C@@]1(OC2=CNC3=C2C(Cl)=C(Br)C=C3)C[C@H](O)[C@@H](NC(C)=O)[C@H]([C@H](O)[C@H](O)CO)O1)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
SKF-82958 (hydrobromide), CAS:74115-01-8, Molecular Weight: 410.7325, C19H21BrClNO2, Purity:98, SMILES: OC1=C(O)C=C2C(C3=CC=CC=C3)CN(CC=C)CCC2=C1Cl.[H]Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
AK-7, CAS:420831-40-9, Molecular Weight: 437.3506, C19H21BrN2O3S, Purity:98, SMILES: O=S(N1CCCCCC1)(C2=CC(C(NC3=CC(Br)=CC=C3)=O)=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Clemizole (hydrochloride), CAS:1163-36-6, Molecular Weight: 362.2961, C19H21Cl2N3, Purity:98, SMILES: ClC1=CC=C(C=C1)CN2C(CN3CCCC3)=NC4=CC=CC=C24.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-Thiazoleacetic acid, 2-[[2-[[[(2S)-4-[(3,4-dichlorophenyl)methyl]-2-morpholinyl]methyl]amino]-2-oxoethyl]thio]-, CAS:879399-82-3, Molecular Weight: 490.42374, C19H21Cl2N3O4S2, Purity:98, SMILES: CC(N(SC1=NC(CC(O)=O)=CS1)C[C@@H]2CN(CC3=CC=C(Cl)C(Cl)=C3)CCO2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
F-15599, CAS:635323-95-4, Molecular Weight: 394.846, C19H21ClF2N4O, Purity:98, SMILES: O=C(C1=CC=C(F)C(Cl)=C1)N2CCC(CNCC3=NC=C(C)C=N3)(F)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
SAR405, CAS:1523406-39-4, Molecular Weight: 443.8506, C19H21ClF3N5O2, Purity:98, SMILES: O=C1N(C2=NC(N3[C@H](C)COCC3)=C1)CC[C@@H](C(F)(F)F)N2CC4=CC(Cl)=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benfluorex (hydrochloride), CAS:23642-66-2, Molecular Weight: 387.8238, C19H21ClF3NO2, Purity:98, SMILES: FC(C1=CC(CC(NCCOC(C2=CC=CC=C2)=O)C)=CC=C1)(F)F.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Danirixin, CAS:954126-98-8, Molecular Weight: 441.9041432, C19H21ClFN3O4S, Purity:98, SMILES: O=C(NC1=CC=C(Cl)C(S([C@H]2CCCNC2)(=O)=O)=C1O)NC3=C(C)C(F)=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Paroxetine (hydrochloride), CAS:78246-49-8, Molecular Weight: 365.8264, C19H21ClFNO3, Purity:98, SMILES: FC1=CC=C([C@H]2[C@H](COC3=CC=C(OCO4)C4=C3)CNCC2)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fmoc-Paz Hcl, CAS:215190-22-0, Molecular Weight: 344.835, C19H21ClN2O2, Purity:95, SMILES: Cl.O=C(OCC1C2=CC=CC=C2C2=CC=CC=C12)N1CCNCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Capsazepine, CAS:138977-28-3, Molecular Weight: 376.9002, C19H21ClN2O2S, Purity:98, SMILES: S=C(N1CCCC2=CC(O)=C(O)C=C2C1)NCCC3=CC=C(Cl)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pioglitazone (hydrochloride), CAS:112529-15-4, Molecular Weight: 392.8996, C19H21ClN2O3S, Purity:98, SMILES: CCC1=CN=C(CCOC2=CC=C(CC3C(NC(S3)=O)=O)C=C2)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pioglitazone hydrochloride, CAS:112529-15-4, Molecular Weight: 392.9, C19H21ClN2O3S, Purity:98, SMILES: Cl.CCc1ccc(CCOc2ccc(CC3SC(=O)NC3=O)cc2)nc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Liproxstatin-1, CAS:950455-15-9, Molecular Weight: 340.8499, C19H21ClN4, Purity:98, SMILES: ClC1=CC(CNC2=NC3=CC=CC=C3NC24CCNCC4)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
MK-4827 (hydrochloride), CAS:1038915-64-8, Molecular Weight: 356.8492, C19H21ClN4O, Purity:98, SMILES: NC(C1=CC=CC2=CN(C3=CC=C([C@H]4CNCCC4)C=C3)N=C21)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
SNS-062, CAS:1270014-40-8, Molecular Weight: 384.86264, C19H21ClN6O, Purity:98, SMILES: O=C(NC1CN(C2=C3C(NC=C3)=NC=N2)CCC1)CNC4=CC=CC(Cl)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
JH-II-127, CAS:1700693-08-8, Molecular Weight: 416.8615, C19H21ClN6O3, Purity:98, SMILES: O=C(C1=CC=C(NC2=NC3=NC=C(Cl)C3=C(NC)N2)C(OC)=C1)N4CCOCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetrabenazine D6, CAS:1392826-25-3, Molecular Weight: 323.4596, C19H21D6NO3, Purity:98, SMILES: O=C1[C@H](CC(C)C)CN2CCC3=CC(OC([2H])([2H])[2H])=C(OC([2H])([2H])[2H])C=C3[C@@]2([H])C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ZSTK474, CAS:475110-96-4, Molecular Weight: 417.4125, C19H21F2N7O2, Purity:98, SMILES: FC(C1=NC2=C(N1C3=NC(N4CCOCC4)=NC(N5CCOCC5)=N3)C=CC=C2)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
ethyl 3-(dibenzylaMino)-2,2-difluoropropanoate, CAS:541547-36-8, Molecular Weight: 333.3723, C19H21F2NO2, Purity:95, SMILES: CCOC(=O)C(F)(F)CN(Cc1ccccc1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
PF-4708671, CAS:1255517-76-0, Molecular Weight: 390.4055, C19H21F3N6, Purity:98, SMILES: FC(C1=CC=C2N=C(CN3CCN(C4=NC=NC=C4CC)CC3)NC2=C1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
GNE-7915, CAS:1351761-44-8, Molecular Weight: 443.3953528, C19H21F4N5O3, Purity:98, SMILES: CCNC1=NC(NC2=C(OC)C=C(C(N3CCOCC3)=O)C(F)=C2)=NC=C1C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Heptanamide, N-(1-cyanocyclopropyl)-4,4-difluoro-2-[[(1S)-2,2,2-trifluoro-1-(4-fluorophenyl)ethyl]amino]-, (2S)-, CAS:1017931-53-1, Molecular Weight: 421.3799592, C19H21F6N3O, Purity:98, SMILES: FC(F)(F)[C@H](C1=CC=C(F)C=C1)N[C@@H](CC(F)(F)CCC)C(NC2(CC2)C#N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-Benzyl-5-Fluorospiro[Indoline-3,4'-Piperidine], CAS:1341040-27-4, Molecular Weight: 296.3818, C19H21FN2, Purity:95, SMILES: FC1=CC2=C(NCC22CCN(CC3=CC=CC=C3)CC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nadifloxacin, CAS:124858-35-1, Molecular Weight: 360.3795, C19H21FN2O4, Purity:98, SMILES: O=C(C1=CN2C(C)CCC3=C2C(C1=O)=CC(F)=C3N4CCC(O)CC4)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rucaparib (phosphate), CAS:459868-92-9, Molecular Weight: 421.3593, C19H21FN3O5P, Purity:98, SMILES: O=P(O)(O)O.FC1=CC2=C3C(CCNC2=O)=C(C4=CC=C(CNC)C=C4)NC3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Flupirtine (Maleate), CAS:75507-68-5, Molecular Weight: 420.3916, C19H21FN4O6, Purity:98, SMILES: O=C(NC1=CC=C(N=C1N)NCC2=CC=C(C=C2)F)OCC.O=C(/C=C\C(O)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-IBP, CAS:155798-08-6, Molecular Weight: 420.2873, C19H21IN2O, Purity:98, SMILES: O=C(NC1CCN(CC2=CC=CC=C2)CC1)C3=CC=C(I)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzyl-4-Cyano-4-(PhenylaminoPiperidine, CAS:968-86-5, Molecular Weight: 291.3901, C19H21N3, Purity:95, SMILES: N#CC1(CCN(CC2=CC=CC=C2)CC1)NC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Alcaftadine, CAS:147084-10-4, Molecular Weight: 307.3895, C19H21N3O, Purity:98, SMILES: O=CC1=CN=C2N1CCC3=CC=CC=C3/C2=C4CCN(C)CC\4, HPLC, NMR, LCMS is ok, stock more than 10g. |
ISCK03, CAS:945526-43-2, Molecular Weight: 355.45394, C19H21N3O2S, Purity:98, SMILES: O=S(C1=CC=C(C(C)(C)C)C=C1)(NC2=CC=C(N3C=CN=C3)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
SU6656, CAS:330161-87-0, Molecular Weight: 371.4533, C19H21N3O3S, Purity:98, SMILES: O=S(C1=CC2=C(NC(/C2=C\C(N3)=CC4=C3CCCC4)=O)C=C1)(N(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Darodipine, CAS:72803-02-2, Molecular Weight: 371.38714, C19H21N3O5, Purity:98, SMILES: O=C(C1=C(C)NC(C)=C(C(OCC)=O)C1C2=CC=CC3=NON=C32)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Isradipine, CAS:75695-93-1, Molecular Weight: 371.3871, C19H21N3O5, Purity:98, SMILES: O=C(C1=C(C)NC(C)=C(C(OC(C)C)=O)C1C2=CC=CC3=NON=C23)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
AK-1, CAS:330461-64-8, Molecular Weight: 403.45214, C19H21N3O5S, Purity:98, SMILES: O=C(NC1=CC=CC([N+]([O-])=O)=C1)C2=CC=CC(S(=O)(N3CCCCCC3)=O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
ethyl 2-(((4-carbamimidoylphenyl)amino)methyl)-1-methyl-1H-benzo[d]imidazole-5-carboxylate, CAS:, Molecular Weight: 351.4023, C19H21N5O2, Purity:95, SMILES: CCOC(=O)c1ccc2n(C)c(CNc3ccc(cc3)C(N)=N)nc2c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
NVS-CRF38, CAS:1207258-55-6, Molecular Weight: 351.4023, C19H21N5O2, Purity:98, SMILES: COC1=CC(C)=C(C2=C(C)OC3=C(N4N=C(C)N=C4C)C(C)=NN32)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
PD 117519, CAS:96392-15-3, Molecular Weight: 383.4012, C19H21N5O4, Purity:98, SMILES: OC[C@@H]1[C@H]([C@H]([C@H](N2C=NC3=C2N=CN=C3N[C@@H]4CCC5=C4C=CC=C5)O1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Prazosin, CAS:19216-56-9, Molecular Weight: 383.4012, C19H21N5O4, Purity:98, SMILES: O=C(N1CCN(C2=NC(N)=C3C=C(OC)C(OC)=CC3=N2)CC1)C4=CC=CO4, HPLC, NMR, LCMS is ok, stock more than 10g. |
benzyl 4-phenylpiperidine-1-carboxylate, CAS:733810-73-6, Molecular Weight: 295.3755, C19H21NO2, Purity:95, SMILES: O=C(N1CCC(CC1)c1ccccc1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
methyl 1-benzyl-4-phenylpyrrolidine-3-carboxylate, CAS:87813-03-4, Molecular Weight: 295.3755, C19H21NO2, Purity:95, SMILES: O=C(OC)C1C(C2=CC=CC=C2)CN(CC3=CC=CC=C3)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nuciferine, CAS:475-83-2, Molecular Weight: 295.3755, C19H21NO2, Purity:98, SMILES: CN1CCC2=CC(OC)=C(OC)C3=C2[C@@]1([H])CC4=CC=CC=C34, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 2-((diphenylmethyle, CAS:81477-94-3, Molecular Weight: 295.3755, C19H21NO2, Purity:95, SMILES: CC(C)(C)OC(=O)CN=C(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
URB602, CAS:565460-15-3, Molecular Weight: 295.3755, C19H21NO2, Purity:98, SMILES: O=C(OC1CCCCC1)NC2=CC(C3=CC=CC=C3)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
AZD 4407, CAS:166882-70-8, Molecular Weight: 375.50494, C19H21NO3S2, Purity:98, SMILES: O=C1N(C)C2=C(C=C(SC3=CC([C@]4(O)C[C@H](C)OCC4)=CS3)C=C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
L-Stepholidine, CAS:16562-13-3, Molecular Weight: 327.3743, C19H21NO4, Purity:98, SMILES: OC1=C(OC)C=C(CCN2CC3=C(OC)C(O)=CC=C3C[C@]24[H])C4=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pizotifen, CAS:15574-96-6, Molecular Weight: 295.4417, C19H21NS, Purity:98, SMILES: CN1CC/C(CC1)=C2C3=CC=CC=C3CCC4=C\2C=CS4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tiotropium (Bromide), CAS:136310-93-5, Molecular Weight: 472.4163, C19H22BrNO4S2, Purity:98, SMILES: C[N+]1([C@@]2([H])C[C@@H](OC(C(C3=CC=CS3)(O)C4=CC=CS4)=O)C[C@]1([H])[C@@H]5[C@@H]2O5)C.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Besifloxacin (Hydrochloride), CAS:405165-61-9, Molecular Weight: 430.3007, C19H22Cl2FN3O3, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N4C[C@H](N)CCCC4)=C3Cl)C1=O)O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
PF-670462, CAS:950912-80-8, Molecular Weight: 410.3159, C19H22Cl2FN5, Purity:98, SMILES: NC1=NC=CC(C2=C(C3=CC=C(F)C=C3)N=CN2C4CCCCC4)=N1.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
GTS-21 (dihydrochloride), CAS:156223-05-1, Molecular Weight: 381.2962, C19H22Cl2N2O2, Purity:98, SMILES: COC1=CC(OC)=CC=C1/C=C2CCCN=C\2C3=CC=CN=C3.Cl[H].Cl[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
Paroxetine (hydrochloride hemihydrate), CAS:110429-35-1, Molecular Weight: 374.83, C19H22ClFNO3.5, Purity:98, SMILES: FC1=CC=C([C@H]2[C@H](COC3=CC=C(OCO4)C4=C3)CNCC2)C=C1.[0.5H2O].Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nortriptyline (hydrochloride), CAS:894-71-3, Molecular Weight: 299.8377, C19H22ClN, Purity:98, SMILES: CNCC/C=C1C2=CC=CC=C2CCC3=CC=CC=C\13.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Protriptyline (hydrochloride), CAS:1225-55-4, Molecular Weight: 299.8377, C19H22ClN, Purity:98, SMILES: CNCCCC1C2=CC=CC=C2C=CC3=CC=CC=C13.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
GMX1778, CAS:200484-11-3, Molecular Weight: 371.8639, C19H22ClN5O, Purity:98, SMILES: N#CN/C(NCCCCCCOC1=CC=C(C=C1)Cl)=N\C2=CC=NC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Prazosin (hydrochloride), CAS:19237-84-4, Molecular Weight: 419.8621, C19H22ClN5O4, Purity:98, SMILES: O=C(N1CCN(C2=NC(N)=C3C=C(OC)C(OC)=CC3=N2)CC1)C4=CC=CO4.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Doxepin (Hydrochloride), CAS:1229-29-4, Molecular Weight: 315.8371, C19H22ClNO, Purity:98, SMILES: CN(C)CC/C=C1C2=CC=CC=C2OCC3=CC=CC=C/13.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
(4-Benzyloxy-Phenyl-Piperidin-4-Yl-Methanone Hydrochloride, CAS:1373028-81-9, Molecular Weight: 331.836, C19H22ClNO2, Purity:95, SMILES: Cl.O=C(C1CCNCC1)C1=CC=C(OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ethyl 2-amino-2-(10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-ylacetate hydrochloride, CAS:147900-32-1, Molecular Weight: 331.836, C19H22ClNO2, Purity:95, SMILES: Cl.CCOC(=O)C(N)C1C2=CC=CC=C2CCC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
H-Glu(OBzl)-OBzl.HCl, CAS:972193, Molecular Weight: 363.835, C19H22ClNO4, Purity:97, SMILES: Cl.N[C@@H](CCC(=O)OCc1ccccc1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
LY450108, CAS:376594-67-1, Molecular Weight: 396.4514, C19H22F2N2O3S, Purity:98, SMILES: FC1=CC(F)=CC(C(NC2=CC=C([C@@H](C)CNS(C(C)C)(=O)=O)C=C2)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sparfloxacin, CAS:110871-86-8, Molecular Weight: 392.3998, C19H22F2N4O3, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C(N)=C(F)C(N4C[C@H](C)N[C@H](C)C4)=C3F)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
BYL-719, CAS:1217486-61-7, Molecular Weight: 441.4704896, C19H22F3N5O2S, Purity:98, SMILES: CC(N=C(S1)NC(N2CCC[C@H]2C(N)=O)=O)=C1C3=CC(C(C)(C(F)(F)F)C)=NC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Azaperone, CAS:1649-18-9, Molecular Weight: 327.3959, C19H22FN3O, Purity:98, SMILES: O=C(C1=CC=C(F)C=C1)CCCN2CCN(C3=NC=CC=C3)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
DM8966, CAS:79644-90-9, Molecular Weight: 359.3946832, C19H22FN3O3, Purity:98, SMILES: O=C(C1=CN2C(C)CCC3=C2C(C1=O)=CC(F)=C3N4CCN(C)CC4)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Enrofloxacin, CAS:93106-60-6, Molecular Weight: 359.3947, C19H22FN3O3, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N4CCN(CC)CC4)=C3)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
ETHYL 1-CYCLOPROPYL-6-FLUORO-4-OXO-7-(PIPERAZIN-1-YL)-1,4-DIHYDROQUINOLINE-3-CARBOXYLATE, CAS:105404-65-7, Molecular Weight: 359.3947, C19H22FN3O3, Purity:95, SMILES: CCOC(=O)C1=CN(C2CC2)C2=CC(N3CCNCC3)=C(F)C=C2C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Gatifloxacin, CAS:112811-59-3, Molecular Weight: 375.3941, C19H22FN3O4, Purity:98, SMILES: CC1NCCN(C2=C(F)C=C3C(N(C4CC4)C=C(C(O)=O)C3=O)=C2OC)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Hetacillin (potassium), CAS:5321-32-4, Molecular Weight: 427.559, C19H22KN3O4S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2N(C(C)(C)N[C@@H]3C4=CC=CC=C4)C3=O)N1C2=O)[O-].[K+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Vinburnine, CAS:4880-88-0, Molecular Weight: 294.3908, C19H22N2O, Purity:98, SMILES: O=C1C[C@@]2(CC)[C@@]3([H])C(N1C4=CC=CC=C54)=C5CCN3CCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-BENZYL-4-(PHENYLAMINO)PIPERIDINE-4-CARBOXYLIC ACID, CAS:85098-64-2, Molecular Weight: 310.3902, C19H22N2O2, Purity:95, SMILES: OC(=O)C1(CCN(CC2=CC=CC=C2)CC1)NC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,6-Diazaspiro[3.3]heptane, 2-[(4-methylphenyl)sulfonyl]-6-(phenylmethyl)-, CAS:1041026-64-5, Molecular Weight: 342.455, C19H22N2O2S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)N1CC2(CN(Cc3ccccc3)C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-Benzyl-7-(Phenylsulfonyl-9-Oxa-3,7-Diazabicyclo[3.3.1]Nonane, CAS:335620-96-7, Molecular Weight: 358.455, C19H22N2O3S, Purity:95, SMILES: O=S(=O)(N1CC2CN(CC3=CC=CC=C3)CC(C1)O2)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,6-ditosyl-2,6-diazaspiro[3.3]heptane, CAS:13595-48-7, Molecular Weight: 406.519, C19H22N2O4S2, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)N1CC2(C1)CN(C2)S(=O)(=O)c1ccc(C)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bicyclomycin benzoate, CAS:37134-40-0, Molecular Weight: 406.38658, C19H22N2O8, Purity:98, SMILES: O[C@H]([C@](NC1=O)(OCCC2=C)C(N[C@]12O)=O)[C@@](C)(O)COC(C3=CC=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Iclaprim, CAS:192314-93-5, Molecular Weight: 354.40298, C19H22N4O3, Purity:98, SMILES: NC1=NC=C(CC2=C3C=CC(C4CC4)OC3=C(OC)C(OC)=C2)C(N)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
KF21213, CAS:155271-17-3, Molecular Weight: 354.40298, C19H22N4O3, Purity:98, SMILES: O=C(N1C)N(C)C2=C(N(C)C(/C=C/C3=CC=C(OC)C(C)=C3C)=N2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
MK-6892, CAS:917910-45-3, Molecular Weight: 386.40178, C19H22N4O5, Purity:98, SMILES: OC(C=C1)=CN=C1C2=NOC(CC(C)(C)C(NC3=C(C(O)=O)CCCC3)=O)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
E3 Ligase Ligand-Linker Conjugates 19, CAS:1799711-24-2, Molecular Weight: 402.40118, C19H22N4O6, Purity:98, SMILES: NCCCCNC(COC1=C(C(N2C(CCC3=O)C(N3)=O)=O)C(C2=O)=CC=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
GDC-0326, CAS:1282514-88-8, Molecular Weight: 382.41638, C19H22N6O3, Purity:98, SMILES: C[C@H](OC1=CC=C2C3=NC(C4=NC=NN4C(C)C)=CN3CCOC2=C1)C(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
GNE-317, CAS:1394076-92-6, Molecular Weight: 414.4814, C19H22N6O3S, Purity:98, SMILES: NC1=NC=C(C2=NC(N3CCOCC3)=C4C(C(C)=C(C5(OC)COC5)S4)=N2)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ribocil, CAS:1381289-58-2, Molecular Weight: 382.4826, C19H22N6OS, Purity:98, SMILES: #929hBuDTUG9QkaDTrNDQ7GoQ7TBdUNAdUTohrTihjuDTklDTblAQkaDNDuDQBuD UBQidUTx , HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefoselis, CAS:122841-10-5, Molecular Weight: 522.558, C19H22N8O6S2, Purity:98, SMILES: O=C(C(N12)=C(CN3N(CCO)C(C=C3)=N)CS[C@]2([H])[C@H](NC(/C(C4=CSC(N)=N4)=N\OC)=O)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-(4-(benzyloxyphenyl-4-methylpentan-3-one, CAS:207737-64-2, Molecular Weight: 282.3768, C19H22O2, Purity:95, SMILES: CC(C)C(=O)CCC1=CC=C(OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R)-2-(3-(3-(3,4-dimethoxyphenyl)-1-hydroxypropyl)phenoxy)acetic acid, CAS:215169-00-9, Molecular Weight: 346.3744, C19H22O6, Purity:95, SMILES: COc1ccc(CC[C@@H](O)c2cccc(OCC(O)=O)c2)cc1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyldiphenyl(prop-2-yn-1-yloxysilane, CAS:88159-06-2, Molecular Weight: 294.4629, C19H22OSi, Purity:95, SMILES: CC(C)(C)[Si](OCC#C)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Trazodone (hydrochloride), CAS:25332-39-2, Molecular Weight: 408.3248, C19H23Cl2N5O, Purity:98, SMILES: O=C1N(CCCN2CCN(C3=CC=CC(Cl)=C3)CC2)N=C4C=CC=CN41.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pirenzepine (dihydrochloride), CAS:29868-97-1, Molecular Weight: 424.3242, C19H23Cl2N5O2, Purity:98, SMILES: O=C1NC2=CC=CN=C2N(C(CN3CCN(C)CC3)=O)C4=CC=CC=C14.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
GPR120-IN-1, CAS:1599477-75-4, Molecular Weight: 405.8390296, C19H23ClF3NO3, Purity:98, SMILES: O=C(O)CC(CC1)CCC21CCN(C3=CC(OC(F)(F)F)=CC=C3Cl)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Gatifloxacin (hydrochloride), CAS:121577-32-0, Molecular Weight: 411.855, C19H23ClFN3O4, Purity:98, SMILES: CC1NCCN(C2=C(F)C=C3C(N(C4CC4)C=C(C(O)=O)C3=O)=C2OC)C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefoselis (hydrochloride), CAS:911212-25-4, Molecular Weight: 559.0189, C19H23ClN8O6S2, Purity:98, SMILES: O=C(C(N12)=C(CN3N(CCO)C(C=C3)=N)CS[C@]2([H])[C@H](NC(/C(C4=CSC(N)=N4)=N\OC)=O)C1=O)O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
BI-D1870, CAS:501437-28-1, Molecular Weight: 391.415, C19H23F2N5O2, Purity:98, SMILES: OC1=C(F)C=C(NC2=NC(N(CCC(C)C)C(C)C(N3C)=O)=C3C=N2)C=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rislenemdaz, CAS:808732-98-1, Molecular Weight: 358.4099232, C19H23FN4O2, Purity:98, SMILES: O=C(N1C[C@@H](F)[C@@H](CNC2=NC=CC=N2)CC1)OCC3=CC=C(C)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Amitraz, CAS:33089-61-1, Molecular Weight: 293.406, C19H23N3, Purity:98, SMILES: CN(/C=N/C1=CC=C(C)C=C1C)/C=N/C2=CC=C(C)C=C2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
ABT-670, CAS:630119-43-6, Molecular Weight: 325.4048, C19H23N3O2, Purity:98, SMILES: O=C(NCN1CCC(C2=CC=CC=[N+]2[O-])CC1)C3=CC=CC(C)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl 3-(1-(5-Ethylpyrimidin-2-YlPiperidin-4-YlBenzoate, CAS:0, Molecular Weight: 325.4048, C19H23N3O2, Purity:95, SMILES: CCC1=CN=C(N=C1)N1CCC(CC1)C1=CC(=CC=C1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
NKL 22, CAS:537034-15-4, Molecular Weight: 325.4048, C19H23N3O2, Purity:98, SMILES: O=C(NC1=CC=CC=C1N)CCCCCC(NC2=CC=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Carbamic acid, N-[2,4-dimethyl-6-(4-morpholinyl)-3-pyridinyl]-, phenylmethyl ester, CAS:908608-06-0, Molecular Weight: 341.40422, C19H23N3O3, Purity:98, SMILES: O=C(OCC1=CC=CC=C1)NC2=C(C)C=C(N3CCOCC3)N=C2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Coluracetam, CAS:135463-81-9, Molecular Weight: 341.4042, C19H23N3O3, Purity:98, SMILES: O=C(NC1=C2C(OC(C)=C2C)=NC3=C1CCCC3)CN4C(CCC4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nexturastat A, CAS:1403783-31-2, Molecular Weight: 341.4042, C19H23N3O3, Purity:98, SMILES: O=C(NO)C1=CC=C(CN(CCCC)C(NC2=CC=CC=C2)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-[[2-[[2-(3,4-Dimethoxyphenyl)ethyl]amino]-2-oxoethyl]amino]benzamide, CAS:76001-09-7, Molecular Weight: 357.40362, C19H23N3O4, Purity:98, SMILES: O=C(N)C1=CC=CC(NCC(NCCC2=CC=C(OC)C(OC)=C2)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Hetacillin, CAS:3511-16-8, Molecular Weight: 389.4686, C19H23N3O4S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2N(C(C)(C)N[C@@H]3C4=CC=CC=C4)C3=O)N1C2=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
DASA-58, CAS:1203494-49-8, Molecular Weight: 453.5324, C19H23N3O6S2, Purity:98, SMILES: NC1=CC=CC(S(=O)(N2CCN(S(=O)(C3=CC=C(OCCO4)C4=C3)=O)CCC2)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benfotiamine, CAS:22457-89-2, Molecular Weight: 466.4479, C19H23N4O6PS, Purity:98, SMILES: CC1=NC=C(CN(/C(C)=C(CCOP(O)(O)=O)/SC(C2=CC=CC=C2)=O)C=O)C(N)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Chembridge-5861528, CAS:332117-28-9, Molecular Weight: 369.4176, C19H23N5O3, Purity:98, SMILES: O=C1C2=C(N=CN2CC(NC3=CC=C(C(C)CC)C=C3)=O)N(C)C(N1C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Trimetrexate, CAS:52128-35-5, Molecular Weight: 369.4176, C19H23N5O3, Purity:98, SMILES: NC1=C(C(C)=C2CNC3=CC(OC)=C(OC)C(OC)=C3)C(C=C2)=NC(N)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-(tert-butoxycarbonyl-9-methyl-5H-spiro[imidazo[1,5-a]pyrido[3,2-e]pyrazine-6,3'-pyrrolidine]-7-carboxylic acid, CAS:0, Molecular Weight: 385.417, C19H23N5O4, Purity:95, SMILES: CC1=NC(C(O)=O)=C2N1C1=NC=CC=C1NC21CCN(C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
AT9283, CAS:896466-04-9, Molecular Weight: 381.4316, C19H23N7O2, Purity:98, SMILES: O=C(NC1CC1)NC2=CNN=C2C3=NC4=CC=C(C=C4N3)CN5CCOCC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
PRT062607, CAS:1370261-96-3, Molecular Weight: 393.4456, C19H23N9O, Purity:98, SMILES: NC(C1=CN=C(N[C@H]2[C@@H](N)CCCC2)N=C1NC3=CC=CC(N4N=CC=N4)=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Elucaine, CAS:25314-87-8, Molecular Weight: 297.39142, C19H23NO2, Purity:98, SMILES: CCN(CC)CC(OC(C1=CC=CC=C1)=O)C2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ibuprofen piconol, CAS:64622-45-3, Molecular Weight: 297.39142, C19H23NO2, Purity:98, SMILES: O=C(OCC1=NC=CC=C1)C(C)C2=CC=C(CC(C)C)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Mavoglurant, CAS:543906-09-8, Molecular Weight: 313.3908, C19H23NO3, Purity:98, SMILES: CC1=CC(C#C[C@]2(O)CCC[C@]3([H])[C@@]2([H])CCN3C(OC)=O)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Mavoglurant (racemate), CAS:1636881-61-2, Molecular Weight: 313.3908, C19H23NO3, Purity:98, SMILES: CC1=CC(C#C[C@]2(O)CCC[C@]3([H])[C@@]2([H])CCN3C(OC)=O)=CC=C1.[relative stereochemistry], HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-(Tert-ButoxycarbonylSpiro[Indene-1,4'-Piperidine]-3-Carboxylic Acid, CAS:209128-15-4, Molecular Weight: 329.3902, C19H23NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C=C(C(O)=O)C1=C2C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
6-Alpha Naloxol, CAS:20410-95-1, Molecular Weight: 329.3902, C19H23NO4, Purity:98, SMILES: O[C@@]12[C@]3([C@@H](O4)[C@@H](O)CC2)C5=C4C(O)=CC=C5C[C@H]1N(CC=C)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-(Tert-Butoxycarbonyl-3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-6-Carboxylic Acid, CAS:1160247-47-1, Molecular Weight: 345.3896, C19H23NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(=O)C3=C2C=C(C=C3)C(O)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
KUL 7211 (racemate), CAS:911196-40-2, Molecular Weight: 345.38962, C19H23NO5, Purity:98, SMILES: O=C(O)COC1=CC=C(CCNC(C)C(O)C2=CC=C(O)C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Agomelatine (L(+)-Tartaric acid), CAS:824393-18-2, Molecular Weight: 393.3878, C19H23NO8, Purity:98, SMILES: CC(NCCC1=C2C=C(OC)C=CC2=CC=C1)=O.O=C(O)[C@H](O)[C@@H](O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Briciclib, CAS:865783-99-9, Molecular Weight: 474.4187, C19H23O10PS, Purity:98, SMILES: O=S(CC1=CC(OP(O)(O)=O)=C(OC)C=C1)(/C=C/C2=C(OC)C=C(OC)C=C2OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(p-Toluenesulfonylamino)benzeneboronic acid pinacol ester, CAS:796061-08-0, Molecular Weight: 373.274, C19H24BNO4S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)Nc1cccc(c1)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tiotropium (bromide hydrate), CAS:139404-48-1, Molecular Weight: 490.4315, C19H24BrNO5S2, Purity:98, SMILES: [H][C@@]12[C@@H](O3)[C@@H]3[C@@](C[C@H](OC(C(C4=CC=CS4)(O)C5=CC=CS5)=O)C2)([H])[N+]1(C)C.O.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Clomipramine (hydrochloride), CAS:17321-77-6, Molecular Weight: 351.3133, C19H24Cl2N2, Purity:98, SMILES: CN(C)CCCN1C2=CC(Cl)=CC=C2CCC3=C1C=CC=C3.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzydamine (hydrochloride), CAS:132-69-4, Molecular Weight: 345.8664, C19H24ClN3O, Purity:98, SMILES: CN(C)CCCOC1=NN(CC2=CC=CC=C2)C3=C1C=CC=C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
PRT062607 (Hydrochloride), CAS:1370261-97-4, Molecular Weight: 429.9066, C19H24ClN9O, Purity:98, SMILES: NC(C1=CN=C(N[C@H]2[C@@H](N)CCCC2)N=C1NC3=CC=CC(N4N=CC=N4)=C3)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Diphenylpyraline (hydrochloride), CAS:132-18-3, Molecular Weight: 317.853, C19H24ClNO, Purity:98, SMILES: CN1CCC(OC(C2=CC=CC=C2)C3=CC=CC=C3)CC1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Flecainide (acetate), CAS:54143-56-5, Molecular Weight: 474.3947, C19H24F6N2O5, Purity:98, SMILES: O=C(NCC1NCCCC1)C2=CC(OCC(F)(F)F)=CC=C2OCC(F)(F)F.CC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Gemifloxacin (mesylate), CAS:210353-53-0, Molecular Weight: 485.4866, C19H24FN5O7S, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N4CC(CN)/C(C4)=N/OC)=N3)C1=O)O.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-[1-(2-Phenylethyl)-4-piperidinyl]benzenamine, CAS:21409-26-7, Molecular Weight: 280.4073, C19H24N2, Purity:95, SMILES: C(Cc1ccccc1)N1CCC(CC1)Nc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Palonosetron, CAS:135729-61-2, Molecular Weight: 296.4066, C19H24N2O, Purity:98, SMILES: O=C1N(C[C@@]([H])(CCC2)C3=C2C=CC=C13)[C@@H]4CN5CCC4CC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
Praziquantel, CAS:55268-74-1, Molecular Weight: 312.4061, C19H24N2O2, Purity:98, SMILES: O=C1CN(C(C2CCCCC2)=O)CC3N1CCC4=C3C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
SGC2085, CAS:1821908-48-8, Molecular Weight: 312.4061, C19H24N2O2, Purity:98, SMILES: CC1=CC(OC2=CC=C(CNC([C@@H](N)C)=O)C=C2C)=CC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ethyl 8-benzyl-6-(cyanomethyl)-1,4-dioxa-8-azaspiro[4,5]decane-6-carboxylate, CAS:, Molecular Weight: 344.4049, C19H24N2O4, Purity:95, SMILES: CCOC(=O)C1(CC#N)CN(CCC21OCCO2)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Formoterol, CAS:67346-49-0, Molecular Weight: 344.40486, C19H24N2O4, Purity:98, SMILES: OC1=CC=C([C@@H](O)CN[C@H](C)CC2=CC=C(OC)C=C2)C=C1NC=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
GP2-114, CAS:130783-39-0, Molecular Weight: 344.40486, C19H24N2O4, Purity:98, SMILES: O=C(N)C1=CC=C(CCC(NCC(C2=CC=C(O)C(O)=C2)O)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Formoterol (Fumarate), CAS:43229-80-7, Molecular Weight: 402.44, C19H24N2O4 . 1/2C4H4O4, Purity:98, SMILES: O=CNC1=CC([C@@H](O)CN[C@H](C)CC2=CC=C(OC)C=C2)=CC=C1O.O=CNC3=CC([C@@H](O)CN[C@H](C)CC4=CC=C(OC)C=C4)=CC=C3O.O=C(O)/C=C/C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Omapatrilat, CAS:167305-00-2, Molecular Weight: 408.5349, C19H24N2O4S2, Purity:98, SMILES: O=C([C@@H]1CCC[C@](N21)([H])SCC[C@H](NC([C@@H](S)CC3=CC=CC=C3)=O)C2=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1,4-Ditosyl-1,4-Diazepan-6-Ol, CAS:28860-33-5, Molecular Weight: 424.534, C19H24N2O5S2, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)N1CCN(CC(O)C1)S(=O)(=O)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ketorolac (tromethamine salt), CAS:74103-07-4, Molecular Weight: 376.4037, C19H24N2O6, Purity:98, SMILES: O=C(C1C2=CC=C(C(C3=CC=CC=C3)=O)N2CC1)O.OCC(CO)(N)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pentamidine, CAS:100-33-4, Molecular Weight: 340.4195, C19H24N4O2, Purity:98, SMILES: N=C(C1=CC=C(OCCCCCOC2=CC=C(C(N)=N)C=C2)C=C1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl 3-((Tert-ButoxycarbonylAmino-6,7-Dihydropyrazolo[1,5-A]Pyrazine-5(4H-Carboxylate, CAS:1373028-73-9, Molecular Weight: 372.4183, C19H24N4O4, Purity:95, SMILES: CC(C)(C)OC(=O)NC1=C2CN(CCN2N=C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2-(((BenzyloxyCarbonylAmino-6,7-Dihydropyrazolo[1,5-A]Pyrazine-5(4H-Carboxylate, CAS:1209488-61-8, Molecular Weight: 372.4183, C19H24N4O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN2NC(C=C2C1)=NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl 4-(Dimethylamino-2-(Methylsulfonyl-8,9-Dihydro-5H-Pyrimido[4,5-D]Azepine-7(6H-Carboxylate, CAS:0, Molecular Weight: 404.483, C19H24N4O4S, Purity:95, SMILES: CN(C)C1=NC(=NC2=C1CCN(CC2)C(=O)OCC1=CC=CC=C1)S(C)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
M2I-1, CAS:312271-03-7, Molecular Weight: 404.4832, C19H24N4O4S, Purity:98, SMILES: O=C(/C(C(N1)=O)=C\C2=CC=C(N(CC(C)C)CC(C)C)C([N+]([O-])=O)=C2)NC1=S, HPLC, NMR, LCMS is ok, stock more than 10g. |
BMS-690514, CAS:859853-30-8, Molecular Weight: 368.4329, C19H24N6O2, Purity:98, SMILES: O[C@@H]1CN(CC[C@H]1N)CC2=C3C(NC4=CC=CC(OC)=C4)=NC=NN3C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
DprE1-IN-2, CAS:1615713-87-5, Molecular Weight: 368.4329, C19H24N6O2, Purity:98, SMILES: O=C(C1=CN(CC2=NC=NC(N(C)C)=C2C)C3=CC(C)=CN=C31)NCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,4-Pyrimidinediamine with linker, CAS:1430089-64-7, Molecular Weight: 364.4474, C19H24N8, Purity:98, SMILES: NCCCNC1=CC=C(NC2=NC=CC(NC3=NNC(C4CC4)=C3)=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefoselis (sulfate), CAS:122841-12-7, Molecular Weight: 620.6365, C19H24N8O10S3, Purity:98, SMILES: O=C(C(N12)=C(CN3N(CCO)C(C=C3)=N)CS[C@]2([H])[C@H](NC(/C(C4=CSC(N)=N4)=N\OC)=O)C1=O)O.O=S(O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Mitiglinide (Calcium), CAS:145525-41-3, Molecular Weight: 334.44, C19H24NO3Ca0.5, Purity:98, SMILES: O=C([O-])[C@H](CC(N1C[C@](CCCC2)([H])[C@]2([H])C1)=O)CC3=CC=CC=C3.[0.5Ca2+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Adrenosterone, CAS:382-45-6, Molecular Weight: 300.3921, C19H24O3, Purity:98, SMILES: C[C@@]([C@](CC1)([H])[C@]2([H])CCC3=CC(CC[C@]3(C)[C@@]2([H])C4=O)=O)(C4)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bortezomib, CAS:179324-69-7, Molecular Weight: 384.2372, C19H25BN4O4, Purity:98, SMILES: OB(O)[C@H](CC(C)C)NC([C@@H](NC(C1=NC=CN=C1)=O)CC2=CC=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bortezomib, CAS:179324-69-7, Molecular Weight: 384.237, C19H25BN4O4, Purity:95, SMILES: CC(C[C@@H](B(O)O)NC(=O)[C@@H](NC(=O)c1cnccn1)Cc1ccccc1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
(6R,8R,9S,10R,13S,14S)-6-bromo-10,13-dimethyl-2,6,7,8,9,11,12,14,15,16-decahydro-1H-cyclopenta[a]phenanthrene-3,17-dione, CAS:38632-00-7, Molecular Weight: 365.305, C19H25BrO2, Purity:95, SMILES: C[C@]12CC[C@H]3[C@@H](C[C@@H](Br)C4=CC(=O)CC[C@]34C)[C@@H]1CCC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Imipramine (hydrochloride), CAS:113-52-0, Molecular Weight: 316.8682, C19H25ClN2, Purity:98, SMILES: CN(C)CCCN1C2=CC=CC=C2CCC3=CC=CC=C31.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R,R)-Palonosetron Hydrochloride, CAS:135729-75-8, Molecular Weight: 332.8676, C19H25ClN2O, Purity:98, SMILES: O=C1N(C[C@]([H])(CCC2)C3=C2C=CC=C13)[C@H]4CN5CCC4CC5.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(aminomethyl)-N,N-dibenzyltetrahydrofuran-3-amine hydrochloride, CAS:1956318-57-2, Molecular Weight: 332.868, C19H25ClN2O, Purity:95, SMILES: Cl.NCC1(CCOC1)N(Cc1ccccc1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Palonosetron (Hydrochloride), CAS:135729-62-3, Molecular Weight: 332.8676, C19H25ClN2O, Purity:98, SMILES: O=C1N(C[C@@]([H])(CCC2)C3=C2C=CC=C13)[C@@H]4CN5CCC4CC5.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Labetalol (hydrochloride), CAS:32780-64-6, Molecular Weight: 364.8664, C19H25ClN2O3, Purity:98, SMILES: O=C(N)C1=CC(C(O)CNC(C)CCC2=CC=CC=C2)=CC=C1O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Purvalanol A, CAS:212844-53-6, Molecular Weight: 388.8944, C19H25ClN6O, Purity:98, SMILES: CC([C@@H](NC1=NC(NC2=CC=CC(Cl)=C2)=C3N=CN(C(C)C)C3=N1)CO)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fluvoxamine (maleate), CAS:61718-82-9, Molecular Weight: 434.4068, C19H25F3N2O6, Purity:98, SMILES: O=C(O)/C=C\C(O)=O.FC(C1=CC=C(/C(CCCCOC)=N/OCCN)C=C1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ko-3290, CAS:79848-61-6, Molecular Weight: 343.4201, C19H25N3O3, Purity:98, SMILES: CC(C)C(NC1=CC=C(OCC(O)CNC(C)(C)C#C)C(C#N)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl ((2-Benzyl-2,4,5,7-Tetrahydropyrano[3,4-C]Pyrazol-7-YlMethylCarbamate, CAS:1422344-07-7, Molecular Weight: 343.4201, C19H25N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)NCC1OCCC2=CN(CC3=CC=CC=C3)N=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Boc-His(Bom)-OH, CAS:79950-65-5, Molecular Weight: 375.4189, C19H25N3O5, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H](CC1=CN=CN1COCC1=CC=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3-(4-Methoxybenzyl-2,4-Dioxo-1,3,7-Triazaspiro[4.4]Nonane-7-Carboxylate, CAS:0, Molecular Weight: 375.4189, C19H25N3O5, Purity:95, SMILES: COC1=CC=C(CN2C(=O)NC3(CCN(C3)C(=O)OC(C)(C)C)C2=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
U89232, CAS:134017-78-0, Molecular Weight: 355.4341, C19H25N5O2, Purity:98, SMILES: CCC(C)(C)N/C(NC#N)=N\[C@H]1C2=CC(C#N)=CC=C2OC(C)(C)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Terazosin, CAS:63590-64-7, Molecular Weight: 387.4329, C19H25N5O4, Purity:98, SMILES: O=C(N1CCN(C2=NC(N)=C3C=C(OC)C(OC)=CC3=N2)CC1)C4OCCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
AZD8797, CAS:911715-90-7, Molecular Weight: 403.5647, C19H25N5OS2, Purity:98, SMILES: CC(C)C[C@@H](NC1=NC(S[C@@H](C)C2=CC=CC=C2)=NC3=C1SC(N)=N3)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Anagliptin, CAS:739366-20-2, Molecular Weight: 383.4475, C19H25N7O2, Purity:98, SMILES: O=C(C1=CN2C(N=C1)=CC(C)=N2)NCC(C)(NCC(N3[C@H](C#N)CCC3)=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Methoxyspiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-61-9, Molecular Weight: 315.4067, C19H25NO3, Purity:95, SMILES: COC1=CC2=C(C=CC22CCN(CC2)C(=O)OC(C)(C)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Methyl-3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-44-8, Molecular Weight: 315.4067, C19H25NO3, Purity:95, SMILES: CC1=CC2=C(C=C1)C(=O)CC21CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 7-Methyl-3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-49-3, Molecular Weight: 315.4067, C19H25NO3, Purity:95, SMILES: CC1=C2C(=CC=C1)C(=O)CC21CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Mitiglinide (calcium hydrate), CAS:207844-01-7, Molecular Weight: 353.46, C19H25NO3 . 1/2 Ca . H2O, Purity:98, SMILES: O=C(N1C[C@@](CCCC2)([H])[C@@]2([H])C1)C[C@@H](C(O)=O)CC3=CC=CC=C3.[0.5Ca2+].O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-1-tert-butyl 4-(1-Phenylethyl) 5,6-dihydropyridine-1,4(2H)-dicarboxylate, CAS:, Molecular Weight: 331.4061, C19H25NO4, Purity:95, SMILES: O=C(N1CCC(=CC1)C(=O)O[C@H](c1ccccc1)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-(Tert-Butoxycarbonyl-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-3-Carboxylic Acid, CAS:185526-32-3, Molecular Weight: 331.4061, C19H25NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(C(O)=O)C3=C2C=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-Tert-Butyl 5'-Methyl Spiro[Cyclopentane-1,3'-Indoline]-1',5'-Dicarboxylate, CAS:0, Molecular Weight: 331.4061, C19H25NO4, Purity:95, SMILES: COC(=O)C1=CC2=C(C=C1)N(CC21CCCC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Methoxy-3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:910442-59-0, Molecular Weight: 331.4061, C19H25NO4, Purity:95, SMILES: COC1=CC=C2C(=O)CC3(CCN(CC3)C(=O)OC(C)(C)C)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-(TERT-BUTOXYCARBONYL)SPIRO[CHROMAN-4,4'-PIPERIDINE]-2-CARBOXYLIC ACID, CAS:1228631-15-9, Molecular Weight: 347.4055, C19H25NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CC(Oc1ccccc21)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1'-(Tert-ButoxycarbonylSpiro[Chroman-4,4'-Piperidine]-2-Carboxylic Acid, CAS:1228631-15-9, Molecular Weight: 347.4055, C19H25NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CC(OC1=C2C=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S-1-benzyl 6-methyl 2-((tert-butoxycarbonylamino-4-oxohexanedioate, CAS:630128-01-7, Molecular Weight: 379.4043, C19H25NO7, Purity:95, SMILES: COC(=O)CC(=O)C[C@H](NC(=O)OC(C)(C)C)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl-2-N-BOC-5-carbomethoxy-4-oxo-pentanate, CAS:630128-01-7, Molecular Weight: 379.4043, C19H25NO7, Purity:95, SMILES: COC(=O)CC(=O)C[C@H](NC(=O)OC(C)(C)C)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rotigotine, CAS:99755-59-6, Molecular Weight: 315.4729, C19H25NOS, Purity:98, SMILES: CCCN(CCC1=CC=CS1)[C@H]2CCC3=C(C=CC=C3O)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzyl 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-5,6-dihydropyridine-1(2H)-carboxylate, CAS:286961-15-7, Molecular Weight: 343.225, C19H26BNO4, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CCN(CC1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-indole-1-carboxylate, CAS:942070-45-3, Molecular Weight: 343.225, C19H26BNO4, Purity:97, SMILES: CC(C)(C)OC(=O)n1cc(B2OC(C)(C)C(C)(C)O2)c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Oxitropium (Bromide), CAS:30286-75-0, Molecular Weight: 412.31804, C19H26BrNO4, Purity:98, SMILES: CC[N@@+]1([C@H]2[C@@H](O3)[C@@H]3[C@@H]1C[C@H](OC([C@@H](C4=CC=CC=C4)CO)=O)C2)C.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Pentamidine (dihydrochloride), CAS:50357-45-4, Molecular Weight: 413.3413, C19H26Cl2N4O2, Purity:98, SMILES: N=C(C1=CC=C(OCCCCCOC2=CC=C(C(N)=N)C=C2)C=C1)N.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
ZT 52656A (hydrochloride), CAS:115730-24-0, Molecular Weight: 390.8707496, C19H26ClF3N2O, Purity:98, SMILES: O=C(CC1=CC=C(C=C1)C(F)(F)F)N2CCCCC2CN3CCCC3.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Drobuline (hydrochloride), CAS:68162-52-7, Molecular Weight: 319.86884, C19H26ClNO, Purity:98, SMILES: OC(CNC(C)C)CC(C1=CC=CC=C1)C2=CC=CC=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nylidrin (hydrochloride), CAS:849-55-8, Molecular Weight: 335.8682, C19H26ClNO2, Purity:98, SMILES: OC(C(NC(C)CCC1=CC=CC=C1)C)C2=CC=C(O)C=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
rac-Rotigotine (Hydrochloride), CAS:102120-99-0, Molecular Weight: 351.9338, C19H26ClNOS, Purity:98, SMILES: OC1=C2CCC(N(CCC)CCC3=CC=CS3)CC2=CC=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rotigotine (Hydrochloride), CAS:125572-93-2, Molecular Weight: 351.9338, C19H26ClNOS, Purity:98, SMILES: OC1=C2CC[C@@H](CC2=CC=C1)N(CCC3=CC=CS3)CCC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 3-((benzyloxycarbonylamino)methyl)-4,4-difluoropiperidine-1-carboxylate, CAS:, Molecular Weight: 384.4175, C19H26F2N2O4, Purity:95, SMILES: O=C(OCc1ccccc1)NCC1CN(CCC1(F)F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Iohexol, CAS:66108-95-0, Molecular Weight: 821.1379, C19H26I3N3O9, Purity:98, SMILES: O=C(C1=C(I)C(N(C(C)=O)CC(O)CO)=C(I)C(C(NCC(O)CO)=O)=C1I)NCC(O)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Oxo-4-Phenyl-2,8-Diaza-Spiro[4.5]Decane-8-Carboxylic Acid Tert-Butyl Ester, CAS:897670-78-9, Molecular Weight: 330.4213, C19H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(CNC2=O)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ASP-9521, CAS:1126084-37-4, Molecular Weight: 330.4213, C19H26N2O3, Purity:98, SMILES: O=C(N1CCC(CC(C)(O)C)CC1)C(N2)=CC3=C2C=CC(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Naminterol, CAS:93047-40-6, Molecular Weight: 330.42134, C19H26N2O3, Purity:98, SMILES: OC(CNC(C)CC1=CC=C(OC)C=C1)C2=CC(N)=CC(CO)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 1-Oxo-1,2,3,5-Tetrahydrospiro[Benzo[C]Azepine-4,4'-Piperidine]-1'-Carboxylate, CAS:1160247-87-9, Molecular Weight: 330.4213, C19H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CNC(=O)C1=CC=CC=C1C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 2-benzyl-1-oxo-2,8-diazaspiro[4.5]decane-8-carboxylate, CAS:155600-89-8, Molecular Weight: 330.4213, C19H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CN(Cc3ccccc3)C2=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3-Oxo-1,2,3,5-Tetrahydrospiro[Benzo[C]Azepine-4,4'-Piperidine]-1'-Carboxylate, CAS:1160247-91-5, Molecular Weight: 330.4213, C19H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CC1=C(CNC2=O)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-Butyl 7-benzyl-9-oxo-3,7-diazabicyclo[3.3.1]nonane-3-carboxylate, CAS:227940-70-7, Molecular Weight: 330.4213, C19H26N2O3, Purity:95, SMILES: O=C(N1CC2CN(CC(C1)C2=O)Cc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 7-benzyl-9-oxo-3,7-diaza-bicyclo[3.3.1]nonane-3-carboxylate, CAS:227940-70-7, Molecular Weight: 330.4213, C19H26N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CN(CC3=CC=CC=C3)CC(C1)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
TMB-PS, CAS:102062-36-2, Molecular Weight: 362.4863, C19H26N2O3S, Purity:98, SMILES: O=S(CCCNC1=C(C)C=C(C2=CC(C)=C(N)C(C)=C2)C=C1C)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(1R,2S,4S-tert-butyl 2-(((benzyloxycarbonylamino-7-azabicyclo[2.2.1]heptane-7-carboxylate, CAS:500556-95-6, Molecular Weight: 346.4207, C19H26N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1[C@H]2CC[C@@H]1[C@H](C2)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
5-Benzyloxycarbonylamino-2-Aza-Spiro[3.3]Heptane-2-Carboxylic Acid Tert-Butyl Ester, CAS:1251021-00-7, Molecular Weight: 346.4207, C19H26N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(CCC2NC(=O)OCC2=CC=CC=C2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
6-Benzyl-2,6-Diaza-Spiro[3.4]Octane-2,8-Dicarboxylic Acid 2-Tert-Butyl Ester, CAS:1823807-74-4, Molecular Weight: 346.4207, C19H26N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CN(CC1=CC=CC=C1)CC2C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl 1-benzyl-5-(tert-butoxycarbonylamino)-1,2,5,6-tetrahydropyridine-3-carboxylate, CAS:, Molecular Weight: 346.4207, C19H26N2O4, Purity:95, SMILES: COC(=O)C1=CC(CN(C1)Cc1ccccc1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 1-(Benzyloxycarbonylamino-3-Azabicyclo[3.2.0]Heptane-3-Carboxylate, CAS:1330763-68-2, Molecular Weight: 346.4207, C19H26N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CCC2(C1)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(((benzyloxycarbonyl(1-(tert-butoxycarbonylpyrrolidin-3-ylaminoacetic acid, CAS:0, Molecular Weight: 378.4195, C19H26N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(C1)N(CC(O)=O)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-tert-Butoxycarbonylaminopiperidine-1,4-dicarboxylic acid monobenzyl ester, CAS:252720-32-4, Molecular Weight: 378.4195, C19H26N2O6, Purity:95, SMILES: O=C(N1CCC(CC1)(NC(=O)OC(C)(C)C)C(=O)O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Z-4-amino-1-Boc-piperidine-4-carboxylic acid, CAS:288154-16-5, Molecular Weight: 378.4195, C19H26N2O6, Purity:95, SMILES: O=C(NC1(CCN(CC1)C(=O)OC(C)(C)C)C(=O)O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-(3-methyl-1-phenyl-1H-pyrazol-5-yl)piperazine-1-carboxylate, CAS:401566-78-7, Molecular Weight: 342.4353, C19H26N4O2, Purity:99, SMILES: Cc1cc(N2CCN(CC2)C(=O)OC(C)(C)C)n(n1)-c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tozadenant, CAS:870070-55-6, Molecular Weight: 406.4991, C19H26N4O4S, Purity:98, SMILES: O=C(NC1=NC2=C(C=CC(N3CCOCC3)=C2S1)OC)N4CCC(O)(CC4)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ca2+ channel agonist 1, CAS:1402821-24-2, Molecular Weight: 354.4493, C19H26N6O, Purity:98, SMILES: CC[C@@H](NC1=NC(NCC2=CC=CC=C2)=C3C(N(CCC)C=N3)=N1)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Roscovitine, CAS:186692-46-6, Molecular Weight: 354.4493, C19H26N6O, Purity:98, SMILES: OC[C@H](NC1=NC(NCC2=CC=CC=C2)=C3C(N(C=N3)C(C)C)=N1)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetrahydrocannabivarin, CAS:31262-37-0, Molecular Weight: 286.40854, C19H26O2, Purity:98, SMILES: OC1=C2[C@@]3([H])[C@](CCC(C)=C3)([H])C(C)(C)OC2=CC(CCC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-((Tert-ButyldiphenylsilylOxyPropan-1-Ol, CAS:127047-71-6, Molecular Weight: 314.494, C19H26O2Si, Purity:95, SMILES: CC(C)(C)[Si](OCCCO)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-Methoxyestradiol, CAS:362-07-2, Molecular Weight: 302.4079, C19H26O3, Purity:98, SMILES: OC1=CC2=C([C@]3(CC[C@@]4([C@H](CC[C@]4([C@@]3(CC2)[H])[H])O)C)[H])C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Formestane, CAS:566-48-3, Molecular Weight: 302.4079, C19H26O3, Purity:98, SMILES: C[C@]1([C@](CC2)([H])[C@]3([H])CCC4=C(O)C(CC[C@]4(C)[C@@]3([H])CC1)=O)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PGS-IN-1, CAS:102271-49-8, Molecular Weight: 302.40794, C19H26O3, Purity:98, SMILES: O=C1OCC/C1=C\C2=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Valifenalate, CAS:283159-90-0, Molecular Weight: 398.8811, C19H27ClN2O5, Purity:98, SMILES: O=C([C@H](C(C)C)NC(OC(C)C)=O)NC(C1=CC=C(Cl)C=C1)CC(OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 4-((Benzyloxycarbonylamino)methyl)-3-fluoropiperidine-1-carboxylate, CAS:1400764-52-4, Molecular Weight: 366.4271, C19H27FN2O4, Purity:95, SMILES: O=C(OCc1ccccc1)NCC1CCN(CC1F)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
A-366, CAS:1527503-11-2, Molecular Weight: 329.4366, C19H27N3O2, Purity:98, SMILES: COC1=CC2=C(N=C(N)C23CCC3)C=C1OCCCN4CCCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bavisant, CAS:929622-08-2, Molecular Weight: 329.4366, C19H27N3O2, Purity:98, SMILES: O=C(N1CCN(C2CC2)CC1)C(C=C3)=CC=C3CN4CCOCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
PZM21, CAS:1997387-43-5, Molecular Weight: 361.50158, C19H27N3O2S, Purity:98, SMILES: O=C(N[C@@H](C)CC1=CSC=C1)NC[C@@H](N(C)C)CC2=CC=C(O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Semagacestat, CAS:425386-60-3, Molecular Weight: 361.4354, C19H27N3O4, Purity:98, SMILES: O=C([C@H]1NC([C@@H](NC([C@H](C(C)C)O)=O)C)=O)N(CCC2=C1C=CC=C2)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dofetilide, CAS:115256-11-6, Molecular Weight: 441.5648, C19H27N3O5S2, Purity:98, SMILES: CS(=O)(NC1=CC=C(CCN(C)CCOC2=CC=C(NS(=O)(C)=O)C=C2)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Daprodustat, CAS:960539-70-2, Molecular Weight: 393.4342, C19H27N3O6, Purity:98, SMILES: O=C(O)CNC(C(C(N1C2CCCCC2)=O)C(N(C3CCCCC3)C1=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Alfuzosin, CAS:81403-80-7, Molecular Weight: 389.4488, C19H27N5O4, Purity:98, SMILES: O=C(C1OCCC1)NCCCN(C2=NC(N)=C3C=C(OC)C(OC)=CC3=N2)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Oclacitinib (maleate), CAS:1208319-27-0, Molecular Weight: 453.51258, C19H27N5O6S, Purity:98, SMILES: O=S(C[C@H]1CC[C@H](N(C)C2=C3C(NC=C3)=NC=N2)CC1)(NC)=O.O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 7-Methyl-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-37-9, Molecular Weight: 301.4232, C19H27NO2, Purity:95, SMILES: CC1=C2C(CCC22CCN(CC2)C(=O)OC(C)(C)C)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nateglinide, CAS:105816-04-4, Molecular Weight: 317.4226, C19H27NO3, Purity:98, SMILES: O=C(O)[C@@H](CC1=CC=CC=C1)NC([C@H]2CC[C@H](C(C)C)CC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 6-Methoxy-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-35-7, Molecular Weight: 317.4226, C19H27NO3, Purity:95, SMILES: COC1=CC2=C(CCC22CCN(CC2)C(=O)OC(C)(C)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetrabenazine, CAS:58-46-8, Molecular Weight: 317.42258, C19H27NO3, Purity:98, SMILES: O=C1[C@@H](CC(C)C)CN2CCC3=CC(OC)=C(OC)C=C3[C@]2([H])C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetrabenazine ((+)-), CAS:1026016-83-0, Molecular Weight: 317.4226, C19H27NO3, Purity:98, SMILES: COC1=C(OC)C=C(CCN(C[C@H]2CC(C)C)[C@]3([H])CC2=O)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tetrabenazine (Racemate), CAS:718635-93-9, Molecular Weight: 317.4226, C19H27NO3, Purity:98, SMILES: O=C1C(CC(C)C)CN2CCC3=CC(OC)=C(OC)C=C3C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cinoctramide, CAS:28598-08-5, Molecular Weight: 333.422, C19H27NO4, Purity:98, SMILES: O=C(N1CCCCCCC1)/C=C/C2=CC(OC)=C(OC)C(OC)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cis-1-Tert-Butyl 4-Ethyl 3-Phenylpiperidine-1,4-Dicarboxylate, CAS:1027710-05-9, Molecular Weight: 333.422, C19H27NO4, Purity:95, SMILES: CCOC(=O)[C@H]1CCN(C[C@H]1C1=CC=CC=C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Glycopyrrolate, CAS:596-51-0, Molecular Weight: 398.3345, C19H28BrNO3, Purity:98, SMILES: C[N+]1(C)CC(OC(C(O)(C2CCCC2)C3=CC=CC=C3)=O)CC1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
EDO-S101, CAS:1236199-60-2, Molecular Weight: 415.35722, C19H28Cl2N4O2, Purity:98, SMILES: O=C(NO)CCCCCCC1=NC2=CC(N(CCCl)CCCl)=CC=C2N1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cefepime (Dihydrochloride Monohydrate), CAS:123171-59-5, Molecular Weight: 571.4982, C19H28Cl2N6O6S2, Purity:98, SMILES: C[N+]1(CC(CS[C@]2([H])[C@@H]3NC(/C(C4=CSC(N)=N4)=N\OC)=O)=C(C(O)=O)N2C3=O)CCCC1.[Cl-].Cl.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
AU-224, CAS:287399-47-7, Molecular Weight: 397.89632, C19H28ClN3O4, Purity:98, SMILES: O=C(OCCCC)CN1CCC(NC(C2=CC(Cl)=C(N)C=C2OC)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sulamserod, CAS:219757-90-1, Molecular Weight: 445.96072, C19H28ClN3O5S, Purity:98, SMILES: CS(=O)(NCCN1CCC(CCC(C2=C3OCCOC3=C(N)C(Cl)=C2)=O)CC1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dapiprazole (hydrochloride), CAS:72822-13-0, Molecular Weight: 361.9121, C19H28ClN5, Purity:98, SMILES: CC1=CC=CC=C1N2CCN(CCC3=NN=C4CCCCN43)CC2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Lodoxamide (tromethamine), CAS:63610-09-3, Molecular Weight: 553.9049, C19H28ClN5O12, Purity:98, SMILES: N#CC1=CC(NC(C(O)=O)=O)=C(Cl)C(NC(C(O)=O)=O)=C1.OCC(CO)(N)CO.OCC(CO)(N)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Alfuzosin (hydrochloride), CAS:81403-68-1, Molecular Weight: 425.9097, C19H28ClN5O4, Purity:98, SMILES: O=C(C1OCCC1)NCCCN(C2=NC(N)=C3C=C(OC)C(OC)=CC3=N2)C.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
PRE-084 (hydrochloride), CAS:75136-54-8, Molecular Weight: 353.8835, C19H28ClNO3, Purity:98, SMILES: O=C(C1(C2=CC=CC=C2)CCCCC1)OCCN3CCOCC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pitolisant (oxalate), CAS:362665-57-4, Molecular Weight: 385.8823, C19H28ClNO5, Purity:98, SMILES: ClC1=CC=C(CCCOCCCN2CCCCC2)C=C1.O=C(O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
3,7-Diazabicyclo[3.3.1]nonane-3-carboxylic acid, 7-(phenylmethyl)-, 1,1-dimethylethyl ester, CAS:227940-71-8, Molecular Weight: 316.4378, C19H28N2O2, Purity:95, SMILES: O=C(N1CC2CN(CC(C1)C2)Cc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
7-Benzyl-2,7-diazaspiro[3.5]nonane, N2-BOC protected, CAS:929301-99-5, Molecular Weight: 316.4378, C19H28N2O2, Purity:95, SMILES: O=C(N1CC2(C1)CCN(CC2)Cc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
CYM-5541, CAS:945128-26-7, Molecular Weight: 316.43782, C19H28N2O2, Purity:98, SMILES: O=C(C1=NOC(C2CC2)=C1)N(C3CCCCC3)C4CCCCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl ((3aS,6aR)-2-benzyloctahydrocyclopenta[c]pyrrol-4-yl)carbamate, CAS:, Molecular Weight: 316.4378, C19H28N2O2, Purity:95, SMILES: O=C(OC(C)(C)C)NC1CC[C@@]2([H])CN(CC3=CC=CC=C3)C[C@]21[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 2-Benzyl-2,7-Diazaspiro[3.5]Nonane-7-Carboxylate, CAS:1206969-92-7, Molecular Weight: 316.4378, C19H28N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CN(CC3=CC=CC=C3)C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 3-Allyl-3-(BenzylaminoPyrrolidine-1-Carboxylate, CAS:0, Molecular Weight: 316.4378, C19H28N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC=C)(C1)NCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 7-benzyl-2,7-diazaspiro[3.5]nonane-2-carboxylate, CAS:929301-99-5, Molecular Weight: 316.4378, C19H28N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CCN(CC1=CC=CC=C1)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl 7-Methoxy-3,4-Dihydro-2H-Spiro[Isoquinoline-1,4'-Piperidine]-1'-Carboxylate, CAS:1160247-66-4, Molecular Weight: 332.4372, C19H28N2O3, Purity:95, SMILES: COC1=CC=C2CCNC3(CCN(CC3)C(=O)OC(C)(C)C)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Trans-Tert-Butyl 4-Benzylhexahydro-2H-Pyrido[4,3-B][1,4]Oxazine-6(7H-Carboxylate, CAS:0, Molecular Weight: 332.4372, C19H28N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2OCCN(CC3=CC=CC=C3)[C@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R)-benzyl 3-((tert-butoxycarbonyl)amino)-3-methylpiperidine-1-carboxylate, CAS:1169762-40-6, Molecular Weight: 348.4366, C19H28N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)NC1(C)CCCN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Boc-4-Cbz-aminoazepane, CAS:878630-96-7, Molecular Weight: 348.4366, C19H28N2O4, Purity:95, SMILES: O=C(C1CCCN(C(C1)N)C(=O)OC(C)(C)C)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-tert-butyl 2-methyl 2-(2-(benzylamino)ethyl)azetidine-1,2-dicarboxylate, CAS:, Molecular Weight: 348.4366, C19H28N2O4, Purity:95, SMILES: O=C(N1C(C(OC)=O)(CCNCC2=CC=CC=C2)CC1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
benzyl 4-(((tert-butoxycarbonyl)amino)methyl)piperidine-1-carboxylate, CAS:172348-56-0, Molecular Weight: 348.4366, C19H28N2O4, Purity:97, SMILES: CC(C)(C)OC(=O)NCC1CCN(CC1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cis Benzyl Tert-Butyl Cyclohexane-1,3-Diyldicarbamate, CAS:1261225-44-8, Molecular Weight: 348.4366, C19H28N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@H]1CCC[C@H](C1)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Trans-Benzyl 3-((Tert-ButoxycarbonylAmino-4-Methylpiperidine-1-Carboxylate, CAS:0, Molecular Weight: 348.4366, C19H28N2O4, Purity:95, SMILES: C[C@@H]1CCN(C[C@H]1NC(=O)OC(C)(C)C)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-butyl 1-tosyl-1,7-diazaspiro[3.5]nonane-7-carboxylate, CAS:0, Molecular Weight: 380.502, C19H28N2O4S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)N1CCC11CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Darbufelone (mesylate), CAS:139340-56-0, Molecular Weight: 428.56602, C19H28N2O5S2, Purity:98, SMILES: O=C1N=C(N)S/C1=C\C2=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C2.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
8-O-Acetyl shanzhiside methyl ester, CAS:57420-46-9, Molecular Weight: 448.4184, C19H28O12, Purity:98, SMILES: O[C@H]([C@@H](O)[C@@H]1O)[C@](O[C@@H]1CO)([H])O[C@H]2[C@@]([C@@]3(C)OC(C)=O)([H])[C@@]([C@H](O)C3)([H])C(C(OC)=O)=CO2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dehydroepiandrosterone, CAS:53-43-0, Molecular Weight: 288.4244, C19H28O2, Purity:97, SMILES: [H][C@@]12CCC(=O)[C@@]1(C)CC[C@@]1([H])[C@@]2([H])CC=C2C[C@@H](O)CC[C@]12C, HPLC, NMR, LCMS is ok, stock more than 10g. |
DHEA, CAS:53-43-0, Molecular Weight: 288.4244, C19H28O2, Purity:98, SMILES: O=C1CC[C@@]2([H])[C@]3([H])CC=C4C[C@@H](O)CC[C@]4(C)C3CC[C@@]21C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Trestolone, CAS:3764-87-2, Molecular Weight: 288.42442, C19H28O2, Purity:98, SMILES: C[C@@]12[C@@H](O)CC[C@@]1([H])[C@]3([H])[C@H](C)CC4=CC(CC[C@]4([H])[C@@]3([H])CC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-Hydroxytestosterone, CAS:2141-17-5, Molecular Weight: 304.42382, C19H28O3, Purity:98, SMILES: C[C@@]12[C@@H](O)CC[C@@]1([H])[C@]3([H])CCC4=C(O)C(CC[C@]4(C)[C@@]3([H])CC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl 12-oxo-12-phenyldodecanoate, CAS:104828-35-5, Molecular Weight: 304.4238, C19H28O3, Purity:95, SMILES: COC(=O)CCCCCCCCCCC(=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bavisant (dihydrochloride), CAS:929622-09-3, Molecular Weight: 402.3585, C19H29Cl2N3O2, Purity:98, SMILES: O=C(N1CCN(C2CC2)CC1)C(C=C3)=CC=C3CN4CCOCC4.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl3-Amino-6-Methyl-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate Hydrochloride, CAS:0, Molecular Weight: 352.899, C19H29ClN2O2, Purity:95, SMILES: Cl.CC1=CC2=C(C=C1)C(N)CC21CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
ethyl 4-chloro-1-(triisopropylsilyl)-1H-pyrrolo[2,3-b]pyridine-5-carboxylate, CAS:1310704-15-4, Molecular Weight: 380.984, C19H29ClN2O2Si, Purity:95, SMILES: CCOC(=O)c1cnc2c(c1Cl)ccn2[Si](C(C)C)(C(C)C)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Roxatidine (Acetate Hydrochloride), CAS:93793-83-0, Molecular Weight: 384.8976, C19H29ClN2O4, Purity:98, SMILES: O=C(NCCCOC1=CC=CC(CN2CCCCC2)=C1)COC(C)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
NBI-98782, CAS:85081-18-1, Molecular Weight: 319.4384, C19H29NO3, Purity:98, SMILES: COC(C=C1CCN2C[C@@H](CC(C)C)[C@@H]3O)=C(C=C1[C@]2(C3)[H])OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
NBI-98854, CAS:171598-74-6, Molecular Weight: 319.4384, C19H29NO3, Purity:98, SMILES: COC(C=C1CCN2C[C@H](CC(C)C)[C@@H](O)C3)=C(C=C1[C@]23[H])OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Terazosin (hydrochloride dihydrate), CAS:70024-40-7, Molecular Weight: 459.9244, C19H30ClN5O6, Purity:98, SMILES: O=C(N1CCN(C2=NC(N)=C3C=C(OC)C(OC)=CC3=N2)CC1)C4OCCC4.O.Cl.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Procyclidine (hydrochloride), CAS:1508-76-5, Molecular Weight: 323.9006, C19H30ClNO, Purity:98, SMILES: OC(C1=CC=CC=C1)(C2CCCCC2)CCN3CCCC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cyclodrine (hydrochloride), CAS:78853-39-1, Molecular Weight: 355.8994, C19H30ClNO3, Purity:98, SMILES: O=C(OCCN(CC)CC)C(C1(O)CCCC1)C2=CC=CC=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
BTTAA, CAS:1334179-85-9, Molecular Weight: 430.5073, C19H30N10O2, Purity:98, SMILES: O=C(O)CN1N=NC(CN(CC2=CN(C(C)(C)C)N=N2)CC3=CN(C(C)(C)C)N=N3)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
11-Benzyl-2,11-Diazaspiro[6.7]Tetradecane, CAS:1445951-65-4, Molecular Weight: 286.4549, C19H30N2, Purity:95, SMILES: C(N1CCCC2(CCCCNC2)CCC1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tert-Butyl ((1-Benzyl-4-Methylpiperidin-4-YlMethylCarbamate, CAS:1345728-58-6, Molecular Weight: 318.4537, C19H30N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)NCC1(C)CCN(CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tenofovir (Disoproxil), CAS:201341-05-1, Molecular Weight: 519.4427, C19H30N5O10P, Purity:98, SMILES: O=C(OC(C)C)OCOP(OCOC(OC(C)C)=O)(CO[C@H](C)CN1C=NC2=C(N)N=CN=C12)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Epiandrosterone, CAS:481-29-8, Molecular Weight: 290.4403, C19H30O2, Purity:98, SMILES: C[C@]1([C@](CC2)([H])[C@]3([H])CC[C@@]4([H])C[C@@H](O)CC[C@]4(C)[C@@]3([H])CC1)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
3β,7β,17β-Trihydroxyandrost-5-ene, CAS:2697-85-0, Molecular Weight: 306.4397, C19H30O3, Purity:98, SMILES: C[C@@](C1=C[C@@H]2O)(CC[C@H](O)C1)[C@]3([H])[C@]2([H])[C@@](CC[C@@H]4O)([H])[C@]4(C)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Idebenone, CAS:58186-27-9, Molecular Weight: 338.4385, C19H30O5, Purity:98, SMILES: O=C1C(CCCCCCCCCCO)=C(C)C(C(OC)=C1OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Piperonyl butoxide, CAS:51-03-6, Molecular Weight: 338.4385, C19H30O5, Purity:98, SMILES: CCCC1=C(COCCOCCOCCCC)C=C2OCOC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bavisant (dihydrochloride hydrate), CAS:1103522-80-0, Molecular Weight: 420.3737, C19H31Cl2N3O3, Purity:98, SMILES: O=C(N1CCN(C2CC2)CC1)C(C=C3)=CC=C3CN4CCOCC4.[H]Cl.[H]Cl.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Amiselimod (hydrochloride), CAS:942398-84-7, Molecular Weight: 413.9026, C19H31ClF3NO3, Purity:98, SMILES: OCC(CCC1=CC=C(OCCCCCCC)C(C(F)(F)F)=C1)(N)CO.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
GW311616, CAS:198062-54-3, Molecular Weight: 397.5321, C19H31N3O4S, Purity:98, SMILES: O=C1[C@@H](C(C)C)[C@@](N(C(/C=C/CN2CCCCC2)=O)CC3)([H])[C@]3([H])N1S(=O)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
CA-074 methyl ester, CAS:147859-80-1, Molecular Weight: 397.4659, C19H31N3O6, Purity:98, SMILES: O=C([C@@H]1[C@@H](C(NCCC)=O)O1)N[C@]([C@@H](C)CC)([H])C(N(CCC2)[C@@H]2C(OC)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
PHA-793887, CAS:718630-59-2, Molecular Weight: 361.4818, C19H31N5O2, Purity:98, SMILES: CC(C)CC(NC1=NNC2=C1CN(C(C3CCN(C)CC3)=O)C2(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzcyclane, CAS:2179-37-5, Molecular Weight: 289.45554, C19H31NO, Purity:98, SMILES: CN(C)CCCOC1(CC2=CC=CC=C2)CCCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S,4S)-methyl 1-benzyl-4-(tert-butyldimethylsilyloxy)pyrrolidine-2-carboxylate, CAS:1318129-60-0, Molecular Weight: 349.5398, C19H31NO3Si, Purity:97, SMILES: COC(=O)[C@@H]1C[C@@H](CN1Cc1ccccc1)O[Si](C)(C)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
tert-Butyl 4-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazol-1-yl)piperidine-1-carboxylate, CAS:877399-74-1, Molecular Weight: 377.286, C19H32BN3O4, Purity:95, SMILES: O=C(N1CCC(CC1)n1ncc(c1)B1OC(C(O1)(C)C)(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
GW311616 (hydrochloride), CAS:197890-44-1, Molecular Weight: 433.9931, C19H32ClN3O4S, Purity:98, SMILES: O=C1[C@@H](C(C)C)[C@@](N(C(/C=C/CN2CCCCC2)=O)CC3)([H])[C@]3([H])N1S(=O)(C)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Camylofine, CAS:54-30-8, Molecular Weight: 320.4696, C19H32N2O2, Purity:98, SMILES: O=C(OCCC(C)C)C(NCCN(CC)CC)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
BW 245C, CAS:72814-32-5, Molecular Weight: 368.46778, C19H32N2O5, Purity:98, SMILES: O=C(O)CCCCCC[C@@H](C(N1)=O)N(CC[C@H](C2CCCCC2)O)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Perindopril, CAS:82834-16-0, Molecular Weight: 368.4678, C19H32N2O5, Purity:98, SMILES: O=C([C@H]1N(C([C@@H](N[C@H](C(OCC)=O)CCC)C)=O)[C@@]2([H])CCCC[C@@]2([H])C1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(1-(Triisopropylsilyl)-1H-pyrrolo[2,3-b]pyridin-5-yl)propan-2-ol, CAS:918523-63-4, Molecular Weight: 332.5557, C19H32N2OSi, Purity:95, SMILES: CC([Si](n1ccc2c1ncc(c2)C(O)(C)C)(C(C)C)C(C)C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl linolenate, CAS:301-00-8, Molecular Weight: 292.4562, C19H32O2, Purity:98, SMILES: CC/C=C\C/C=C\C/C=C\CCCCCCCC(OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(3S,5S,6S,8R,9S,10R,13S,14S,17S)-10,13-dimethylhexadecahydro-1H-cyclopenta[a]phenanthrene-3,6,17-triol, CAS:49644-04-4, Molecular Weight: 308.4556, C19H32O3, Purity:95, SMILES: O[C@H]1CC[C@@]2([C@]3(CC[C@@]4([C@H](CC[C@]4([C@@]3(C[C@@H]([C@]2(C1)[H])O)[H])[H])O)C)[H])C, HPLC, NMR, LCMS is ok, stock more than 10g. |
TOFA, CAS:54857-86-2, Molecular Weight: 324.45498, C19H32O4, Purity:98, SMILES: O=C(C1=CC=C(OCCCCCCCCCCCCCC)O1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-phenyl-2,5,8,11,14,17-hexaoxanonadecan-19-ol, CAS:24342-68-5, Molecular Weight: 372.4532, C19H32O7, Purity:95, SMILES: OCCOCCOCCOCCOCCOCCOCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Di-Tert-Butyl 2-Oxo-1,8,11-Triazaspiro[5.6]Dodecane-8,11-Dicarboxylate, CAS:0, Molecular Weight: 383.4824, C19H33N3O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC2(CCCC(=O)N2)C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fingolimod, CAS:162359-55-9, Molecular Weight: 307.4708, C19H33NO2, Purity:98, SMILES: OCC(CCC1=CC=C(CCCCCCCC)C=C1)(N)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fingolimod (hydrochloride), CAS:162359-56-0, Molecular Weight: 343.9318, C19H34ClNO2, Purity:98, SMILES: OCC(N)(CO)CCC1=CC=C(C=C1)CCCCCCCC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methoprene, CAS:40596-69-8, Molecular Weight: 310.4715, C19H34O3, Purity:98, SMILES: CC(C)(OC)CCCC(C)C/C=C/C(C)=C/C(OC(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
ETC-1002, CAS:738606-46-7, Molecular Weight: 344.4861, C19H36O5, Purity:98, SMILES: O=C(O)C(C)(C)CCCCCC(O)CCCCCC(C)(C)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
TAPI-2, CAS:187034-31-7, Molecular Weight: 415.5276, C19H37N5O5, Purity:98, SMILES: CC(C)(C)[C@@H](C(N[C@H](C(NCCN)=O)C)=O)NC(C(CC(NO)=O)CC(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sisomicin (sulfate), CAS:53179-09-2, Molecular Weight: 692.72, C19H37N5O7 . 5/2 H2SO4, Purity:98, SMILES: N[C@H]1[C@](O[C@@H]2[C@@H](N)C[C@@H](N)[C@H](O[C@@]3([H])OC[C@@](O)(C)[C@H](NC)[C@H]3O)[C@H]2O)([H])OC(CN)=CC1.[2.5H2SO4], HPLC, NMR, LCMS is ok, stock more than 10g. |
(4R)-1-tert-butyl 2-Methyl 4-(tert-butyldimethylsilyloxy)-2-ethylpyrrolidine-1,2-dicarboxylate, CAS:, Molecular Weight: 387.5863, C19H37NO5Si, Purity:95, SMILES: COC(=O)C1(CC)C[C@H](CN1C(=O)OC(C)(C)C)O[Si](C(C)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
nonadecanal, CAS:17352-32-8, Molecular Weight: 282.5044, C19H38O, Purity:95, SMILES: CCCCCCCCCCCCCCCCCCC=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Methyl Stearate, CAS:112-61-8, Molecular Weight: 298.5038, C19H38O2, Purity:95, SMILES: CCCCCCCCCCCCCCCCCC(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nonadecanoic acid, CAS:646-30-0, Molecular Weight: 298.5038, C19H38O2, Purity:95, SMILES: CCCCCCCCCCCCCCCCCCC(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Nonadecanol, CAS:1454-84-8, Molecular Weight: 284.5203, C19H40O, Purity:95, SMILES: CCCCCCCCCCCCCCCCCCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
3-(Hexadecyloxy)propan-1-ol, CAS:23377-40-4, Molecular Weight: 300.5197, C19H40O2, Purity:95, SMILES: CCCCCCCCCCCCCCCCOCCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
Cetrimonium (bromide), CAS:57-09-0, Molecular Weight: 364.4475, C19H42BrN, Purity:98, SMILES: CCCCCCCCCCCCCCCC[N+](C)(C)C.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
VX-745, CAS:209410-46-8, Molecular Weight: 436.2621, C19H9Cl2F2N3OS, Purity:98, SMILES: O=C1N=CN(C(C=C2)=C1C3=C(Cl)C=CC=C3Cl)N=C2SC4=CC=C(F)C=C4F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Enfuvirtide, CAS:159519-65-0, Molecular Weight: 4491.88, C204H301N51O64, Purity:98, SMILES: [Enfuvirtide], HPLC, NMR, LCMS is ok, stock more than 10g. |
Corticotropin-releasing factor (ovine), CAS:79804-71-0, Molecular Weight: 4670.31, C205H339N59O63S, Purity:98, SMILES: [Corticotropin-releasing factor (ovine)], HPLC, NMR, LCMS is ok, stock more than 10g. |
Corticotropin-releasing factor (human), CAS:86784-80-7, Molecular Weight: 4757.45, C208H344N60O63S2, Purity:98, SMILES: [Corticotropin-releasing factor (human)], HPLC, NMR, LCMS is ok, stock more than 10g. |
Merbromin, CAS:129-16-8, Molecular Weight: 752.6674, C20H10Br2HgNa2O6, Purity:98, SMILES: O[Hg]C1=C([O-])C(Br)=CC(C2C3=C(C=CC=C3)C([O-])=O)=C1OC4=C2C=C(Br)C(O)=C4.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
BCA, CAS:979-88-4, Molecular Weight: 388.2839, C20H10N2Na2O4, Purity:98, SMILES: O=C(C1=CC(C2=NC3=CC=CC=C3C(C([O-])=O)=C2)=NC4=CC=CC=C14)[O-].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Etravirine D4, CAS:1142095-93-9, Molecular Weight: 439.3014, C20H11D4BrN6O, Purity:98, SMILES: NC1=C(Br)C(OC2=C(C)C=C(C#N)C=C2C)=NC(NC3=C([2H])C([2H])=C(C#N)C([2H])=C3[2H])=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Amaranth, CAS:915-67-3, Molecular Weight: 604.473, C20H11N2Na3O10S3, Purity:98, SMILES: O=S(C1=C(O)C(N=NC2=C3C=CC=CC3=C(S(=O)([O-])=O)C=C2)=C4C=CC(S(=O)([O-])=O)=CC4=C1)([O-])=O.[Na+].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Ponceau 4R, CAS:2611-82-7, Molecular Weight: 604.473, C20H11N2Na3O10S3, Purity:98, SMILES: O=S(C1=C2C(/N=N/C3=C4C=CC=CC4=C(S(=O)([O-])=O)C=C3)=C(O)C=CC2=CC(S(=O)([O-])=O)=C1)([O-])=O.[Na+].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
DUBs-IN-1, CAS:924296-18-4, Molecular Weight: 337.3342, C20H11N5O, Purity:98, SMILES: N#CC1=C(C#N)N=C2C(/C(C3=C2C=CC=C3)=N/OCC4=CC=CC=C4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
HI-TOPK-032, CAS:487020-03-1, Molecular Weight: 369.39924, C20H11N5OS, Purity:98, SMILES: O=C(C1=CC=CS1)NC2=CC3=C(C#N)C4=NC5=CC=CC=C5N=C4N3C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzo[a]pyrene, CAS:50-32-8, Molecular Weight: 252.30928, C20H12, Purity:98, SMILES: C12=C(C=C3)C=C(C=CC=C4)C4=C1C=CC5=CC=CC3=C25, HPLC, NMR, LCMS is ok, stock more than 10g. |
TA-01, CAS:1784751-18-3, Molecular Weight: 351.3246, C20H12F3N3, Purity:98, SMILES: FC(C=C1)=CC=C1C2=C(C3=CC=NC=C3)NC(C4=C(F)C=CC=C4F)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
A-769662, CAS:844499-71-4, Molecular Weight: 360.3859, C20H12N2O3S, Purity:98, SMILES: N#CC1C(C2=C(NC1=O)SC=C2C3=CC=C(C4=CC=CC=C4O)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
[2,2'-Biquinoline]-4,4'-dicarboxylic acid, CAS:1245-13-2, Molecular Weight: 344.3203, C20H12N2O4, Purity:95, SMILES: OC(=O)c1cc(nc2c1cccc2)c1nc2ccccc2c(c1)C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Helioxanthin 8-1, CAS:840529-13-7, Molecular Weight: 376.3191, C20H12N2O6, Purity:98, SMILES: O=C1NNC(C2=C(C3=CC=C(OCO4)C4=C3)C5=C6C(OCO6)=CC=C5C=C21)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Fluorescein, CAS:2321-07-5, Molecular Weight: 332.3063, C20H12O5, Purity:98, SMILES: O=C1OC2(C3=C(OC4=C2C=CC(O)=C4)C=C(O)C=C3)C5=C1C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
9-Bromo-10-phenylanthracene , CAS:23674-20-6, Molecular Weight: 333.221, C20H13Br, Purity:95, SMILES: BrC1=C2C=CC=CC2=C(C2=CC=CC=C2)C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Oglemilast, CAS:778576-62-8, Molecular Weight: 516.3021, C20H13Cl2F2N3O5S, Purity:98, SMILES: O=C(C1=C2C(OC3=CC=C(NS(=O)(C)=O)C=C23)=C(OC(F)F)C=C1)NC4=C(Cl)C=NC=C4Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
GV-196771A, CAS:166974-23-8, Molecular Weight: 423.2246, C20H13Cl2N2NaO3, Purity:98, SMILES: O=C(C(N1)=C(/C=C2C(N(C3=CC=CC=C3)CC/2)=O)C4=C1C=C(Cl)C=C4Cl)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(1-(4-ChlorophenylCyclopropyl-3-Hydroxy-8-(TrifluoromethylQuinoline-4-Carboxylic Acid, CAS:1067186-56-4, Molecular Weight: 407.77, C20H13ClF3NO3, Purity:95, SMILES: OC(=O)C1=C2C=CC=C(C2=NC(=C1O)C1(CC1)C1=CC=C(Cl)C=C1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
TA-02, CAS:1784751-19-4, Molecular Weight: 333.3341, C20H13F2N3, Purity:98, SMILES: FC(C=C1)=CC=C1C2=C(C3=CC=NC=C3)NC(C4=CC=CC=C4F)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
AMG 517, CAS:659730-32-2, Molecular Weight: 430.4030296, C20H13F3N4O2S, Purity:98, SMILES: CC(NC1=NC2=C(OC3=NC=NC(C4=CC=C(C(F)(F)F)C=C4)=C3)C=CC=C2S1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Monepantel, CAS:887148-69-8, Molecular Weight: 473.3915392, C20H13F6N3O2S, Purity:98, SMILES: O=C(N[C@@](C)(C#N)COC1=CC(C#N)=CC=C1C(F)(F)F)C2=CC=C(SC(F)(F)F)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
PD 169316, CAS:152121-53-4, Molecular Weight: 360.3412, C20H13FN4O2, Purity:98, SMILES: FC(C=C1)=CC=C1C2=C(C3=CC=NC=C3)NC(C4=CC=C([N+]([O-])=O)C=C4)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pim1/AKK1-IN-1, CAS:1093222-27-5, Molecular Weight: 339.3501, C20H13N5O, Purity:98, SMILES: N#CC1=CC=C(C2=CN=C3C(C(NC(C4=CC=CN=C4)=O)=CN3)=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
5(6)-Aminofluorescein, CAS:27599-63-9, Molecular Weight: 347.32, C20H13NO5, Purity:98, SMILES: NC(C=C1)=CC2=C1C3(OC2=O)C(C=CC(O)=C4)=C4OC5=C3C=CC(O)=C5.O=C(C6=C7C=C(N)C=C6)OC87C(C=CC(O)=C9)=C9OC%10=C8C=CC(O)=C%10, HPLC, NMR, LCMS is ok, stock more than 10g. |
5-Aminofluorescein, CAS:3326-34-9, Molecular Weight: 347.3209, C20H13NO5, Purity:98, SMILES: O=C1OC2(C3=C(OC4=C2C=CC(O)=C4)C=C(O)C=C3)C5=C1C=C(N)C=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
6-Aminofluorescein, CAS:51649-83-3, Molecular Weight: 347.3209, C20H13NO5, Purity:98, SMILES: O=C1OC2(C3=C(OC4=C2C=CC(O)=C4)C=C(O)C=C3)C5=C1C=CC(N)=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
Helioxanthin derivative 5-4-2, CAS:203935-39-1, Molecular Weight: 347.3209, C20H13NO5, Purity:98, SMILES: O=C1NCC2=C(C3=CC=C(OCO4)C4=C3)C5=C6C(OCO6)=CC=C5C=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
9,10-dihydro-9,10-[1,2]benzenoanthracene, CAS:477-75-8, Molecular Weight: 254.3252, C20H14, Purity:95, SMILES: c1ccc2C3c4ccccc4C(c2c1)c1ccccc31, HPLC, NMR, LCMS is ok, stock more than 10g. |
L-779450, CAS:303727-31-3, Molecular Weight: 347.7977, C20H14ClN3O, Purity:98, SMILES: OC1=CC(C2=C(C3=CC=NC=C3)N=C(C4=CC=CC=C4)N2)=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
BML-277, CAS:516480-79-8, Molecular Weight: 363.7971, C20H14ClN3O2, Purity:98, SMILES: ClC(C=C1)=CC=C1OC(C=C2)=CC=C2C3=NC4=CC(C(N)=O)=CC=C4N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sanguinarine (chloride), CAS:5578-73-4, Molecular Weight: 367.7825, C20H14ClNO4, Purity:98, SMILES: C[N+]1=CC2=C3C(OCO3)=CC=C2C(C=CC4=C5)=C1C4=CC6=C5OCO6.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
NIH-12848, CAS:959551-10-1, Molecular Weight: 385.4054696, C20H14F3N3S, Purity:98, SMILES: FC(C1=CC=CC=C1C2=NC(NCC3=CC=CS3)=C4C=CC=CC4=N2)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
N-desmethyl Enzalutamide, CAS:1242137-16-1, Molecular Weight: 450.4094, C20H14F4N4O2S, Purity:98, SMILES: S=C(N1C2=CC(F)=C(C(N)=O)C=C2)N(C3=CC=C(C(C(F)(F)F)=C3)C#N)C(C(C)1C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
SB 202190, CAS:152121-30-7, Molecular Weight: 331.343, C20H14FN3O, Purity:98, SMILES: FC1=CC=C(C2=C(C3=CC=NC=C3)NC(C4=CC=C(O)C=C4)=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Phenyl(1-(phenylsulfonyl)-1H-pyrrolo[2,3-b]pyridin-2-yl)methanone, CAS:1198283-74-7, Molecular Weight: 362.402, C20H14N2O3S, Purity:95, SMILES: O=C(c1cc2c(n1S(=O)(=O)c1ccccc1)nccc2)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
WST-8, CAS:193149-74-5, Molecular Weight: 601.478, C20H14N6NaO11S2+, Purity:98, SMILES: O=[N+](C1=CC=C(N2N=C(C3=CC=C(S(=O)(O)=O)C=C3S(=O)([O-])=O)N=[N+]2C4=CC=C([N+]([O-])=O)C=C4OC)C=C1)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Sanguinarine, CAS:2447-54-3, Molecular Weight: 332.3289, C20H14NO4+, Purity:98, SMILES: C[N+]1=CC2=C3C(OCO3)=CC=C2C(C=CC4=C5)=C1C4=CC6=C5OCO6, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-[1,1'-Binaphthalene]-2,2'-diol, CAS:18531-99-2, Molecular Weight: 286.324, C20H14O2, Purity:98, SMILES: Oc1ccc2c(c1c1c(O)ccc3c1cccc3)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
[1,1'-binaphthalene]-2,2'-diol, CAS:18531-94-7, Molecular Weight: 286.324, C20H14O2, Purity:95, SMILES: Oc1ccc2ccccc2c1-c1c(O)ccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
[1,1'-binaphthalene]-2,2'-diol, CAS:602-09-5, Molecular Weight: 286.324, C20H14O2, Purity:95, SMILES: Oc1ccc2ccccc2c1-c1c(O)ccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
IPA-3, CAS:42521-82-4, Molecular Weight: 350.4539, C20H14O2S2, Purity:98, SMILES: OC1=CC=C2C=CC=CC2=C1SSC3=C4C=CC=CC4=CC=C3O, HPLC, NMR, LCMS is ok, stock more than 10g. |
10-Phenylanthracene-9-boronic acid, CAS:334658-75-2, Molecular Weight: 298.143, C20H15BO2, Purity:95, SMILES: OB(c1c2ccccc2c(c2c1cccc2)c1ccccc1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Etravirine, CAS:269055-15-4, Molecular Weight: 435.2767, C20H15BrN6O, Purity:98, SMILES: N#CC1=CC(C)=C(C(C)=C1)OC2=NC(NC3=CC=C(C=C3)C#N)=NC(N)=C2Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
CPDA, CAS:1415834-63-7, Molecular Weight: 388.7951, C20H15ClF2N2O2, Purity:98, SMILES: O=C(NC1=NC=CC(OCC2=CC=C(Cl)C=C2)=C1)CC3=C(F)C=CC=C3F, HPLC, NMR, LCMS is ok, stock more than 10g. |
Pexidartinib, CAS:1029044-16-3, Molecular Weight: 417.8148, C20H15ClF3N5, Purity:98, SMILES: FC(C1=CC=C(CNC2=NC=C(CC3=CNC4=NC=C(Cl)C=C43)C=C2)C=N1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
5-(3-CHLORO-4-FLUOROPHENYL)-3-METHYL-3-(PYRIMIDIN-5-YLMETHYL)INDOLIN-2-ONE, CAS:1141080-83-2, Molecular Weight: 367.804, C20H15ClFN3O, Purity:95, SMILES: CC1(Cc2cncnc2)C(=O)Nc2ccc(cc12)-c1ccc(F)c(Cl)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Rhodamine 110, CAS:13558-31-1, Molecular Weight: 366.7977, C20H15ClN2O3, Purity:98, SMILES: O=C(C1=CC=CC=C1C2=C3C=CC(N)=CC3=[O+]C4=C2C=CC(N)=C4)O.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Vatalanib (free base), CAS:212141-54-3, Molecular Weight: 346.8129, C20H15ClN4, Purity:98, SMILES: ClC1=CC=C(C=C1)NC2=NN=C(CC3=CC=NC=C3)C4=C2C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Senicapoc, CAS:289656-45-7, Molecular Weight: 323.336, C20H15F2NO, Purity:98, SMILES: O=C(C(C1=CC=CC=C1)(C2=CC=C(C=C2)F)C3=CC=C(F)C=C3)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Lorediplon, CAS:917393-39-6, Molecular Weight: 394.4221, C20H15FN4O2S, Purity:98, SMILES: CC(N(C1=CC(C2=CC=NC3=C(C(C4=CC=CS4)=O)C=NN23)=CC=C1F)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Kartogenin, CAS:4727-31-5, Molecular Weight: 317.338, C20H15NO3, Purity:98, SMILES: O=C(O)C1=CC=CC=C1C(NC2=CC=C(C3=CC=CC=C3)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Oxyphenisatine, CAS:125-13-3, Molecular Weight: 317.338, C20H15NO3, Purity:98, SMILES: O=C1NC2=C(C=CC=C2)C1(C3=CC=C(O)C=C3)C4=CC=C(O)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Dihydrosanguinarine, CAS:3606-45-9, Molecular Weight: 333.3374, C20H15NO4, Purity:98, SMILES: CN1C2=C(C=C(OCO3)C3=C4)C4=CC=C2C5=CC=C6C(OCO6)=C5C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
RS-1, CAS:312756-74-4, Molecular Weight: 524.2256, C20H16Br2N2O3S, Purity:98, SMILES: O=C(NC1=CC=C(Br)C=C1)C2=CC=C(Br)C(S(=O)(NCC3=CC=CC=C3)=O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Histone Acetyltransferase Inhibitor II, CAS:932749-62-7, Molecular Weight: 464.1472, C20H16Br2O3, Purity:98, SMILES: O=C1/C(CCC/C1=C\C2=CC=C(O)C(Br)=C2)=C/C3=CC=C(O)C(Br)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
7-BROMO-2-(3-(PYRIMIDIN-2-YL)PHENETHYL)ISOINDOLIN-1-ONE, CAS:1417190-47-6, Molecular Weight: 394.265, C20H16BrN3O, Purity:95, SMILES: Brc1cccc2CN(CCc3cccc(c3)-c3ncccn3)C(=O)c12, HPLC, NMR, LCMS is ok, stock more than 10g. |
NSC5844, CAS:140926-75-6, Molecular Weight: 383.2738, C20H16Cl2N4, Purity:98, SMILES: ClC1=CC=C2C(NCCNC3=CC=NC4=CC(Cl)=CC=C34)=CC=NC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sertaconazole (nitrate), CAS:99592-39-9, Molecular Weight: 500.7827, C20H16Cl3N3O4S, Purity:98, SMILES: ClC1=CC=C(C(OCC2=CSC3=C(Cl)C=CC=C32)CN4C=CN=C4)C(Cl)=C1.O[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
RAD140, CAS:1182367-47-0, Molecular Weight: 393.82634, C20H16ClN5O2, Purity:98, SMILES: ClC1=C(C)C(N[C@]([H])([C@@]([H])(O)C)C2=NN=C(O2)C3=CC=C(C#N)C=C3)=CC=C1C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
Telatinib, CAS:332012-40-5, Molecular Weight: 409.8257, C20H16ClN5O3, Purity:98, SMILES: O=C(C1=NC=CC(COC2=NN=C(NC3=CC=C(Cl)C=C3)C4=C2OC=C4)=C1)NC, HPLC, NMR, LCMS is ok, stock more than 10g. |
Prochlorperazine D8, CAS:1215641-01-2, Molecular Weight: 381.9919, C20H16D8ClN3S, Purity:98, SMILES: ClC(C=C1)=CC2=C1SC3=CC=CC=C3N2CCCN4C([2H])([2H])C([2H])([2H])N(C)C([2H])([2H])C4([2H])[2H], HPLC, NMR, LCMS is ok, stock more than 10g. |
N-(4-Fluoro-2-Methoxy-5-Nitrophenyl-4-(1-Methyl-1H-Indol-3-YlPyrimidin-2-Amine, CAS:1421372-94-2, Molecular Weight: 393.3711, C20H16FN5O3, Purity:95, SMILES: COC1=CC(F)=C(C=C1NC1=NC=CC(=N1)C1=CN(C)C2=CC=CC=C12)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(R)-[1,1'-Binaphthalene]-2,2'-diamine, CAS:18741-85-0, Molecular Weight: 284.3544, C20H16N2, Purity:95, SMILES: Nc1ccc2ccccc2c1-c1c(N)ccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
[1,1'-binaphthalene]-2,2'-diamine, CAS:4488-22-6, Molecular Weight: 284.3544, C20H16N2, Purity:95, SMILES: Nc1ccc2ccccc2c1-c1c(N)ccc2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Verinurad, CAS:1352792-74-5, Molecular Weight: 348.4182, C20H16N2O2S, Purity:98, SMILES: CC(C)(SC1=C(C2=C3C=CC=CC3=C(C#N)C=C2)C=NC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
1-Benzyl-3-(5-methoxycarbonyl-2-furyl)indazole, CAS:170632-13-0, Molecular Weight: 332.3526, C20H16N2O3, Purity:95, SMILES: COC(=O)c1ccc(o1)c1nn(c2c1cccc2)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-4-ethyl-4-hydroxy-1H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14(4H,12H)-dione, CAS:2114454, Molecular Weight: 348.352, C20H16N2O4, Purity:95, SMILES: CC[C@@]1(O)C(=O)OCc2c1cc1-c3nc4ccccc4cc3Cn1c2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Campathecin, CAS:7689-03-4, Molecular Weight: 348.3521, C20H16N2O4, Purity:98, SMILES: O=C1C2=C([C@@](O)(CC)C(OC2)=O)C=C(N1C3)C(C3=C4)=NC5=C4C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
RN-18, CAS:431980-38-0, Molecular Weight: 380.41704, C20H16N2O4S, Purity:98, SMILES: O=C(NC1=CC=CC=C1OC)C2=CC=CC=C2SC3=CC=C([N+]([O-])=O)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-10-Hydroxycamptothecin, CAS:19685-09-7, Molecular Weight: 364.3514, C20H16N2O5, Purity:98, SMILES: O=C1[C@](O)(CC)C2=C(CO1)C(N3CC4=CC5=CC(O)=CC=C5N=C4C3=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-10-Hydroxycamptothecin, CAS:19685-09-7, Molecular Weight: 364.3514, C20H16N2O5, Purity:98, SMILES: CC[C@@]1(O)C(=O)OCc2c1cc1-c3nc4ccc(O)cc4cc3Cn1c2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
10-Hydroxycamptothecin, CAS:19685-09-7, Molecular Weight: 364.3514, C20H16N2O5, Purity:95, SMILES: CC[C@@]1(O)C(=O)OCC2=C1C=C1N(CC3=C1N=C1C=CC(O)=CC1=C3)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
TCS JNK 5a, CAS:312917-14-9, Molecular Weight: 332.4189, C20H16N2OS, Purity:98, SMILES: O=C(C1=C2C=CC=CC2=CC=C1)NC3=C(C#N)C(CCCC4)=C4S3, HPLC, NMR, LCMS is ok, stock more than 10g. |
LDN-27219, CAS:312946-37-5, Molecular Weight: 408.4966, C20H16N4O2S2, Purity:98, SMILES: O=C1N(C2=CC=CC=C2)C(SCC(NN)=O)=NC3=C1C(C4=CC=CC=C4)=CS3, HPLC, NMR, LCMS is ok, stock more than 10g. |
NVP-BVU972, CAS:1185763-69-2, Molecular Weight: 340.3812, C20H16N6, Purity:98, SMILES: CN1N=CC(C2=NN3C(C=C2)=NC=C3CC4=CC=C(N=CC=C5)C5=C4)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
CH5183284, CAS:1265229-25-1, Molecular Weight: 356.3806, C20H16N6O, Purity:98, SMILES: O=C(C1=C(N)N(C2=CC=C3N=C(C)NC3=C2)N=C1)C(N4)=CC5=C4C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
AS601245, CAS:345987-15-7, Molecular Weight: 372.4462, C20H16N6S, Purity:98, SMILES: N#CC(C1=CC=NC(NCCC2=CC=CN=C2)=N1)C3=NC4=CC=CC=C4S3, HPLC, NMR, LCMS is ok, stock more than 10g. |
2,2,2-triphenylacetic acid, CAS:595-91-5, Molecular Weight: 288.3398, C20H16O2, Purity:95, SMILES: OC(=O)C(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Triphenylacetic acid, CAS:595-91-5, Molecular Weight: 288.3398, C20H16O2, Purity:95, SMILES: OC(=O)C(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Corylin, CAS:53947-92-5, Molecular Weight: 320.3387, C20H16O4, Purity:98, SMILES: O=C1C(C2=CC=C3C(C=CC(C)(C)O3)=C2)=COC4=CC(O)=CC=C14, HPLC, NMR, LCMS is ok, stock more than 10g. |
Psoralidin, CAS:18642-23-4, Molecular Weight: 336.338, C20H16O5, Purity:98, SMILES: O=C1C2=C(OC3=CC(O)=CC=C32)C4=CC(C/C=C(C)\C)=C(O)C=C4O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
CHIR-98014, CAS:252935-94-7, Molecular Weight: 486.31408, C20H17Cl2N9O2, Purity:98, SMILES: ClC1=CC(Cl)=CC=C1C2=NC(NCCNC3=CC=C([N+]([O-])=O)C(N)=N3)=NC=C2N4C=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
Vatalanib (dihydrochloride), CAS:212141-51-0, Molecular Weight: 419.7348, C20H17Cl3N4, Purity:98, SMILES: ClC1=CC=C(C=C1)NC2=NN=C(C3=C2C=CC=C3)CC4=CC=NC=C4.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
BMS-708163, CAS:1146699-66-2, Molecular Weight: 520.885, C20H17ClF4N4O4S, Purity:98, SMILES: O=S(N([C@@H](C(N)=O)CCC(F)(F)F)CC1=CC=C(C2=NOC=N2)C=C1F)(C3=CC=C(Cl)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ketazolam, CAS:27223-35-4, Molecular Weight: 368.8136, C20H17ClN2O3, Purity:98, SMILES: O=C1C=C(C)OC2(C3=CC=CC=C3)N1CC(N(C)C4=CC=C(Cl)C=C24)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(Chloro(4-methoxyphenyl)methylene)dibenzene, CAS:14470-28-1, Molecular Weight: 308.801, C20H17ClO, Purity:95, SMILES: COc1ccc(cc1)C(c1ccccc1)(c1ccccc1)Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
ADX-47273, CAS:851881-60-2, Molecular Weight: 369.3647, C20H17F2N3O2, Purity:98, SMILES: O=C(C1=CC=C(F)C=C1)N2C[C@@H](C3=NC(C4=CC=C(F)C=C4)=NO3)CCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
DBCO-Amine TFA, CAS:0, Molecular Weight: 390.3558, C20H17F3N2O3, Purity:95, SMILES: OC(=O)C(F)(F)F.NCCC(=O)N1CC2=CC=CC=C2C#CC2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tasquinimod, CAS:254964-60-8, Molecular Weight: 406.3552, C20H17F3N2O4, Purity:98, SMILES: O=C(C1=C(O)C2=C(N(C)C1=O)C=CC=C2OC)N(C)C3=CC=C(C(F)(F)F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
BMY-43748, CAS:132195-65-4, Molecular Weight: 418.3692, C20H17F3N4O3, Purity:98, SMILES: O=C(C1=CN(C2=CC=C(F)C=C2F)C3=C(C(C)=C(F)C(N4C[C@@H](N)CC4)=N3)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
GNF-5, CAS:778277-15-9, Molecular Weight: 418.3692, C20H17F3N4O3, Purity:98, SMILES: FC(F)(F)OC(C=C1)=CC=C1NC2=NC=NC(C3=CC=CC(C(NCCO)=O)=C3)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
BAY 41-2272, CAS:256376-24-6, Molecular Weight: 360.3876, C20H17FN6, Purity:98, SMILES: NC1=NC(C2=NN(CC3=CC=CC=C3F)C4=NC=CC=C42)=NC=C1C5CC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
6-amino-2-(1-(2-fluorobenzyl)-1H-pyrazolo[3,4-b]pyridin-3-yl)-7,9-dimethyl-7H-purin-8(9H)-one, CAS:, Molecular Weight: 404.4004, C20H17FN8O, Purity:95, SMILES: O=C1N(C)C2=C(N)N=C(C3=NN(CC4=CC=CC=C4F)C5=NC=CC=C53)N=C2N1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sulindac, CAS:38194-50-2, Molecular Weight: 356.4106, C20H17FO3S, Purity:98, SMILES: O=C(CC(C1=C2C=CC(F)=C1)=C(/C2=C/C3=CC=C(C=C3)S(C)=O)C)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
((2R,3R,4R)-3-(benzoyloxy)-4-fluoro-4-methyl-5-oxotetrahydrofuran-2-yl)methyl benzoate, CAS:874638-80-9, Molecular Weight: 372.3438, C20H17FO6, Purity:97, SMILES: C[C@@]1(F)[C@H](OC(=O)c2ccccc2)[C@@H](COC(=O)c2ccccc2)OC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(((2-iodo-1,3-phenylene)bis(oxy))bis(methylene))dibenzene, CAS:888968-41-0, Molecular Weight: 416.2523, C20H17IO2, Purity:99, SMILES: Ic1c(OCc2ccccc2)cccc1OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
9-Aminocamptothecin, CAS:91421-43-1, Molecular Weight: 363.3667, C20H17N3O4, Purity:98, SMILES: O=C1[C@](O)(CC)C2=C(CO1)C(N3CC4=CC5=C(N)C=CC=C5N=C4C3=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Balaglitazone, CAS:199113-98-9, Molecular Weight: 395.4317, C20H17N3O4S, Purity:98, SMILES: O=C(N1)SC(CC2=CC=C(OCC(N3C)=NC4=C(C=CC=C4)C3=O)C=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
5-Methoxy-4-((4-(1-Methyl-1H-Indol-3-YlPyrimidin-2-YlAmino-2-Nitrophenol, CAS:0, Molecular Weight: 391.3801, C20H17N5O4, Purity:95, SMILES: COC1=CC(O)=C(C=C1NC1=NC=CC(=N1)C1=CN(C)C2=CC=CC=C12)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
GDP366, CAS:501698-03-9, Molecular Weight: 375.44688, C20H17N5OS, Purity:98, SMILES: O=C(NC1=CC=CC(C)=C1)NC2=CC=C(C3=CSC4=NC=NC(N)=C43)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
FT011, CAS:1001288-58-9, Molecular Weight: 351.3527, C20H17NO5, Purity:98, SMILES: O=C(O)C1=CC=CC=C1NC(/C=C/C2=CC=C(OCC#C)C(OC)=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(+)-Bicuculline, CAS:485-49-4, Molecular Weight: 367.3521, C20H17NO6, Purity:98, SMILES: O=C1O[C@@H]([C@H]2N(C)CCC3=C2C=C(OCO4)C4=C3)C5=CC=C(OCO6)C6=C51, HPLC, NMR, LCMS is ok, stock more than 10g. |
2-(Triphenylphosphoranylidene)acetaldehyde, CAS:2136-75-6, Molecular Weight: 304.3221, C20H17OP, Purity:95, SMILES: O=CC=P(c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
KR-33494, CAS:1021497-97-1, Molecular Weight: 460.3442, C20H18BrN3O3S, Purity:98, SMILES: OC(C1=NN(CCC2=CC=CC=C2)C=C1NC(CSC3=CC=C(Br)C=C3)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
4-bromo-N,N-bis(4-methoxyphenyl)aniline, CAS:194416-45-0, Molecular Weight: 384.266, C20H18BrNO2, Purity:95, SMILES: COc1ccc(cc1)N(c1ccc(Br)cc1)c1ccc(OC)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Sarafloxacin (hydrochloride), CAS:91296-87-6, Molecular Weight: 421.825, C20H18ClF2N3O3, Purity:98, SMILES: O=C(C1=CN(C2=CC=C(F)C=C2)C3=C(C=C(F)C(N4CCNCC4)=C3)C1=O)O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
Asciminib, CAS:1492952-76-7, Molecular Weight: 449.8384264, C20H18ClF2N5O3, Purity:98, SMILES: O=C(C1=CC(C2=NNC=C2)=C(N3C[C@H](O)CC3)N=C1)NC4=CC=C(OC(F)(Cl)F)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
GPR120 modulator 2, CAS:1050506-87-0, Molecular Weight: 387.8798, C20H18ClNO3S, Purity:98, SMILES: O=C(O)CCC1=CC=C(OCC2=NC(C3=CC=CC=C3Cl)=CS2)C=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
Berberine (chloride), CAS:633-65-8, Molecular Weight: 371.8142, C20H18ClNO4, Purity:98, SMILES: COC1=C(OC)C2=C[N+]3=C(C(C(CC3)=C4)=CC5=C4OCO5)C=C2C=C1.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Epiberberine (chloride), CAS:889665-86-5, Molecular Weight: 371.8142, C20H18ClNO4, Purity:98, SMILES: COC1=C(OC)C=C2C(CC[N+]3=C2C=C(C=C4)C(C5=C4OCO5)=C3)=C1.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Dolutegravir (sodium), CAS:1051375-19-9, Molecular Weight: 441.3606, C20H18F2N3NaO5, Purity:98, SMILES: O=C(C1=CN(C2=C([O-])C1=O)C[C@]3([H])OCC[C@@H](C)N3C2=O)NCC4=CC=C(F)C=C4F.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
DFMTI, CAS:864864-86-8, Molecular Weight: 368.3799, C20H18F2N4O, Purity:98, SMILES: O=C(N(C(C)C)C1)C2=C1C=C(C3=C(C)N(C4=CC=C(F)C=C4F)N=N3)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
MK-5046, CAS:1022152-70-0, Molecular Weight: 444.3735392, C20H18F6N4O, Purity:98, SMILES: O[C@](CC1=NC(CC2(C(F)(F)F)CC2)=CN1)(C(F)(F)F)C3=CC=C(N4C=CC=N4)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
[1,1'-Biphenyl]-3-carboxamide, 6-(1-aminoethyl)-4'-fluoro-N-4-pyridinyl-, CAS:934387-35-6, Molecular Weight: 335.3748232, C20H18FN3O, Purity:98, SMILES: O=C(C1=CC(C2=CC=C(F)C=C2)=C(C(N)C)C=C1)NC3=CC=NC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
R-268712, CAS:879487-87-3, Molecular Weight: 363.3882, C20H18FN5O, Purity:98, SMILES: FC1=C(C2=CN(CCO)N=C2)C=C(C3=CNN=C3C4=CC=CC(C)=N4)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
NVP-HSP990, CAS:934343-74-5, Molecular Weight: 379.3876, C20H18FN5O2, Purity:98, SMILES: CC1=C2C(C[C@H](C3=C(C4=NC(OC)=CC=C4)C=C(F)C=C3)NC2=O)=NC(N)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Benzenesulfonamide, 5-[[5-fluoro-4-[[4-(2-propyn-1-yloxy)phenyl]amino]-2-pyrimidinyl]amino]-2-methyl-, CAS:916741-98-5, Molecular Weight: 427.4520232, C20H18FN5O3S, Purity:98, SMILES: O=S(C1=CC(NC2=NC=C(F)C(NC3=CC=C(OCC#C)C=C3)=N2)=CC=C1C)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Vidofludimus, CAS:717824-30-1, Molecular Weight: 355.3596, C20H18FNO4, Purity:98, SMILES: O=C(C1=C(C(NC2=CC=C(C3=CC=CC(OC)=C3)C=C2F)=O)CCC1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nile Red, CAS:7385-67-3, Molecular Weight: 318.3691, C20H18N2O2, Purity:98, SMILES: O=C1C2=CC=CC=C2C3=NC4=CC=C(N(CC)CC)C=C4OC3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
HMN-154, CAS:173528-92-2, Molecular Weight: 366.43352, C20H18N2O3S, Purity:98, SMILES: O=S(C1=CC=C(OC)C=C1)(NC2=CC=CC=C2/C=C/C3=CC=NC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
HMN-176, CAS:173529-10-7, Molecular Weight: 382.4329, C20H18N2O4S, Purity:98, SMILES: O=S(C1=CC=C(OC)C=C1)(NC2=CC=CC=C2/C=C/C3=CC=N(C=C3)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ac-CoA Synthase Inhibitor1, CAS:508186-14-9, Molecular Weight: 410.51252, C20H18N4O2S2, Purity:98, SMILES: O=C(NCCOC)NC1=CC=C2N=C(C3=CC=CS3)C(C4=CC=CS4)=NC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
N,N'-Bis-Z-1-Guanylpyrazole, CAS:152120-55-3, Molecular Weight: 378.3813, C20H18N4O4, Purity:95, SMILES: O=C(N\C(=N\C(=O)OCc1ccccc1)n1cccn1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Moxalactam (sodium salt), CAS:64953-12-4, Molecular Weight: 564.4363, C20H18N6Na2O9S, Purity:98, SMILES: O=C(C(N12)=C(CSC3=NN=NN3C)CO[C@]2([H])[C@](OC)(NC([C@H](C([O-])=O)C4=CC=C(O)C=C4)=O)C1=O)[O-].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
Rhosin, CAS:1173671-63-0, Molecular Weight: 358.3965, C20H18N6O, Purity:98, SMILES: O=C(N/N=C/C1=CC=C2N=CC=NC2=C1)[C@H](N)CC3=CNC4=C3C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
BAY 61-3606, CAS:732983-37-8, Molecular Weight: 390.3953, C20H18N6O3, Purity:98, SMILES: O=C(C1=CC=CN=C1NC2=NC(C3=CC=C(OC)C(OC)=C3)=CC4=NC=CN24)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S,3S)-2,3-Bis((4-methoxybenzoyl)oxy)succinic acid, CAS:191605-10-4, Molecular Weight: 418.3509, C20H18O10, Purity:99, SMILES: COc1ccc(cc1)C(=O)O[C@@H]([C@H](OC(=O)c1ccc(OC)cc1)C(O)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Bifendate, CAS:73536-69-3, Molecular Weight: 418.3509, C20H18O10, Purity:98, SMILES: COC(=O)c1cc(OC)c2OCOc2c1-c1c2OCOc2c(OC)cc1C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
(S)-(-)-1,1,2-Triphenylethane-1,2-diol, CAS:108998-83-0, Molecular Weight: 290.3557, C20H18O2, Purity:95, SMILES: O[C@@H](C1=CC=CC=C1)C(O)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
Neobavaisoflavone, CAS:41060-15-5, Molecular Weight: 322.3545, C20H18O4, Purity:98, SMILES: O=C1C(C2=CC=C(O)C(C/C=C(C)\C)=C2)=COC3=CC(O)=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
Demethoxycurcumin, CAS:22608-11-3, Molecular Weight: 338.3539, C20H18O5, Purity:98, SMILES: O=C(CC(/C=C/C1=CC=C(O)C=C1)=O)/C=C/C2=CC=C(O)C(OC)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2R,3R)-2,3-Bis((4-methylbenzoyl)oxy)succinic acid, CAS:32634-66-5, Molecular Weight: 386.3521, C20H18O8, Purity:96, SMILES: Cc1ccc(cc1)C(=O)O[C@H]([C@@H](OC(=O)c1ccc(C)cc1)C(O)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
(2S,3S)-2,3-Bis((4-methylbenzoyl)oxy)succinic acid, CAS:32634-68-7, Molecular Weight: 386.3521, C20H18O8, Purity:96, SMILES: Cc1ccc(cc1)C(=O)O[C@@H]([C@H](OC(=O)c1ccc(C)cc1)C(O)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
9-(4-bromobutyl)-N-(2,2,2-trifluoroethyl)-9H-fluorene-9-carboxamide, CAS:182438-98-8, Molecular Weight: 426.27, C20H19BrF3NO, Purity:95, SMILES: BrCCCCC1(C(=O)NCC(F)(F)F)c2ccccc2c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
YM-155, CAS:781661-94-7, Molecular Weight: 443.2939, C20H19BrN4O3, Purity:98, SMILES: O=C1C2=C(C(C3=CC=CC=C31)=O)[N+](CC4=NC=CN=C4)=C(C)N2CCOC.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
Ethanone, 1-[4-[5-(4-chloro-2-fluorophenyl)-4-(4-pyrimidinyl)-1H-pyrazol-3-yl]-1-piperidinyl]-2-hydroxy-, CAS:635725-16-5, Molecular Weight: 415.8485632, C20H19ClFN5O2, Purity:98, SMILES: O=C(N1CCC(C2=NNC(C3=CC=C(Cl)C=C3F)=C2C4=NC=NC=C4)CC1)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
MK-8745, CAS:885325-71-3, Molecular Weight: 431.9142, C20H19ClFN5OS, Purity:98, SMILES: O=C(C1=CC=CC(Cl)=C1F)N2CCN(CC3=NC(NC4=NC=CS4)=CC=C3)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
Tonabersat, CAS:175013-84-0, Molecular Weight: 391.8206, C20H19ClFNO4, Purity:98, SMILES: O[C@@H]1C(C)(C)OC2=CC=C(C(C)=O)C=C2[C@@H]1NC(C3=CC(Cl)=C(F)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
A-867744, CAS:1000279-69-5, Molecular Weight: 402.8945, C20H19ClN2O3S, Purity:98, SMILES: O=S(C1=CC=C(C=C1)N2C(C)=C(C=C2C3=CC=C(C=C3)Cl)C(CC)=O)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
YM-155 (hydrochloride), CAS:355406-09-6, Molecular Weight: 398.8429, C20H19ClN4O3, Purity:98, SMILES: O=C(C1=C2[N+](CC3=NC=CN=C3)=C(C)N1CCOC)C4=C(C=CC=C4)C2=O.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g.
EOS Med Chem, Medchem is Big
執大象,天下往,往而無害,安平泰
2018. 4.18 Janpan CPHI, Attend
2018. 5.15 Israel Biomed, Attend
2018. 6. 20 China CPHI, W4E82
2018. 8. 28 Korea CPHI, Attend
2018. 10. 9 Spain World CPHI, Attend
郵箱: info@eosmedchem.com ; eosmedchem@gmail.com
辦公室: 0086-531-69905422-806(直通)
攜帶番號 & WhatsApp & Wechat: +8618653174435
住所: Diaozhen Chemical Industrial Park, Jinan City, China
Skype: willgutian
QQ: 2393923585
|