| GNE-493, CAS:1033735-94-2, Molecular Weight: 372.4447, C17H20N6O2S, Purity:98, SMILES: OC(C)(C)C1=CC2=C(S1)C(N3CCOCC3)=NC(C4=CN=C(N)N=C4)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| T338C Src-IN-1, CAS:1351926-90-3, Molecular Weight: 372.4447, C17H20N6O2S, Purity:98, SMILES: NC1=C2C(N(C(C)C)N=C2CC3=CC(NS(=O)(C=C)=O)=CC=C3)=NC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(6-AMINO-9H-PURIN-9-YL)-4-(BENZYLAMINO)-5-(HYDROXYMETHYL)TETRAHYDROFURAN-3-OL, CAS:67313-10-4, Molecular Weight: 356.3791, C17H20N6O3, Purity:95, SMILES: Nc1ncnc2n(cnc12)C1OC(CO)C(NCc2ccccc2)C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-[(4-Aminophenyl)methyl]adenosine, CAS:95523-13-0, Molecular Weight: 372.3785, C17H20N6O4, Purity:98, SMILES: OC[C@@H]1[C@H]([C@H]([C@H](N2C=NC3=C2N=CN=C3NCC4=CC=C(N)C=C4)O1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bromosporine, CAS:1619994-69-2, Molecular Weight: 404.4435, C17H20N6O4S, Purity:98, SMILES: O=C(OCC)NC1=CC(C2=CC=C(C)C(NS(=O)(C)=O)=C2)=NN3C1=NN=C3C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ruxolitinib (sulfate), CAS:1092939-16-6, Molecular Weight: 404.4435, C17H20N6O4S, Purity:98, SMILES: [H][C@@](C1CCCC1)(N2N=CC(C3=C4C=CNC4=NC=N3)=C2)CC#N.O=S(O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MRK-016, CAS:342652-67-9, Molecular Weight: 368.3931, C17H20N8O2, Purity:98, SMILES: CN1N=CN=C1COC2=NN3C(C4=NOC(C)=C4)=NN=CC3=C2C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenemethanol, a-(2,6-dimethylphenyl)-2,6-dimethyl- (9CI), CAS:22004-65-5, Molecular Weight: 240.3401, C17H20O, Purity:95, SMILES: OC(c1c(C)cccc1C)c1c(C)cccc1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4AS,8AR)-8A-BENZYLHEXAHYDRONAPHTHALENE-1,6(2H,7H)-DIONE, CAS:1050169-98-6, Molecular Weight: 256.3395, C17H20O2, Purity:95, SMILES: [H][C@@]12CCCC(=O)[C@@]1(Cc1ccccc1)CCC(=O)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| U66858, CAS:99107-52-5, Molecular Weight: 272.3389, C17H20O3, Purity:98, SMILES: COC1=C2C=CC=CC2=C(OC(C)=O)C(CCCC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-methoxyphenoxy)-1-(4-methoxyphenyl)propane-1,3-diol, CAS:92409-15-9, Molecular Weight: 304.3377, C17H20O5, Purity:95, SMILES: COc1ccc(cc1)C(O)C(CO)Oc1ccccc1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-3-(benzyloxy-2-hydroxypropyl 4-methylbenzenesulfonate, CAS:16495-04-8, Molecular Weight: 336.403, C17H20O5S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OC[C@@H](O)COCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Firocoxib, CAS:189954-96-9, Molecular Weight: 336.4027, C17H20O5S, Purity:98, SMILES: O=C1OC(C)(C)C(C2=CC=C(S(=O)(C)=O)C=C2)=C1OCC3CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (E)-6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-1,3-dihydroisobenzofuran-5-yl)-4-methylhex-4-enoic acid, CAS:24280-93-1, Molecular Weight: 320.3371, C17H20O6, Purity:95, SMILES: COc1c(C)c2COC(=O)c2c(O)c1C\C=C(/C)CCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mycophenolic acid, CAS:24280-93-1, Molecular Weight: 320.3371, C17H20O6, Purity:98, SMILES: O=C(O)CC/C(C)=C/CC1=C(O)C2=C(COC2=O)C(C)=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MKC9989, CAS:1338934-20-5, Molecular Weight: 336.3365, C17H20O7, Purity:98, SMILES: O=CC1=C(O2)C(C(C)=C(CCOCCOC)C2=O)=CC(OC)=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4'-(pentyloxy)-[1,1'-biphenyl]-4-yl)boronic acid, CAS:158937-25-8, Molecular Weight: 284.158, C17H21BO3, Purity:95, SMILES: CCCCCOc1ccc(cc1)-c1ccc(cc1)B(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(5-Bromo-2-fluorobenzoyl)piperidine-1-carboxylate, CAS:, Molecular Weight: 386.256, C17H21BrFNO3, Purity:95, SMILES: O=C(c1cc(Br)ccc1F)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-(4-Bromo-2-CyanophenoxyPiperidine-1-Carboxylate, CAS:1292317-56-6, Molecular Weight: 381.264, C17H21BrN2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)OC1=CC=C(Br)C=C1C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 5-Bromo-2-Oxospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:873779-30-7, Molecular Weight: 381.264, C17H21BrN2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(=O)NC1=CC=C(Br)C=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 6-Bromo-2-Oxospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:1160247-29-9, Molecular Weight: 381.264, C17H21BrN2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)C(=O)NC1=CC(Br)=CC=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 7-(4-Bromophenyl-5-Oxo-2,6-Diazaspiro[3.4]Octane-2-Carboxylate, CAS:1823258-71-4, Molecular Weight: 381.264, C17H21BrN2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CC(NC2=O)C1=CC=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(5-Bromo-2-methoxy-phenyl)adamantane, CAS:104224-63-7, Molecular Weight: 321.252, C17H21BrO, Purity:95, SMILES: COC1=C(C=C(Br)C=C1)C12CC3CC(CC(C3)C1)C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Azasetron (hydrochloride), CAS:123040-16-4, Molecular Weight: 386.2729, C17H21Cl2N3O3, Purity:98, SMILES: O=C(C1=C(OCC(N2C)=O)C2=CC(Cl)=C1)NC3CN4CCC3CC4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(5-chloro-2-fluorobenzoyl)piperidine-1-carboxylate, CAS:1228631-50-2, Molecular Weight: 341.805, C17H21ClFNO3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C(=O)C1=C(F)C=CC(Cl)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(5-Chloro-2-fluorobenzoyl)piperidine-1-carboxylate, CAS:1228631-50-2, Molecular Weight: 341.805, C17H21ClFNO3, Purity:95, SMILES: O=C(c1cc(Cl)ccc1F)C1CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rhosin (hydrochloride), CAS:1281870-42-5, Molecular Weight: 394.8575, C20H19ClN6O, Purity:98, SMILES: O=C(N/N=C/C1=CC=C2N=CC=NC2=C1)[C@H](N)CC3=CNC4=C3C=CC=C4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Naltrexone D4, CAS:, Molecular Weight: 345.4256, C20H19D4NO4, Purity:98, SMILES: O[C@@]12[C@]3([C@@H](O4)C(CC2)=O)C5=C4C(O)=CC=C5C[C@H]1N(CC6C([2H])([2H])C6([2H])[2H])CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dolutegravir, CAS:1051375-16-6, Molecular Weight: 419.3788, C20H19F2N3O5, Purity:98, SMILES: FC1=CC(F)=C(C=C1)CNC(C2=CN(C3=C(C2=O)O)C[C@@]([H])(N4C3=O)OCC[C@H]4C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pimodivir, CAS:1629869-44-8, Molecular Weight: 399.394, C20H19F2N5O2, Purity:98, SMILES: O=C([C@H]1C(CC2)CCC2[C@@H]1NC3=NC(C4=CNC5=NC=C(F)C=C54)=NC=C3F)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RO4987655, CAS:874101-00-5, Molecular Weight: 565.2816, C20H19F3IN3O5, Purity:98, SMILES: FC(C(F)=C(NC1=CC=C(I)C=C1F)C(C(NOCCO)=O)=C2)=C2CN3C(CCCO3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lu AE58054, CAS:467459-31-0, Molecular Weight: 398.3697, C20H19F5N2O, Purity:98, SMILES: FC1=CC(NC=C2CCNCC3=CC(OCC(F)(C(F)F)F)=CC=C3)=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK583, CAS:1346547-00-9, Molecular Weight: 398.4539, C20H19FN4O2S, Purity:98, SMILES: FC1=CC2=C(NN=C2NC3=CC=NC4=CC=C(S(=O)(C(C)(C)C)=O)C=C34)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Finafloxacin, CAS:209342-40-5, Molecular Weight: 398.3877, C20H19FN4O4, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N4C[C@]5([H])OCCN[C@@]5([H])C4)=C3C#N)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Riociguat, CAS:625115-55-1, Molecular Weight: 422.4156, C20H19FN8O2, Purity:98, SMILES: FC1=CC=CC=C1CN2C3=NC=CC=C3C(C4=NC(N)=C(C(N)=N4)N(C)C(OC)=O)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SC58451, CAS:168433-84-9, Molecular Weight: 342.4270632, C20H19FO2S, Purity:98, SMILES: O=S(C1=CC=C(C(C2)=C(C3=CC=C(F)C=C3)CC42CC4)C=C1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4-Dimethyltriphenylamine, CAS:20440-95-3, Molecular Weight: 273.3716, C20H19N, Purity:95, SMILES: CC1=CC=C(C=C1)N(C1=CC=CC=C1)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TAS-103, CAS:174634-08-3, Molecular Weight: 333.3838, C20H19N3O2, Purity:98, SMILES: O=C(C1=C2C3=CC=C(O)C=C3N=C1NCCN(C)C)C4=C2C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dapivirine, CAS:244767-67-7, Molecular Weight: 329.39836, C20H19N5, Purity:98, SMILES: CC1=CC(C)=CC(C)=C1NC2=CC=NC(NC3=CC=C(C#N)C=C3)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pemetrexed (disodium), CAS:150399-23-8, Molecular Weight: 471.37429856, C20H19N5Na2O6, Purity:98, SMILES: O=C1NC(N)=NC2=C1C(CCC3=CC=C(C(N[C@H](C([O-])=O)CCC([O-])=O)=O)C=C3)=CN2.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pemetrexed disodium, CAS:357166-30-4, Molecular Weight: 471.3743, C20H19N5Na2O6, Purity:95, SMILES: [O-]C(=O)CC[C@@H](C(=O)[O-])NC(=O)c1ccc(cc1)CCc1c[nH]c2c1c(=O)[nH]c(n2)N.C.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-(4-Methoxybenzyl-5-Methyl-3-(Phenylamino-2H-Pyrazolo[3,4-D]Pyrimidine-4,6(5H,7H-Dione, CAS:1160521-51-6, Molecular Weight: 377.3966, C20H19N5O3, Purity:95, SMILES: COC1=CC=C(CN2C3=NNC(NC4=CC=CC=C4)=C3C(=O)N(C)C2=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK2982772, CAS:1622848-92-3, Molecular Weight: 377.39656, C20H19N5O3, Purity:98, SMILES: O=C(C1=NC(CC2=CC=CC=C2)=NN1)N[C@H]3COC4=CC=CC=C4N(C)C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyriproxyfen, CAS:95737-68-1, Molecular Weight: 321.3698, C20H19NO3, Purity:98, SMILES: CC(OC1=NC=CC=C1)COC2=CC=C(OC3=CC=CC=C3)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (-)-MK 801 (Maleate), CAS:121917-57-5, Molecular Weight: 337.3692, C20H19NO4, Purity:98, SMILES: C[C@@]1(N2)C3=CC=CC=C3C[C@H]2C4=CC=CC=C14.O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (+)-MK 801 (Maleate), CAS:77086-22-7, Molecular Weight: 337.3692, C20H19NO4, Purity:98, SMILES: C[C@]12C3=CC=CC=C3C[C@@H](N2)C4=CC=CC=C14.O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3-(2-phenyl-1,3-dioxolan-2-ylpropylisoindoline-1,3-dione, CAS:3308-99-4, Molecular Weight: 337.3692, C20H19NO4, Purity:95, SMILES: O=C1N(CCCC2(OCCO2)C2=CC=CC=C2)C(=O)C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Pro-OH, CAS:71989-31-6, Molecular Weight: 337.3692, C20H19NO4, Purity:97, SMILES: OC(=O)[C@@H]1CCCN1C(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2-Butyl-5-Nitrobenzofuran-3-Yl(4-MethoxyphenylMethanone, CAS:141627-42-1, Molecular Weight: 353.3686, C20H19NO5, Purity:95, SMILES: CCCCC1=C(C(=O)C2=CC=C(OC)C=C2)C2=C(O1)C=CC(=C2)[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Hyp-OH, CAS:88050-17-3, Molecular Weight: 353.3686, C20H19NO5, Purity:98, SMILES: O[C@@H]1C[C@H](N(C1)C(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY341495, CAS:201943-63-7, Molecular Weight: 353.3686, C20H19NO5, Purity:98, SMILES: O=C(O)[C@@H]1[C@H](C1)[C@@](N)(CC2C3=C(C=CC=C3)OC4=C2C=CC=C4)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Protopine, CAS:130-86-9, Molecular Weight: 353.3686, C20H19NO5, Purity:98, SMILES: O=C1CC2=CC=C3C(OCO3)=C2CN(C)CCC4=CC5=C(OCO5)C=C41, HPLC, NMR, LCMS is ok, stock more than 10g. |
| H 89, CAS:127243-85-0, Molecular Weight: 446.3607, C20H20BrN3O2S, Purity:98, SMILES: O=S(C1=CC=CC2=C1C=CN=C2)(NCCNC/C=C/C3=CC=C(Br)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| YS-49, CAS:132836-42-1, Molecular Weight: 386.2823, C20H20BrNO2, Purity:98, SMILES: OC1=CC2=C(C(CC3=C4C=CC=CC4=CC=C3)NCC2)C=C1O.[H]Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyltriphenylphosphonium bromide, CAS:1530-32-1, Molecular Weight: 371.251, C20H20BrP, Purity:95, SMILES: [Br-].CC[P+](c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-((2-Chloro-3-((phenylimino)methyl)cyclohex-2-en-1-ylidene)methyl)aniline hydrochloride, CAS:63857-00-1, Molecular Weight: 359.292, C20H20Cl2N2, Purity:97, SMILES: Cl.ClC1=C(CCCC1=CNc1ccccc1)C=Nc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BAY 61-3606 (dihydrochloride), CAS:648903-57-5, Molecular Weight: 463.3172, C20H20Cl2N6O3, Purity:98, SMILES: O=C(N)C1=CC=CN=C1NC2=NC(C3=CC=C(C(OC)=C3)OC)=CC4=NC=CN24.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ABT-639, CAS:1235560-28-7, Molecular Weight: 455.9059, C20H20ClF2N3O3S, Purity:98, SMILES: O=S(C1=CC(C(N2C[C@](CCC3)([H])N3CC2)=O)=C(Cl)C=C1F)(NC4=CC=CC=C4F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lu AE58054 (Hydrochloride), CAS:467458-02-2, Molecular Weight: 434.8306, C20H20ClF5N2O, Purity:98, SMILES: FC1=CC(NC=C2CCNCC3=CC(OCC(F)(F)C(F)F)=CC=C3)=C2C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AT7867, CAS:857531-00-1, Molecular Weight: 337.8459, C20H20ClN3, Purity:98, SMILES: ClC1=CC=C(C=C1)C2(CCNCC2)C3=CC=C(C=C3)C4=CNN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AS1517499, CAS:919486-40-1, Molecular Weight: 397.8581, C20H20ClN5O2, Purity:98, SMILES: O=C(C1=CN=C(NCCC2=CC=C(O)C(Cl)=C2)N=C1NCC3=CC=CC=C3)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SD-06, CAS:271576-80-8, Molecular Weight: 397.8581, C20H20ClN5O2, Purity:98, SMILES: OCC(N1CCC(CC1)C2=NNC(C3=CC=C(C=C3)Cl)=C2C4=NC=NC=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Berberine (chloride hydrate), CAS:141433-60-5, Molecular Weight: 389.8295, C20H20ClNO5, Purity:98, SMILES: COC1=C(OC)C2=C[N+]3=C(C(C(CC3)=C4)=CC5=C4OCO5)C=C2C=C1.[Cl-].O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (methoxymethyl)triphenylphosphonium chloride, CAS:4009-98-7, Molecular Weight: 342.799, C20H20ClOP, Purity:95, SMILES: [Cl-].COC[P+](c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glucocorticoid receptor agonist, CAS:1245526-82-2, Molecular Weight: 396.3786, C20H20F4N2O2, Purity:98, SMILES: OC1=CC=C(C=C1C(C)(C[C@](O)(C(F)(F)F)CC2=CC3=C(C=NC=C3)N2)C)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Raltegravir (potassium salt), CAS:871038-72-1, Molecular Weight: 482.5067, C20H20FKN6O5, Purity:98, SMILES: O=C(C(N=C(C(NC(C1=NN=C(C)O1)=O)(C)C)N2C)=C([O-])C2=O)NCC3=CC=C(F)C=C3.[K+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prasugrel, CAS:150322-43-3, Molecular Weight: 373.4411, C20H20FNO3S, Purity:98, SMILES: FC1=CC=CC=C1C(C(C2CC2)=O)N3CCC4=C(C3)C=C(S4)OC(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-3-((S)-5-(4-Fluorophenyl)-5-hydroxypentanoyl)-4-phenyloxazolidin-2-one, CAS:189028-95-3, Molecular Weight: 357.3755, C20H20FNO4, Purity:95, SMILES: O[C@@H](CCCC(=O)N1[C@H](COC1=O)C1=CC=CC=C1)C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Carabersat, CAS:184653-84-7, Molecular Weight: 357.3755032, C20H20FNO4, Purity:98, SMILES: O=C(N[C@@H]1[C@@H](O)C(C)(C)OC2=CC=C(C(C)=O)C=C12)C3=CC=C(F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(1-Benzyl-1,2,3,6-tetrahydro-4-pyridyl)indole, CAS:17403-05-3, Molecular Weight: 288.3862, C20H20N2, Purity:95, SMILES: c1ccc(cc1)CN1CCC(=CC1)c1c[nH]c2c1cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9-(Tert-Butyl-7,12-Dihydrobenzo[2,3]Azepino[4,5-B]Indol-6(5H-One, CAS:1169705-95-6, Molecular Weight: 304.3856, C20H20N2O, Purity:95, SMILES: CC(C)(C)C1=CC2=C(NC3=C2CC(=O)NC2=CC=CC=C32)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MCB-613, CAS:1162656-22-5, Molecular Weight: 304.3856, C20H20N2O, Purity:98, SMILES: O=C1/C(CC(CC)C/C1=C\C2=CC=CN=C2)=C/C3=CC=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KF 13218, CAS:127654-03-9, Molecular Weight: 336.3844, C20H20N2O3, Purity:98, SMILES: O=C(O)CCCC/C=C1C(C=NC=C2)=C2C(N(C)C3=CC=CC=C\13)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| K02288, CAS:1431985-92-0, Molecular Weight: 352.3838, C20H20N2O4, Purity:98, SMILES: OC1=CC=CC(C2=CC(C3=CC(OC)=C(OC)C(OC)=C3)=C(N)N=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Dap(Ac)-OH, CAS:71989-20-3, Molecular Weight: 368.3832, C20H20N2O5, Purity:98, SMILES: NC(=O)CC[C@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nile Blue A (sulfate), CAS:3625-57-8, Molecular Weight: 366.42, C20H20N3O3S0.5, Purity:98, SMILES: CCN(C1=CC2=[O+]C3=C(C4=CC=CC=C4C(N)=C3)N=C2C=C1)CC.O=S([O-])([O-])=O.[0.5], HPLC, NMR, LCMS is ok, stock more than 10g. |
| KW-2449, CAS:1000669-72-6, Molecular Weight: 332.399, C20H20N4O, Purity:98, SMILES: O=C(C1=CC=C(/C=C/C2=NNC3=C2C=CC=C3)C=C1)N4CCNCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ganetespib, CAS:888216-25-9, Molecular Weight: 364.3978, C20H20N4O3, Purity:98, SMILES: CN1C2=CC=C(N3C(NN=C3C4=CC(C(C)C)=C(O)C=C4O)=O)C=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pafuramidine, CAS:186953-56-0, Molecular Weight: 364.3978, C20H20N4O3, Purity:98, SMILES: N=C(C1=CC=C(C2=CC=C(C3=CC=C(C(NOC)=N)C=C3)O2)C=C1)NOC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IRAK inhibitor 6, CAS:1042672-97-8, Molecular Weight: 396.4628, C20H20N4O3S, Purity:98, SMILES: COC1=CC(N2CCOCC2)=CC=C1NC(C3=CSC(C4=CC=CN=C4)=N3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML-030, CAS:1013750-77-0, Molecular Weight: 412.4622, C20H20N4O4S, Purity:98, SMILES: COC1=CC=C(C2=NN3C(SC2)=NN=C3C4=CC(OC)=CC=C4OC)C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GIBH-130, CAS:1252608-59-5, Molecular Weight: 360.4124, C20H20N6O, Purity:98, SMILES: O=C(C1=NN=C(C2=CC=CC=C2)C=C1C)N3CCN(C4=NC=CC=N4)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Indole-2-carboxamide, 5-methoxy-3-(1-methylethoxy)-1-phenyl-N-2H-tetrazol-5-yl-, CAS:104961-19-5, Molecular Weight: 392.4112, C20H20N6O3, Purity:98, SMILES: O=C(C(N1C2=CC=CC=C2)=C(OC(C)C)C3=C1C=CC(OC)=C3)NC4=NN=NN4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Kif15-IN-2, CAS:672926-33-9, Molecular Weight: 440.4756, C20H20N6O4S, Purity:98, SMILES: O=C(C1=CC=CC=C1N2)N([C@@H](C(C)C)C(NC3=NC(C)=C(C4=NN=C(C)O4)S3)=O)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MRS 2578, CAS:711019-86-2, Molecular Weight: 472.673, C20H20N6S4, Purity:98, SMILES: S=C(NCCCCNC(NC1=CC(N=C=S)=CC=C1)=S)NC2=CC(N=C=S)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-04217903 (methanesulfonate), CAS:956906-93-7, Molecular Weight: 468.489, C20H20N8O4S, Purity:98, SMILES: OCCN1N=CC(C2=NC3=C(N=C2)N=NN3CC4=CC5=CC=CN=C5C=C4)=C1.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Columbamine, CAS:3621-36-1, Molecular Weight: 338.3766, C20H20NO4+, Purity:98, SMILES: COC1=C(OC)C2=C[N+]3=C(C4=CC(O)=C(OC)C=C4CC3)C=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bavachalcone, CAS:28448-85-3, Molecular Weight: 324.3704, C20H20O4, Purity:98, SMILES: O=C(C1=CC(C/C=C(C)\C)=C(O)C=C1O)/C=C/C2=CC=C(O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bavachin, CAS:19879-32-4, Molecular Weight: 324.3704, C20H20O4, Purity:98, SMILES: O=C1C[C@@H](C2=CC=C(O)C=C2)OC3=CC(O)=C(C/C=C(C)\C)C=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isobavachalcone, CAS:20784-50-3, Molecular Weight: 324.3704, C20H20O4, Purity:98, SMILES: O=C(/C=C/C1=CC=C(C=C1)O)C2=CC=C(C(C/C=C(C)\C)=C2O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BNC105, CAS:945771-74-4, Molecular Weight: 372.3686, C20H20O7, Purity:98, SMILES: COC1=CC(C(C2=C(C)OC3=C(O)C(OC)=CC=C23)=O)=CC(OC)=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sinensetin, CAS:2306-27-6, Molecular Weight: 372.3686, C20H20O7, Purity:98, SMILES: O=C1C=C(C2=CC=C(OC)C(OC)=C2)OC3=CC(OC)=C(OC)C(OC)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tangeretin, CAS:481-53-8, Molecular Weight: 372.3686, C20H20O7, Purity:98, SMILES: O=C1C=C(C2=CC=C(OC)C=C2)OC3=C(OC)C(OC)=C(OC)C(OC)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2S,3S)-2,3-Bis((4-methylbenzoyl)oxy)succinic acid hydrate, CAS:71607-31-3, Molecular Weight: 404.3674, C20H20O9, Purity:98, SMILES: O.Cc1ccc(cc1)C(=O)O[C@@H]([C@H](OC(=O)c1ccc(C)cc1)C(O)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Macitentan (n-butyl analogue), CAS:556797-16-1, Molecular Weight: 587.2849, C20H21Br2N5O4S, Purity:98, SMILES: BrC1=CN=C(OCCOC2=C(C3=CC=C(Br)C=C3)C(NS(CCCC)(=O)=O)=NC=N2)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 4-Bromospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:473737-34-7, Molecular Weight: 401.297, C20H21BrN2O2, Purity:95, SMILES: BrC1=CC=CC2=C1C1(CN2)CCN(CC1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 5-Bromospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:438192-14-4, Molecular Weight: 401.297, C20H21BrN2O2, Purity:95, SMILES: BrC1=CC=C2NCC3(CCN(CC3)C(=O)OCC3=CC=CC=C3)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 7-Bromospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:1243461-51-9, Molecular Weight: 401.297, C20H21BrN2O2, Purity:95, SMILES: BrC1=C2NCC3(CCN(CC3)C(=O)OCC3=CC=CC=C3)C2=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Folinic acid (Calcium), CAS:1492-18-8, Molecular Weight: 511.50144, C20H21CaN7O7, Purity:98, SMILES: O=C(N[C@H](C([O-])=O)CCC([O-])=O)C(C=C1)=CC=C1NCC(N2C=O)CNC3=C2C(N=C(N)N3)=O.[Ca+2], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Levoleucovorin (Calcium), CAS:80433-71-2, Molecular Weight: 511.50144, C20H21CaN7O7, Purity:98, SMILES: O=C1C2=C(NC[C@H](CNC3=CC=C(C(N[C@H](C([O-])=O)CCC([O-])=O)=O)C=C3)N2C=O)NC(N)=N1.[Ca+2], HPLC, NMR, LCMS is ok, stock more than 10g. |
| ABT-639 (hydrochloride), CAS:1235560-31-2, Molecular Weight: 492.3668464, C20H21Cl2F2N3O3S, Purity:98, SMILES: O=S(C1=CC(C(N2C[C@](CCC3)([H])N3CC2)=O)=C(Cl)C=C1F)(NC4=CC=CC=C4F)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TAS-103 (dihydrochloride), CAS:174634-09-4, Molecular Weight: 406.3056, C20H21Cl2N3O2, Purity:98, SMILES: O=C(C1=C2C3=CC=C(O)C=C3N=C1NCCN(C)C)C4=C2C=CC=C4.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CC0651, CAS:1319207-44-7, Molecular Weight: 442.2898, C20H21Cl2NO6, Purity:98, SMILES: ClC1=CC(Cl)=CC(C2=CC=C(C=C2)C[C@@H]([C@@H]([C@H](C(O)=O)O)O)NC(COC)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BAY-Y 3118, CAS:151213-16-0, Molecular Weight: 405.8504432, C20H21ClFN3O3, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N(C4)C[C@]5([H])[C@@]4([H])CCCN5)=C3Cl)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prasugrel (hydrochloride), CAS:389574-19-0, Molecular Weight: 409.902, C20H21ClFNO3S, Purity:98, SMILES: FC1=CC=CC=C1C(C(C2CC2)=O)N3CCC4=C(C3)C=C(S4)OC(C)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 5-Chlorospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:1041704-16-8, Molecular Weight: 356.846, C20H21ClN2O2, Purity:95, SMILES: ClC1=CC=C2NCC3(CCN(CC3)C(=O)OCC3=CC=CC=C3)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fipexide, CAS:34161-24-5, Molecular Weight: 388.8447, C20H21ClN2O4, Purity:98, SMILES: ClC1=CC=C(OCC(N2CCN(CC3=CC=C(OCO4)C4=C3)CC2)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-((2-CHLOROPYRIDIN-4-YL)METHYL)-1-CYCLOBUTYL-6,7,8,9-TETRAHYDRO-3H-PYRAZOLO[3,4-C]ISOQUINOLIN-5(4H)-ONE, CAS:, Molecular Weight: 368.86, C20H21ClN4O, Purity:95, SMILES: Clc1cc(Cn2nc(C3CCC3)c3c4CCCCc4c(=O)[nH]c23)ccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KRN-633, CAS:286370-15-8, Molecular Weight: 416.8582, C20H21ClN4O4, Purity:98, SMILES: ClC1=CC(OC2=NC=NC3=CC(OC)=C(C=C32)OC)=CC=C1NC(NCCC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fenofibrate, CAS:49562-28-9, Molecular Weight: 360.8313, C20H21ClO4, Purity:98, SMILES: CC(C)(OC1=CC=C(C(C2=CC=C(Cl)C=C2)=O)C=C1)C(OC(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Flibanserin, CAS:167933-07-5, Molecular Weight: 390.4022, C20H21F3N4O, Purity:98, SMILES: O=C1NC2=CC=CC=C2N1CCN3CCN(C4=CC=CC(C(F)(F)F)=C4)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Defactinib, CAS:1073154-85-4, Molecular Weight: 510.4927, C20H21F3N8O3S, Purity:98, SMILES: O=C(NC)C1=CC=C(NC2=NC=C(C(F)(F)F)C(NCC3=NC=CN=C3N(C)S(=O)(C)=O)=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Enasidenib (mesylate), CAS:1650550-25-6, Molecular Weight: 569.4806592, C20H21F6N7O4S, Purity:98, SMILES: CS(=O)(O)=O.CC(O)(C)CNC1=NC(C2=NC(C(F)(F)F)=CC=C2)=NC(NC3=CC(C(F)(F)F)=NC=C3)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Escitalopram, CAS:128196-01-0, Molecular Weight: 324.3919432, C20H21FN2O, Purity:98, SMILES: FC1=CC=C([C@@]2(CCCN(C)C)C(C=CC(C#N)=C3)=C3CO2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 5-Fluorospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:209348-85-6, Molecular Weight: 340.3913, C20H21FN2O2, Purity:95, SMILES: FC1=CC=C2NCC3(CCN(CC3)C(=O)OCC3=CC=CC=C3)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB 239063, CAS:193551-21-2, Molecular Weight: 368.4048, C20H21FN4O2, Purity:98, SMILES: COC1=NC=CC(C2=C(N=CN2[C@H]3CC[C@H](O)CC3)C4=CC=C(F)C=C4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Raltegravir, CAS:518048-05-0, Molecular Weight: 444.4164, C20H21FN6O5, Purity:98, SMILES: O=C(C(O)=C(C(NCC1=CC=C(C=C1)F)=O)N=C2C(C)(C)NC(C3=NN=C(C)O3)=O)N2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sivelestat (sodium), CAS:150374-95-1, Molecular Weight: 456.4447, C20H21N2NaO7S, Purity:98, SMILES: [O-]C(CNC(C1=CC=CC=C1NS(C2=CC=C(OC(C(C)(C)C)=O)C=C2)(=O)=O)=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4H-Pyrido[3,2,1-jk]carbazol-11(8H)-one, 5,6,9,10-tetrahydro-10-[(2-methyl-1H-imidazol-1-yl)methyl]-, CAS:120635-47-4, Molecular Weight: 319.40024, C20H21N3O, Purity:98, SMILES: O=C1C(CN2C=CN=C2C)CCC(N3CCC4)=C1C5=C3C4=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Imidafenacin, CAS:170105-16-5, Molecular Weight: 319.4002, C20H21N3O, Purity:98, SMILES: NC(C(C1=CC=CC=C1)(C2=CC=CC=C2)CCN3C(C)=NC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB-505124, CAS:694433-59-5, Molecular Weight: 335.3996, C20H21N3O2, Purity:98, SMILES: CC1=CC=CC(C2=C(C3=CC=C(OCO4)C4=C3)N=C(C(C)(C)C)N2)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB-55124, CAS:694-54-2, Molecular Weight: 335.3996, C20H21N3O2, Purity:97, SMILES: Cc1cccc(n1)-c1[nH]c(nc1-c1ccc2OCOc2c1)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tubastatin-A, CAS:1252003-15-8, Molecular Weight: 335.3996, C20H21N3O2, Purity:98, SMILES: O=C(NO)C1=CC=C(CN2C3=C(CN(C)CC3)C4=C2C=CC=C4)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fradafiban, CAS:148396-36-5, Molecular Weight: 367.39844, C20H21N3O4, Purity:98, SMILES: O=C(O)C[C@H]1C(N[C@H](COC2=CC=C(C3=CC=C(C(N)=N)C=C3)C=C2)C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ampiroxicam, CAS:99464-64-9, Molecular Weight: 447.4616, C20H21N3O7S, Purity:98, SMILES: O=C(OC(OC(C1=CC=CC=C12)=C(C(NC3=NC=CC=C3)=O)N(C)S2(=O)=O)C)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-NM-PP1, CAS:221244-14-0, Molecular Weight: 331.4142, C20H21N5, Purity:98, SMILES: CC(N1N=C(CC2=CC=CC3=C2C=CC=C3)C4=C(N)N=CN=C41)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chitinase-IN-2, CAS:1579991-63-1, Molecular Weight: 395.478, C20H21N5O2S, Purity:98, SMILES: O=C(C1=CC=CC2=C1C3=CC=C2N(C)C)N(CCNCC4=NN=C(C)S4)C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IRAK-1-4 Inhibitor I, CAS:509093-47-4, Molecular Weight: 395.41184, C20H21N5O4, Purity:98, SMILES: O=C(C1=CC=CC([N+]([O-])=O)=C1)NC2=NC3=CC=CC=C3N2CCN4CCOCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pemetrexed, CAS:137281-23-3, Molecular Weight: 427.41064, C20H21N5O6, Purity:98, SMILES: O=C1NC(N)=NC2=C1C(CCC3=CC=C(C(N[C@H](C(O)=O)CCC(O)=O)=O)C=C3)=CN2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pemetrexed (disodium hemipenta hydrate), CAS:357166-30-4, Molecular Weight: 516.41, C20H21N5O6 . 5/2 H2O . 2Na, Purity:98, SMILES: O=C([O-])CC[C@@H](C([O-])=O)NC(C1=CC=C(CCC2=CNC(N=C(N)N3)=C2C3=O)C=C1)=O.[Na+].[2.5H2O].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Triazolo-pyramidine derivative, CAS:1202402-40-1, Molecular Weight: 407.42584, C20H21N7O3, Purity:98, SMILES: NC1=NC(C2=CC=C(C)O2)=C(N=NN3CC4=NC(CO[C@@H]5COCC5)=CC=C4)C3=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-D-Val-OH, CAS:84624-17-9, Molecular Weight: 339.385, C20H21NO4, Purity:97, SMILES: CC(C)[C@@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Val-OH, CAS:68858-20-8, Molecular Weight: 339.385, C20H21NO4, Purity:96, SMILES: CC(C)[C@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-(3,5-dimethylphenyl)-2-(4-((2-oxotetrahydrofuran-3-yl)oxy)phenyl)acetamide, CAS:, Molecular Weight: 339.385, C20H21NO4, Purity:95, SMILES: CC1=CC(NC(CC2=CC=C(OC3CCOC3=O)C=C2)=O)=CC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Papaverine, CAS:58-74-2, Molecular Weight: 339.385, C20H21NO4, Purity:98, SMILES: COC1=CC2=C(C=C1OC)C=CN=C2CC3=CC=C(OC)C(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetrahydroberberine, CAS:522-97-4, Molecular Weight: 339.385, C20H21NO4, Purity:98, SMILES: COC1=CC=C(CC23)C(CN2CCC(C3=C4)=CC5=C4OCO5)=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK2801, CAS:1619994-68-1, Molecular Weight: 371.45, C20H21NO4S, Purity:98, SMILES: O=C(C)C1=CC(C2=C(S(=O)(C)=O)C=CC=C2)=C3N1C=CC(OCCC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-(R)-2-amino-3-hydroxy-3-methylbutanoic acid, CAS:884880-39-1, Molecular Weight: 355.3844, C20H21NO5, Purity:95, SMILES: CC(C)(O)[C@@H](NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-(S)-2-amino-3-hydroxy-3-methylbutanoic acid, CAS:1217603-41-2, Molecular Weight: 355.3844, C20H21NO5, Purity:95, SMILES: CC(C)(O)[C@H](NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Z-Glu-OBzl, CAS:3705-42-8, Molecular Weight: 371.3838, C20H21NO6, Purity:99, SMILES: OC(=O)CC[C@H](NC(=O)OCc1ccccc1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Phenylsulfonyl)-3-indoleboronic acid pinacol ester, CAS:870717-93-4, Molecular Weight: 383.269, C20H22BNO4S, Purity:98, SMILES: CC1(C)OB(OC1(C)C)c1cn(c2ccccc12)S(=O)(=O)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DG172 (dihydrochloride), CAS:1361504-77-9, Molecular Weight: 455.2188, C20H22BrCl2N3, Purity:98, SMILES: BrC(C=CC=C1)=C1/C(C#N)=C/C(C=C2)=CC=C2N3CCN(C)CC3.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| H-89 (dihydrochloride), CAS:130964-39-5, Molecular Weight: 519.2826, C20H22BrCl2N3O2S, Purity:98, SMILES: O=S(C1=CC=CC2=C1C=CN=C2)(NCCNC/C=C/C3=CC=C(Br)C=C3)=O.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 7-Bromospiro[Indoline-3,4'-Piperidine]-1'-Carboxylate Hydrochloride, CAS:0, Molecular Weight: 437.758, C20H22BrClN2O2, Purity:95, SMILES: Cl.BrC1=CC=CC2=C1NCC21CCN(CC1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Citalopram (hydrobromide), CAS:59729-32-7, Molecular Weight: 405.3039, C20H22BrFN2O, Purity:98, SMILES: N#CC1=CC2=C(C(C3=CC=C(F)C=C3)(CCCN(C)C)OC2)C=C1.[H]Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Indole, 1-[(2-bromophenyl)sulfonyl]-4-[(4-methyl-1-piperazinyl)methyl]-, CAS:1038988-11-2, Molecular Weight: 448.37658, C20H22BrN3O2S, Purity:98, SMILES: CN1CCN(CC2=CC=CC3=C2C=CN3S(=O)(C4=CC=CC=C4Br)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| YS-49 (monohydrate), CAS:, Molecular Weight: 404.2976, C20H22BrNO3, Purity:98, SMILES: OC1=CC2=C(C(CC3=C4C=CC=CC4=CC=C3)NCC2)C=C1O.O.Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lemildipine, CAS:94739-29-4, Molecular Weight: 457.3045, C20H22Cl2N2O6, Purity:98, SMILES: O=C(C1=C(COC(N)=O)NC(C)=C(C(OC)=O)C1C2=CC=CC(Cl)=C2Cl)OC(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AT7867 (dihydrochloride), CAS:1431697-86-7, Molecular Weight: 410.7678, C20H22Cl3N3, Purity:98, SMILES: ClC1=CC=C(C=C1)C2(CCNCC2)C3=CC=C(C=C3)C4=CNN=C4.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Defactinib (hydrochloride), CAS:1073160-26-5, Molecular Weight: 546.9537, C20H22ClF3N8O3S, Purity:98, SMILES: O=C(NC)C1=CC=C(NC2=NC=C(C(F)(F)F)C(NCC3=NC=CN=C3N(C)S(=O)(C)=O)=N2)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cyclobenzaprine (hydrochloride), CAS:6202-23-9, Molecular Weight: 311.8484, C20H22ClN, Purity:98, SMILES: CN(C)CC/C=C1C2=CC=CC=C2C=CC3=CC=CC=C\13.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amodiaquin (dihydrochloride dihydrate), CAS:6398-98-7, Molecular Weight: 464.81, C20H22ClN3O . 2H2O . 2HCl, Purity:98, SMILES: OC1=CC=C(NC2=CC=NC3=CC(Cl)=CC=C23)C=C1CN(CC)CC.Cl.Cl.O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB-505124 (hydrochloride), CAS:356559-13-2, Molecular Weight: 371.8606, C20H22ClN3O2, Purity:98, SMILES: CC1=CC=CC(C2=C(C3=CC=C(OCO4)C4=C3)N=C(C(C)(C)C)N2)=N1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tubastatin A (Hydrochloride), CAS:1310693-92-5, Molecular Weight: 371.8606, C20H22ClN3O2, Purity:98, SMILES: O=C(C1=CC=C(C=C1)CN2C3=C(C4=C2C=CC=C4)CN(C)CC3)NO.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| A939572, CAS:1032229-33-6, Molecular Weight: 387.86, C20H22ClN3O3, Purity:98, SMILES: O=C(N1CCC(OC2=C(Cl)C=CC=C2)CC1)NC3=CC=CC(C(NC)=O)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chitinase-IN-2 (hydrochloride), CAS:, Molecular Weight: 431.939, C20H22ClN5O2S, Purity:98, SMILES: O=C(C1=CC=CC2=C1C3=CC=C2N(C)C)N(CCNCC4=NN=C(C)S4)C3=O.Cl[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| BAY-1895344 (hydrochloride), CAS:, Molecular Weight: 411.88798, C20H22ClN7O, Purity:98, SMILES: CN1N=CC=C1C2=C(C=CN=C3C4=CC=NN4)C3=NC(N5[C@H](C)COCC5)=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FPS-ZM1, CAS:945714-67-0, Molecular Weight: 327.8478, C20H22ClNO, Purity:98, SMILES: ClC1=CC=C(C(N(C2CCCCC2)CC3=CC=CC=C3)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Papaverine (hydrochloride), CAS:61-25-6, Molecular Weight: 375.846, C20H22ClNO4, Purity:98, SMILES: COC1=CC2=C(C=C1OC)C=CN=C2CC3=CC=C(OC)C(OC)=C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Terutroban, CAS:165538-40-9, Molecular Weight: 407.911, C20H22ClNO4S, Purity:98, SMILES: O=C(O)CCC1=C2CC[C@@H](NS(=O)(C3=CC=C(Cl)C=C3)=O)CC2=CC=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ARRY-520, CAS:885060-09-3, Molecular Weight: 420.4761, C20H22F2N4O2S, Purity:98, SMILES: O=C(N1[C@@](C2=CC=CC=C2)(CCCN)SC(C3=CC(F)=CC=C3F)=N1)N(OC)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ARRY-520 (R enantiomer), CAS:885060-08-2, Molecular Weight: 420.4761, C20H22F2N4O2S, Purity:98, SMILES: O=C(N1[C@](C2=CC=CC=C2)(CCCN)SC(C3=CC(F)=CC=C3F)=N1)N(OC)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-AKT400, CAS:1004990-28-6, Molecular Weight: 400.4250864, C20H22F2N6O, Purity:98, SMILES: N[C@@](CC1)(CNC(C2=CC=C(F)C=C2F)=O)CN1C3=C4C(NC=C4CC)=NC=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SGI-1776, CAS:1025065-69-3, Molecular Weight: 405.4168, C20H22F3N5O, Purity:98, SMILES: CN1CCC(CC1)CNC2=NN3C(C=C2)=NC=C3C4=CC=CC(OC(F)(F)F)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GDC-0339, CAS:1428569-85-0, Molecular Weight: 465.4952, C20H22F3N7OS, Purity:98, SMILES: FC1=CC=CC(F)=C1C2=NC(C(NC3=C(N4CC[C@@H](F)[C@H](N)CC4)N(C)N=C3)=O)=C(N)S2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TPA 023, CAS:252977-51-8, Molecular Weight: 395.4333832, C20H22FN7O, Purity:98, SMILES: FC1=CC=CC=C1C2=NN=C3C=C(C(C)(C)C)C(OCC4=NC=NN4CC)=NN32, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Azatadine, CAS:3964-81-6, Molecular Weight: 290.4021, C20H22N2, Purity:98, SMILES: CN1CC/C(CC1)=C2C3=CC=CC=C3CCC4=CC=CN=C4\2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl-4-(4-MethoxyphenylPiperidine-4-Carbonitrile, CAS:1158750-70-9, Molecular Weight: 306.4015, C20H22N2O, Purity:95, SMILES: COC1=CC=C(C=C1)C1(CCN(CC2=CC=CC=C2)CC1)C#N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CASIN, CAS:425399-05-9, Molecular Weight: 306.4015, C20H22N2O, Purity:98, SMILES: OCCNC1C(NC2=C3C=C(C4=CC=CC=C4)C=C2)=C3CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl Spiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:167484-18-6, Molecular Weight: 322.4009, C20H22N2O2, Purity:95, SMILES: O=C(OCC1=CC=CC=C1)N1CCC2(CNC3=C2C=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| URB-597, CAS:546141-08-6, Molecular Weight: 338.4003, C20H22N2O3, Purity:98, SMILES: O=C(OC1=CC(C2=CC=CC(C(N)=O)=C2)=CC=C1)NC3CCCCC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| YHO-13177, CAS:912287-56-0, Molecular Weight: 370.4653, C20H22N2O3S, Purity:98, SMILES: N#C/C(C1=CC=C(OC)C(OC)=C1)=C\C2=CC=C(N3CCC(O)CC3)S2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nomifensine (maleate), CAS:32795-47-4, Molecular Weight: 354.3997, C20H22N2O4, Purity:98, SMILES: NC1=CC=CC2=C1CN(C)CC2C3=CC=CC=C3.O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RVX-208, CAS:1044870-39-4, Molecular Weight: 370.3991, C20H22N2O5, Purity:98, SMILES: COC1=CC(OC)=C(C(NC(C2=CC(C)=C(OCCO)C(C)=C2)=N3)=O)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ciproxifan (maleate), CAS:184025-19-2, Molecular Weight: 386.3985, C20H22N2O6, Purity:98, SMILES: O=C(C1CC1)C2=CC=C(OCCCC3=CNC=N3)C=C2.O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sivelestat, CAS:127373-66-4, Molecular Weight: 434.4629, C20H22N2O7S, Purity:98, SMILES: CC(C)(C)C(OC1=CC=C(S(=O)(NC2=CC=CC=C2C(NCC(O)=O)=O)=O)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mequitazine, CAS:29216-28-2, Molecular Weight: 322.46708, C20H22N2S, Purity:98, SMILES: C12=CC=CC=C1N(CC3CN4CCC3CC4)C5=C(C=CC=C5)S2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Importazole, CAS:662163-81-7, Molecular Weight: 318.41548, C20H22N4, Purity:98, SMILES: CC(NC1=C2C=CC=CC2=NC(N3CCCC3)=N1)C4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WAY-262611, CAS:1123231-07-1, Molecular Weight: 318.4155, C20H22N4, Purity:98, SMILES: NCC1CCN(C2=NC=CC(C3=CC=C4C=CC=CC4=C3)=N2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ABT-046, CAS:1031336-60-3, Molecular Weight: 350.4143, C20H22N4O2, Purity:98, SMILES: NC1=C(C2=CC=C([C@H]3CC[C@H](CC(O)=O)CC3)C=C2)C=NC4=CC=NN41, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD-6280, CAS:942436-93-3, Molecular Weight: 366.4137, C20H22N4O3, Purity:98, SMILES: O=C(C1=NN=C2C(C3=CC(OC)=CC=C3OC)=CC=CC2=C1N)NCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GW2580, CAS:870483-87-7, Molecular Weight: 366.4137, C20H22N4O3, Purity:98, SMILES: NC1=NC(N)=C(CC2=CC(OC)=C(OCC3=CC=C(OC)C=C3)C=C2)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SYM2206, CAS:173952-44-8, Molecular Weight: 366.4137, C20H22N4O3, Purity:98, SMILES: O=C(N1N=C(C2=CC=C(N)C=C2)C3=C(C=C4C(OCO4)=C3)C1C)NCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BLZ945, CAS:953769-46-5, Molecular Weight: 398.4787, C20H22N4O3S, Purity:98, SMILES: O=C(C1=NC=CC(OC2=CC=C3N=C(N[C@H]4[C@H](O)CCCC4)SC3=C2)=C1)NC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Kif15-IN-1, CAS:672926-32-8, Molecular Weight: 430.4775, C20H22N4O5S, Purity:98, SMILES: O=C(C1=CC=CC=C1N2)N([C@@H](C(C)C)C(NC3=NC(C)=C(C(OCC)=O)S3)=O)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Febantel, CAS:58306-30-2, Molecular Weight: 446.4769, C20H22N4O6S, Purity:98, SMILES: COCC(NC1=CC(SC2=CC=CC=C2)=CC=C1/N=C(NC(OC)=O)\NC(OC)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Azlocillin (sodium salt), CAS:37091-65-9, Molecular Weight: 483.4734, C20H22N5NaO6S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC([C@H](NC(N3CCNC3=O)=O)C4=CC=CC=C4)=O)N1C2=O)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| A2AR-agonist-1, CAS:41552-95-8, Molecular Weight: 410.4265, C20H22N6O4, Purity:98, SMILES: OC[C@@H]1[C@H]([C@H]([C@H](N2C=NC3=C2N=CN=C3NCCC4=CNC5=C4C=CC=C5)O1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| U0126, CAS:1173097-76-1, Molecular Weight: 426.55828, C20H22N6OS2, Purity:98, SMILES: NC1=CC=CC=C1S/C(N)=C(/C(C#N)=C(SC2=C(C=CC=C2)N)\N)C#N.CCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-(4-(((2,4-Diaminopteridin-6-yl)methyl)(methyl)amino)benzamido)pentanedioic acid, CAS:59-05-2, Molecular Weight: 454.4393, C20H22N8O5, Purity:98, SMILES: CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methotrexate, CAS:59-05-2, Molecular Weight: 454.4393, C20H22N8O5, Purity:98, SMILES: NC1=NC(N)=C2C(N=CC(CN(C)C3=CC=C(C(N[C@@H](CCC(O)=O)C(O)=O)=O)C=C3)=N2)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Efaproxiral (sodium), CAS:170787-99-2, Molecular Weight: 363.3828, C20H22NNaO4, Purity:98, SMILES: CC(C)(OC1=CC=C(CC(NC2=CC(C)=CC(C)=C2)=O)C=C1)C([O-])=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Avobenzone, CAS:70356-09-1, Molecular Weight: 310.3869, C20H22O3, Purity:98, SMILES: O=C(C1=CC=C(C(C)(C)C)C=C1)CC(C2=CC=C(OC)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Columbin, CAS:546-97-4, Molecular Weight: 358.3851, C20H22O6, Purity:98, SMILES: O=C1[C@](C=C2)(O)[C@@](CC3)(C)[C@@]([C@@](C[C@@H](C4=COC=C4)O5)(C)[C@]3([H])C5=O)([H])[C@]2([H])O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Triptonide, CAS:38647-11-9, Molecular Weight: 358.3851, C20H22O6, Purity:98, SMILES: O=C([C@@]1([C@H]2O1)C(C)C)[C@]34O[C@H]3C[C@@]([H])(C5=C(CC6)C(OC5)=O)[C@@]6(C)[C@]47[C@H]2O7, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Polydatin, CAS:27208-80-6, Molecular Weight: 390.3839, C20H22O8, Purity:98, SMILES: O[C@H]([C@H]([C@@H]([C@@H](CO)O1)O)O)[C@@H]1OC2=CC(/C=C/C3=CC=C(O)C=C3)=CC(O)=C2.[(E)], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,3,5,4'-Tetrahydroxystilbene 2-O-β-D-glucoside, CAS:82373-94-2, Molecular Weight: 406.38328, C20H22O9, Purity:98, SMILES: OC1=CC(O)=CC(/C=C/C2=CC=C(O)C=C2)=C1O[C@@H]([C@@H]([C@@H](O)[C@@H]3O)O)O[C@@H]3CO.[(E)], HPLC, NMR, LCMS is ok, stock more than 10g. |
| MLN9708, CAS:1239908-20-3, Molecular Weight: 517.1216, C20H23BCl2N2O9, Purity:98, SMILES: O=C(O)CC1(CC(O)=O)OB([C@@H](NC(CNC(C2=CC(Cl)=CC=C2Cl)=O)=O)CC(C)C)OC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(phenylsulfonyl)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrrolo[2,3-b]pyridine, CAS:916176-50-6, Molecular Weight: 398.284, C20H23BN2O4S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)n1ccc2c1nccc2B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1-tosyl-1H-pyrrolo[2,3-b]pyridine, CAS:866545-91-7, Molecular Weight: 398.284, C20H23BN2O4S, Purity:95, SMILES: CC(O1)(C)C(C)(C)OB1C2=CN(S(C3=CC=C(C)C=C3)(=O)=O)C4=NC=CC=C42, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Brompheniramine (maleate), CAS:980-71-2, Molecular Weight: 435.3116, C20H23BrN2O4, Purity:98, SMILES: O=C(O)/C=C\C(O)=O.CN(C)CCC(C1=CC=CC=N1)C2=CC=C(Br)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BX-912, CAS:702674-56-4, Molecular Weight: 471.3536, C20H23BrN8O, Purity:98, SMILES: BrC1=C(NCCC2=CNC=N2)N=C(NC3=CC(NC(N4CCCC4)=O)=CC=C3)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Calcium N5-methyltetrahydrofolate, CAS:26560-38-3, Molecular Weight: 497.5179, C20H23CaN7O6, Purity:98, SMILES: O=C([O-])CC[C@@H](C([O-])=O)NC(C1=CC=C(NCC2N(C)C3=C(N=C(N)NC3=O)NC2)C=C1)=O.[Ca+2], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Levomefolate (calcium), CAS:151533-22-1, Molecular Weight: 497.5179, C20H23CaN7O6, Purity:98, SMILES: O=C([O-])CC[C@@H](C([O-])=O)NC(C1=CC=C(NC[C@@H]2N(C)C3=C(N=C(N)NC3=O)NC2)C=C1)=O.[Ca+2], HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB 271046 (Hydrochloride), CAS:209481-24-3, Molecular Weight: 488.4509, C20H23Cl2N3O3S2, Purity:98, SMILES: ClC1=CC2=C(C=C1)SC(S(=O)(NC3=CC=C(C(N4CCNCC4)=C3)OC)=O)=C2C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LPA2 antagonist 1, CAS:1017606-66-4, Molecular Weight: 500.4649, C20H23Cl2N5O2S2, Purity:98, SMILES: ClC1=C(Cl)C=C(S(=O)(N2CCN(C[C@@H](NC3=NC=NC4=C3SC=C4C)C)CC2)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 1-(2-((Tert-ButoxycarbonylAminoEthyl-3-(3-Chlorophenyl-4-(((TrifluoromethylSulfonylOxy-1H-Pyrazole-5-Carboxylate, CAS:0, Molecular Weight: 541.926, C20H23ClF3N3O7S, Purity:95, SMILES: CCOC(=O)C1=C(OS(=O)(=O)C(F)(F)F)C(=NN1CCNC(=O)OC(C)(C)C)C1=CC(Cl)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 1-(2-((Tert-ButoxycarbonylAminoEthyl-3-(4-Chlorophenyl-4-(((TrifluoromethylSulfonylOxy-1H-Pyrazole-5-Carboxylate, CAS:0, Molecular Weight: 541.926, C20H23ClF3N3O7S, Purity:95, SMILES: CCOC(=O)C1=C(OS(=O)(=O)C(F)(F)F)C(=NN1CCNC(=O)OC(C)(C)C)C1=CC=C(Cl)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NMDA-IN-1, CAS:700878-19-9, Molecular Weight: 375.8675, C20H23ClFN3O, Purity:98, SMILES: OC1=CC=C2N=C(CN3CCC(CC4=CC=CC=C4F)CC3)NC2=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Eliprodil, CAS:119431-25-3, Molecular Weight: 347.8541, C20H23ClFNO, Purity:98, SMILES: ClC(C=C1)=CC=C1C(O)CN(CC2)CCC2CC3=CC=C(F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| YM-46303, CAS:171722-81-9, Molecular Weight: 358.86182, C20H23ClN2O2, Purity:98, SMILES: O=C(OC12CCN(CC2)CC1)NC3=CC=CC=C3C4=CC=CC=C4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chlorpheniramine (maleate), CAS:113-92-8, Molecular Weight: 390.8606, C20H23ClN2O4, Purity:98, SMILES: CN(C)CCC(C1=CC=C(Cl)C=C1)C2=CC=CC=N2.O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dexchlorpheniramine (maleate), CAS:2438-32-6, Molecular Weight: 390.8606, C20H23ClN2O4, Purity:98, SMILES: O=C(O)/C=C\C(O)=O.CN(C)CC[C@H](C1=NC=CC=C1)C2=CC=C(Cl)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9H-Purine, 2-chloro-9-[[3-(cyclopentyloxy)-4-methoxyphenyl]methyl]-6,8-dimethyl-, CAS:225100-12-9, Molecular Weight: 386.87522, C20H23ClN4O2, Purity:98, SMILES: CC1=NC2=C(C)N=C(Cl)N=C2N1CC3=CC=C(OC)C(OC4CCCC4)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK2256098, CAS:1224887-10-8, Molecular Weight: 414.8886, C20H23ClN6O2, Purity:98, SMILES: O=C(NOC)C1=CC=CC=C1NC2=CC(NC3=CC(C)=NN3C(C)C)=NC=C2Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-1-(2,3-bis(benzyloxy)propyl)cyclopropane-1-sulfonyl chloride, CAS:1258884-22-8, Molecular Weight: 394.912, C20H23ClO4S, Purity:95, SMILES: ClS(=O)(=O)C1(C[C@@H](COCc2ccccc2)OCc2ccccc2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MK-8998, CAS:953778-58-0, Molecular Weight: 380.4040296, C20H23F3N2O2, Purity:98, SMILES: O=C(N[C@@H](C1=NC=C(OCC(F)(F)F)C=C1)C)CC2=CC=C(C(C)C)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PBTZ169, CAS:1377239-83-2, Molecular Weight: 456.4818296, C20H23F3N4O3S, Purity:98, SMILES: O=C1C2=CC(C(F)(F)F)=CC([N+]([O-])=O)=C2SC(N3CCN(CC4CCCCC4)CC3)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NCT-503, CAS:1916571-90-8, Molecular Weight: 408.4836296, C20H23F3N4S, Purity:98, SMILES: S=C(N1CCN(CC2=CC=C(C(F)(F)F)C=C2)CC1)NC3=NC(C)=CC(C)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 1-(2-((Tert-ButoxycarbonylAminoEthyl-3-(4-Fluorophenyl-4-(((TrifluoromethylSulfonylOxy-1H-Pyrazole-5-Carboxylate, CAS:0, Molecular Weight: 525.471, C20H23F4N3O7S, Purity:95, SMILES: CCOC(=O)C1=C(OS(=O)(=O)C(F)(F)F)C(=NN1CCNC(=O)OC(C)(C)C)C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-FLUORO-2-((4-IODOBENZO[D][1,3]DIOXOL-5-YL)METHYL)-1-(3-(ISOPROPYLAMINO)PROPYL)-1H-IMIDAZO[4,5-C]PYRIDIN-4-AMINE, CAS:1799421-10-5, Molecular Weight: 511.3318, C20H23FIN5O2, Purity:95, SMILES: CC(C)NCCCn1c(Cc2ccc3OCOc3c2I)nc2c(N)nc(F)cc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2H-Pyran-4-propanamide, α-[4-(cyclopropylsulfonyl)phenyl]-N-(5-fluoro-2-thiazolyl)tetrahydro-, (αR)-, CAS:745051-61-0, Molecular Weight: 438.5360232, C20H23FN2O4S2, Purity:98, SMILES: O=C(NC1=NC=C(F)S1)[C@@H](C2=CC=C(S(=O)(C3CC3)=O)C=C2)CC4CCOCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Desethyl Sunitinib, CAS:356068-97-8, Molecular Weight: 370.4206, C20H23FN4O2, Purity:98, SMILES: O=C1NC2=CC=C(F)C=C2/C1=C/C3=C(C)C(C(NCCNCC)=O)=C(C)N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl (4,6-diamino-2-(1-(2-fluorobenzyl)-4,5,6,7-tetrahydro-1H-pyrazolo[3,4-b]pyridin-3-yl)pyrimidin-5-yl)(methyl)carbamate, CAS:, Molecular Weight: 426.4474, C20H23FN8O2, Purity:95, SMILES: O=C(OC)N(C1=C(N)N=C(C2=NN(CC3=CC=CC=C3F)C4=C2CCCN4)N=C1N)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MCC950 (sodium), CAS:256373-96-3, Molecular Weight: 426.4618, C20H23N2NaO5S, Purity:98, SMILES: O=S(C1=CC(C(C)(O)C)=CO1)([N-]C(NC2=C3CCCC3=CC4=C2CCC4)=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| S1RA, CAS:878141-96-9, Molecular Weight: 337.4155, C20H23N3O2, Purity:98, SMILES: CC1=CC(OCCN2CCOCC2)=NN1C3=CC(C=CC=C4)=C4C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tenovin-1, CAS:380315-80-0, Molecular Weight: 369.4805, C20H23N3O2S, Purity:98, SMILES: O=C(NC(NC1=CC=C(NC(C)=O)C=C1)=S)C2=CC=C(C(C)(C)C)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BI-7273, CAS:1883429-21-7, Molecular Weight: 353.4149, C20H23N3O3, Purity:98, SMILES: CN(C)CC1=C(OC)C=C(C(C2=C3C=NC=C2)=CN(C)C3=O)C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BI-9564, CAS:1883429-22-8, Molecular Weight: 353.4149, C20H23N3O3, Purity:98, SMILES: CN(C)CC1=CC(OC)=C(C(C2=C3C=NC=C2)=CN(C)C3=O)C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ICI141292, CAS:86880-51-5, Molecular Weight: 369.41432, C20H23N3O4, Purity:98, SMILES: O=C(NCCNCC(O)COC1=CC=CC=C1C#N)CC2=CC=C(O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NU6300, CAS:, Molecular Weight: 413.4933, C20H23N5O3S, Purity:98, SMILES: O=S(C(C=C1)=CC=C1NC2=NC(OCC3CCCCC3)=C4C(NC=N4)=N2)(C=C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Folinic acid, CAS:58-05-9, Molecular Weight: 473.4393, C20H23N7O7, Purity:98, SMILES: O=C(O)CC[C@@H](C(O)=O)NC(C1=CC=C(NCC2N(C=O)C3=C(N=C(N)NC3=O)NC2)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Dibenzylamino)cyclohexanone, CAS:149506-79-6, Molecular Weight: 293.4027, C20H23NO, Purity:95, SMILES: O=C1CCC(CC1)N(Cc1ccccc1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Benzyl-3-Phenyl-8-Azabicyclo[3.2.1]Octan-3-Ol, CAS:0, Molecular Weight: 293.4027, C20H23NO, Purity:95, SMILES: OC1(CC2CCC(C1)N2CC1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JNJ16259685, CAS:409345-29-5, Molecular Weight: 325.4015, C20H23NO3, Purity:98, SMILES: O=C(C1=CC=C2N=C3C(CCCO3)=CC2=C1)[C@H]4CC[C@@H](OC)CC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (-)-Isocorypalmine, CAS:483-34-1, Molecular Weight: 341.4009, C20H23NO4, Purity:98, SMILES: OC(C=C1[C@@]2([H])N3CC4=C(C=CC(OC)=C4OC)C2)=C(C=C1CC3)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-3-(4-(BENZYLOXYPHENYL-2-BUTYRAMIDOPROPANOIC ACID, CAS:172992-35-7, Molecular Weight: 341.4009, C20H23NO4, Purity:95, SMILES: CCCC(=O)N[C@@H](CC1=CC=C(OCC2=CC=CC=C2)C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Efaproxiral, CAS:131179-95-8, Molecular Weight: 341.4009, C20H23NO4, Purity:98, SMILES: CC(C)(OC1=CC=C(CC(NC2=CC(C)=CC(C)=C2)=O)C=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Picloxydine, CAS:5636-92-0, Molecular Weight: 475.37756, C20H24Cl2N10, Purity:98, SMILES: N=C(N1CCN(C(NC(NC2=CC=C(Cl)C=C2)=N)=N)CC1)NC(NC3=CC=C(Cl)C=C3)=N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amitriptyline (hydrochloride), CAS:549-18-8, Molecular Weight: 313.8643, C20H24ClN, Purity:98, SMILES: CN(C)CC/C=C1C2=CC=CC=C2CCC3=C\1C=CC=C3.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Maprotiline (hydrochloride), CAS:10347-81-6, Molecular Weight: 313.8643, C20H24ClN, Purity:98, SMILES: CNCCCC1(CC2)C3=CC=CC=C3C2C4=CC=CC=C14.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NEO 376, CAS:496921-73-4, Molecular Weight: 357.87706, C20H24ClN3O, Purity:98, SMILES: O=C1C2=C(N(CCN3CCN(C4=CC=CC(Cl)=C4)CC3)C=C2)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| S1RA (hydrochloride), CAS:1265917-14-3, Molecular Weight: 373.8765, C20H24ClN3O2, Purity:98, SMILES: CC1=CC(OCCN2CCOCC2)=NN1C3=CC(C=CC=C4)=C4C=C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SR9009, CAS:1379686-30-2, Molecular Weight: 437.9402, C20H24ClN3O4S, Purity:98, SMILES: O=C(N1CC(CN(CC2=CC=C(Cl)C=C2)CC3=CC=C([N+]([O-])=O)S3)CC1)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,2,4-Triazolo[4,3-a]pyridin-3(2H)-one, 2-[3-[(2S)-4-(3-chlorophenyl)-2-methyl-1-piperazinyl]propyl]-, CAS:161905-64-2, Molecular Weight: 385.89046, C20H24ClN5O, Purity:98, SMILES: O=C1N(CCCN2[C@@H](C)CN(C3=CC=CC(Cl)=C3)CC2)N=C4C=CC=CN41, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (4-Benzyl-Piperidin-1-Yl-Phenyl-Acetic Acid Hydrochloride, CAS:0, Molecular Weight: 345.863, C20H24ClNO2, Purity:95, SMILES: Cl.OC(=O)C(N1CCC(CC2=CC=CC=C2)CC1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Naltrexone (Hydrochloride), CAS:16676-29-2, Molecular Weight: 377.8618, C20H24ClNO4, Purity:98, SMILES: OC1=CC=C2C3=C1O[C@](C(CC4)=O)([H])[C@@]3(CCN5CC6CC6)[C@]4(O)[C@@]5([H])C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NMS-P118, CAS:1262417-51-5, Molecular Weight: 395.4187, C20H24F3N3O2, Purity:98, SMILES: FC(CC1)(F)CCC1N(CC2)CCC2N(C3=O)CC4=C3C(C(N)=O)=CC(F)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Boc-4-(2-(4-Fluoro-3-(trifluoromethyl)phenyl)-2-oxoethylcarbamoyl)piperidine, CAS:1082949-99-2, Molecular Weight: 432.4092, C20H24F4N2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)C(=O)NCC(=O)c1ccc(F)c(c1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ibiglustat, CAS:1401090-53-6, Molecular Weight: 389.4869, C20H24FN3O2S, Purity:98, SMILES: O=C(O[C@@H]1CN2CCC1CC2)NC(C)(C3=CSC(C4=CC=C(F)C=C4)=N3)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Balofloxacin, CAS:127294-70-6, Molecular Weight: 389.4207, C20H24FN3O4, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N4CC(NC)CCC4)=C3OC)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Balofloxacin, CAS:127294-73-9, Molecular Weight: 389.4207, C20H24FN3O4, Purity:98, SMILES: CNC1CCCN(C1)c1c(F)cc2c(c1OC)n(cc(C(O)=O)c2=O)C1CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Danofloxacin (mesylate), CAS:119478-55-6, Molecular Weight: 453.4845, C20H24FN3O6S, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N4[C@](C5)([H])CN(C)[C@]5([H])C4)=C3)C1=O)O.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Omecamtiv mecarbil, CAS:873697-71-3, Molecular Weight: 401.4347, C20H24FN5O3, Purity:98, SMILES: O=C(N1CCN(CC1)CC2=C(C(NC(NC3=CC=C(N=C3)C)=O)=CC=C2)F)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML RR-S2 CDA, CAS:1638241-89-0, Molecular Weight: 690.5431, C20H24N10O10P2S2, Purity:98, SMILES: OC1([H])[C@](O[P@](S)(OC[C@](O[C@@H](N2C3=NC=NC(N)=C3N=C2)[C@@H]4O)([H])[C@@]4([H])O5)=O)([H])[C@H](N6C7=NC=NC(N)=C7N=C6)O[C@]1([H])CO[P@]5(S)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| c-di-AMP, CAS:54447-84-6, Molecular Weight: 658.411884, C20H24N10O12P2, Purity:98, SMILES: O[C@H]([C@@](OP(O)(OC[C@](O[C@@H](N1C2=NC=NC(N)=C2N=C1)[C@@H]3O)([H])[C@@]3([H])O4)=O)([H])[C@](COP4(O)=O)([H])O5)[C@@H]5N6C7=NC=NC(N)=C7N=C6, HPLC, NMR, LCMS is ok, stock more than 10g. |
| cGAMP, CAS:849214-04-6, Molecular Weight: 674.4113, C20H24N10O13P2, Purity:98, SMILES: O=P(O[C@H]1[C@@H](O)[C@H](N2C=NC3=C2N=CN=C3N)O[C@@H]1COP4(O)=O)(O)OC[C@@H]5[C@@H](O4)[C@@H](O)[C@H](N6C=NC7=C6N=C(N)NC7=O)O5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Aligeron, CAS:70713-45-0, Molecular Weight: 292.41796, C20H24N2, Purity:98, SMILES: C=CCN1CCN(C(C2=CC=CC=C2)C3=CC=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Quinidine, CAS:56-54-2, Molecular Weight: 324.41676, C20H24N2O2, Purity:98, SMILES: C=C[C@H]1C[N@](CC[C@H]1C2)[C@@]2([H])[C@@H](O)C3=CC=NC4=CC=C(OC)C=C34, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pheniramine (Maleate), CAS:132-20-7, Molecular Weight: 356.4156, C20H24N2O4, Purity:98, SMILES: CN(C)CCC(C1=CC=CC=C1)C2=CC=CC=N2.O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MCC950, CAS:210826-40-7, Molecular Weight: 404.4799, C20H24N2O5S, Purity:98, SMILES: O=S(C1=CC(C(C)(O)C)=CO1)(NC(NC2=C3CCCC3=CC4=C2CCC4)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nisoldipine, CAS:63675-72-9, Molecular Weight: 388.41436, C20H24N2O6, Purity:98, SMILES: O=C(C1=C(C)NC(C)=C(C(OCC(C)C)=O)C1C2=CC=CC=C2[N+]([O-])=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dolasetron (Mesylate), CAS:115956-13-3, Molecular Weight: 420.4794, C20H24N2O6S, Purity:98, SMILES: O=C(C1=CNC2=C1C=CC=C2)O[C@@H]3C[C@@](CC4C5)([H])[N@](CC4=O)[C@@]5([H])C3.O=S(C)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lucanthone, CAS:479-50-5, Molecular Weight: 340.4824, C20H24N2OS, Purity:98, SMILES: O=C1C2=C(SC3=C1C=CC=C3)C(C)=CC=C2NCCN(CC)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LF3, CAS:664969-54-4, Molecular Weight: 416.56016, C20H24N4O2S2, Purity:98, SMILES: S=C(N1CCN(C/C=C/C2=CC=CC=C2)CC1)NC3=CC=C(S(=O)(N)=O)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Istradefylline, CAS:155270-99-8, Molecular Weight: 384.429, C20H24N4O4, Purity:98, SMILES: O=C1C2=C(N=C(/C=C/C3=CC(OC)=C(OC)C=C3)N2C)N(CC)C(N1CC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GPDA, CAS:65096-46-0, Molecular Weight: 464.49216, C20H24N4O7S, Purity:98, SMILES: O=C([C@H](CCC1)N1C(CN)=O)NC2=CC=C([N+]([O-])=O)C=C2.O=S(C3=CC=C(C)C=C3)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD6738, CAS:1352226-88-0, Molecular Weight: 412.5085, C20H24N6O2S, Purity:98, SMILES: O=[S@@](C1(CC1)C2=NC(C3=C4C(NC=C4)=NC=C3)=NC(N5CCOC[C@H]5C)=C2)(C)=N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD-166866, CAS:192705-79-6, Molecular Weight: 396.44296, C20H24N6O3, Purity:98, SMILES: O=C(NC(C)(C)C)NC1=NC2=NC(N)=NC=C2C=C1C3=CC(OC)=CC(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CCT244747, CAS:1404095-34-6, Molecular Weight: 408.457, C20H24N8O2, Purity:98, SMILES: N#CC1=NC=C(NC2=NC=C(C3=CN(C)N=C3)C(OC)=C2)N=C1O[C@H](C)CN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ginkgolide B, CAS:15291-77-7, Molecular Weight: 424.3986, C20H24O10, Purity:98, SMILES: O[C@@H]1C(C2([C@H]3O)[C@](OC3=O)([H])O4)([C@@](O5)([H])C[C@H]2C(C)(C)C)C4(C5=O)[C@@](O)([C@@H]6C)[C@@]1([H])OC6=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ginkgolide C, CAS:15291-76-6, Molecular Weight: 440.3979, C20H24O11, Purity:98, SMILES: O[C@@H]1C2([C@@](O3)([H])[C@H](O)[C@H]4C(C)(C)C)C4([C@H]5O)[C@](OC5=O)([H])OC2(C3=O)[C@@](O)([C@@H]6C)[C@@]1([H])OC6=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethynyl Estradiol, CAS:57-63-6, Molecular Weight: 296.4034, C20H24O2, Purity:98, SMILES: OC1=CC=C2C(CC[C@]3([H])[C@]2([H])CC[C@@]4(C)[C@@]3([H])CC[C@]4(C#C)O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Exemestane, CAS:107868-30-4, Molecular Weight: 296.4034, C20H24O2, Purity:98, SMILES: C[C@]1([C@](CC2)([H])[C@]3([H])CC(C4=CC(C=C[C@]4(C)[C@@]3([H])CC1)=O)=C)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trenbolone (acetate), CAS:10161-34-9, Molecular Weight: 312.4028, C20H24O3, Purity:98, SMILES: O=C1CCC2=C3[C@@]([C@@](CC[C@@H]4OC(C)=O)([H])[C@]4(C)C=C3)([H])CCC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Triptophenolide, CAS:74285-86-2, Molecular Weight: 312.4028, C20H24O3, Purity:98, SMILES: O=C1C(CC[C@]2(C)C3=C(CC[C@]24[H])C(O)=C(C(C)C)C=C3)=C4CO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Macelignan, CAS:107534-93-0, Molecular Weight: 328.4022, C20H24O4, Purity:98, SMILES: OC1=CC=C(C[C@H](C)[C@H](C)CC2=CC=C(OCO3)C3=C2)C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sobetirome, CAS:211110-63-3, Molecular Weight: 328.4022, C20H24O4, Purity:98, SMILES: O=C(O)COC1=CC(C)=C(CC2=CC=C(O)C(C(C)C)=C2)C(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Terbufibrol, CAS:56488-59-6, Molecular Weight: 344.40156, C20H24O5, Purity:98, SMILES: O=C(O)C1=CC=C(OCC(O)COC2=CC=C(C(C)(C)C)C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Triptolide, CAS:38748-32-2, Molecular Weight: 360.401, C20H24O6, Purity:98, SMILES: O=C1OCC2=C1CC[C@@]3(C)C2C[C@@H]4O[C@]4([C@@H]([C@@]5([C@H]6O5)C(C)C)O)[C@@]37[C@H]6O7, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ginkgolide A, CAS:15291-75-5, Molecular Weight: 408.3992, C20H24O9, Purity:98, SMILES: O=C1[C@@H](C)[C@]2(O)[C@@]3(C4=O)C(C5([C@@H](O)C(O6)=O)C6O3)([C@H](O4)C[C@H]5C(C)(C)C)C[C@]2([H])O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Benzyloxy-4-Methoxyboronic Acid, Pinacol Ester, CAS:1005010-03-6, Molecular Weight: 340.221, C20H25BO4, Purity:95, SMILES: COC1=C(OCC2=CC=CC=C2)C=C(C=C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(Benzyloxy-3-Methoxyphenylboronic Acid, Pinacol Ester, CAS:1000796-87-1, Molecular Weight: 340.221, C20H25BO4, Purity:95, SMILES: COC1=CC(=CC=C1OCC1=CC=CC=C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MAC13243, CAS:1071638-38-4, Molecular Weight: 442.4024, C20H25Cl2N3O2S, Purity:98, SMILES: ClC1=CC=C(CSC2=NCN(CCC3=CC(OC)=C(OC)C=C3)CN2)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JNJ-40411813, CAS:1127498-03-6, Molecular Weight: 344.8783, C20H25ClN2O, Purity:98, SMILES: O=C1C(Cl)=C(N2CCC(C3=CC=CC=C3)CC2)C=CN1CCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RG-12915, CAS:136174-04-4, Molecular Weight: 360.8777, C20H25ClN2O2, Purity:98, SMILES: O=C(C1=C2OC(CCCC3)C3C2=CC(Cl)=C1)NC4CN5CCC4CC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzonitrile, 4-[2-(4,4-dimethyl-2-oxo-3-oxazolidinyl)-4-thiazolyl]-Methanesulfonamide, N-[4-[1-hydroxy-2-[[(1,2,3,4-tetrahydro-1-oxo-2-naphthalenyl)methyl]amino]ethyl]phenyl]-, hydrochloride, CAS:129280-22-4, Molecular Weight: 424.9415, C20H25ClN2O4S, Purity:98, SMILES: CS(=O)(NC1=CC=C(C(O)CNCC(CCC2=C3C=CC=C2)C3=O)C=C1)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amlodipine, CAS:88150-42-9, Molecular Weight: 408.8759, C20H25ClN2O5, Purity:98, SMILES: O=C(C1=C(COCCN)NC(C)=C(C(OC)=O)C1C2=CC=CC=C2Cl)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BCTC, CAS:393514-24-4, Molecular Weight: 372.8917, C20H25ClN4O, Purity:98, SMILES: O=C(N1CCN(C2=NC=CC=C2Cl)CC1)NC3=CC=C(C(C)(C)C)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-5274857, CAS:1373615-35-0, Molecular Weight: 436.9555, C20H25ClN4O3S, Purity:98, SMILES: O=C(N1CCN(C2=NC=C(Cl)C(C3=NC=C(C)C=C3C)=C2)CC1)CCS(=O)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Purvalanol B, CAS:212844-54-7, Molecular Weight: 432.9039, C20H25ClN6O3, Purity:98, SMILES: O=C(O)C1=CC=C(NC2=C3N=CN(C(C)C)C3=NC(N[C@@H](CO)C(C)C)=N2)C=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity N, CAS:1394157-34-6, Molecular Weight: 501.3994, C20H25FN3O9P, Purity:98, SMILES: O=[P@@](N[C@@H](C)C(OC)=O)(OC[C@@H]1[C@@H](O)[C@](F)(C)[C@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BML-210, CAS:537034-17-6, Molecular Weight: 339.4314, C20H25N3O2, Purity:98, SMILES: O=C(NC1=CC=CC=C1N)CCCCCCC(NC2=CC=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pimelic Diphenylamide 106, CAS:937039-45-7, Molecular Weight: 339.4314, C20H25N3O2, Purity:98, SMILES: O=C(NC1=CC=CC=C1N)CCCCCC(NC2=CC=C(C)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RG2833, CAS:1215493-56-3, Molecular Weight: 339.4314, C20H25N3O2, Purity:98, SMILES: O=C(NCCCCCC(NC1=CC=CC=C1N)=O)C2=CC=C(C)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Imoxiterol, CAS:88578-07-8, Molecular Weight: 355.4308, C20H25N3O3, Purity:98, SMILES: OC(CNC(C)CCN1C2=CC=CC=C2N=C1)C3=CC=C(O)C(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nampt-IN-1, CAS:1698878-14-6, Molecular Weight: 419.4946, C20H25N3O5S, Purity:98, SMILES: O=C(N1CCC(C=C(NS(CC(C)(C)O)(=O)=O)C=C2)=C2C1)COC3=CN=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| EPZ015666, CAS:1616391-65-1, Molecular Weight: 383.4442, C20H25N5O3, Purity:98, SMILES: O=C(NC[C@H](O)CN1CCC(C=CC=C2)=C2C1)C3=CC(NC4COC4)=NC=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SR121566A, CAS:180144-61-0, Molecular Weight: 431.5086, C20H25N5O4S, Purity:98, SMILES: O=C(O)CN1CCC(N(C2=NC(C3=CC=C(C(N)=N)C=C3)=CS2)CCC(O)=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-04447943, CAS:1082744-20-4, Molecular Weight: 395.4582, C20H25N7O2, Purity:98, SMILES: O=C1C2=C(N(C3CCOCC3)N=C2)N=C([C@@H]4CN(CC5=NC=CC=N5)C[C@H]4C)N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Levomefolic acid, CAS:31690-09-2, Molecular Weight: 459.4558, C20H25N7O6, Purity:98, SMILES: O=C(O)CC[C@@H](C(O)=O)NC(C1=CC=C(NC[C@@H]2N(C)C3=C(NC(N)=NC3=O)NC2)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1r,4r)-4-(dibenzylamino)cyclohexanol, CAS:149506-81-0, Molecular Weight: 295.4186, C20H25NO, Purity:95, SMILES: O[C@@H]1CC[C@H](CC1)N(Cc1ccccc1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dienogest, CAS:65928-58-7, Molecular Weight: 311.418, C20H25NO2, Purity:98, SMILES: C[C@@]12[C@](O)(CC#N)CC[C@@]1([H])[C@]3([H])CCC4=CC(CCC4=C3CC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ENMD-119, CAS:864668-87-1, Molecular Weight: 311.418, C20H25NO2, Purity:98, SMILES: C[C@@]12C=CC[C@@]1([H])[C@]3([H])CCC4=C(C=C(OC)C(C(N)=O)=C4)[C@@]3([H])CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tiagabine, CAS:115103-54-3, Molecular Weight: 375.548, C20H25NO2S2, Purity:98, SMILES: O=C([C@H]1CN(CC/C=C(C2=C(C)C=CS2)/C3=C(C)C=CS3)CCC1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ((2R,6S)-4-benzyl-6-(benzyloxymethyl)morpholin-2-yl)methanol, CAS:1093085-89-2, Molecular Weight: 327.4174, C20H25NO3, Purity:95, SMILES: OC[C@@H]1O[C@H](COCc2ccccc2)CN(C1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ((2S,6R)-4-benzyl-6-(benzyloxymethyl)morpholin-2-yl)methanol, CAS:, Molecular Weight: 327.4174, C20H25NO3, Purity:95, SMILES: OC[C@@H]1CN(CC2=CC=CC=C2)C[C@H](COCC3=CC=CC=C3)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cilomilast, CAS:153259-65-5, Molecular Weight: 343.4168, C20H25NO4, Purity:98, SMILES: O=C([C@H]1CC[C@@](C#N)(CC1)C2=CC=C(OC)C(OC3CCCC3)=C2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenepropanoic acid, α-methoxy-4-[[3-[4-[(methylsulfonyl)oxy]phenyl]propyl]amino]-, (αS)-, CAS:539813-69-9, Molecular Weight: 407.4806, C20H25NO6S, Purity:98, SMILES: OC([C@@H](OC)CC1=CC=C(NCCCC2=CC=C(OS(C)(=O)=O)C=C2)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GW791343 (dihydrochloride), CAS:1019779-04-4, Molecular Weight: 447.3495, C20H26Cl2F2N4O, Purity:98, SMILES: O=C(NC1=CC(CN2CCNCC2)=CC=C1C)CNC3=CC=C(F)C(F)=C3.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prodipine (hydrochloride), CAS:31314-39-3, Molecular Weight: 315.88014, C20H26ClN, Purity:98, SMILES: CC(C)N1CCC(C2=CC=CC=C2)(CC1)C3=CC=CC=C3.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefetamet pivoxil (hydrochloride), CAS:111696-23-2, Molecular Weight: 548.0327, C20H26ClN5O7S2, Purity:98, SMILES: O=C(C(N12)=C(C)CS[C@]2([H])[C@H](NC(/C(C3=CSC(N)=N3)=N\OC)=O)C1=O)OCOC(C(C)(C)C)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Adiphenine (hydrochloride), CAS:50-42-0, Molecular Weight: 347.8789, C20H26ClNO2, Purity:98, SMILES: O=C(OCCN(CC)CC)C(C1=CC=CC=C1)C2=CC=CC=C2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tiagabine (hydrochloride), CAS:145821-59-6, Molecular Weight: 412.0089, C20H26ClNO2S2, Purity:98, SMILES: O=C([C@H]1CN(CC/C=C(C2=C(C)C=CS2)/C3=C(C)C=CS3)CCC1)O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Naltrexone metabolite 6β-Naltrexol (hydrochloride), CAS:55488-86-3, Molecular Weight: 379.8777, C20H26ClNO4, Purity:98, SMILES: O[C@@]12[C@]3([C@@H](O4)[C@H](O)CC2)C5=C4C(O)=CC=C5C[C@H]1N(CC6CC6)CC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-benzyl 7-tert-butyl 9,9-difluoro-3,7-diaza-bicyclo[3.3.1]nonane-3,7-dicarboxylate, CAS:, Molecular Weight: 396.4282, C20H26F2N2O4, Purity:95, SMILES: O=C(N1CC2CN(CC(C1)C2(F)F)C(=O)OC(C)(C)C)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gatifloxacin (mesylate), CAS:316819-28-0, Molecular Weight: 471.4998, C20H26FN3O7S, Purity:98, SMILES: CC1NCCN(C2=C(F)C=C3C(N(C4CC4)C=C(C(O)=O)C3=O)=C2OC)C1.O=S(C)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ajmaline, CAS:4360-12-7, Molecular Weight: 326.4326, C20H26N2O2, Purity:98, SMILES: CN1C2=CC=CC=C2[C@@]34[C@]1([H])[C@@](CC5[C@H](CC)[C@H]6O)([H])N6[C@]([H])(C5[C@H]4O)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hydroquinidine, CAS:1435-55-8, Molecular Weight: 326.4326, C20H26N2O2, Purity:98, SMILES: O[C@H]([C@]1([H])[N@@](CC2)C[C@H](CC)[C@@H]2C1)C3=CC=NC4=CC=C(OC)C=C34, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Verilopam, CAS:68318-20-7, Molecular Weight: 326.43264, C20H26N2O2, Purity:98, SMILES: NC1=CC=C(CCN2CCC3=CC(OC)=C(OC)C=C3CC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PTACH, CAS:848354-66-5, Molecular Weight: 390.5627, C20H26N2O2S2, Purity:98, SMILES: CC(C)C(SCCCCCCC(NC1=NC(C2=CC=CC=C2)=CS1)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Benzyl 2-Tert-Butyl 8-Oxo-2,5-Diazaspiro[3.5]Nonane-2,5-Dicarboxylate, CAS:1824026-93-8, Molecular Weight: 374.4308, C20H26N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CC(=O)CCN2C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-2-Boc-5-Cbz-6A-H-Hexahydro-Pyrrolo[3,4-C]Pyrrole-3A-Carboxylicacid, CAS:1217766-30-7, Molecular Weight: 390.4302, C20H26N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2CN(C[C@@]2(C1)C(O)=O)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(1R,3R,4R-3-(((BenzyloxyCarbonylAmino-7-(Tert-Butoxycarbonyl-7-Azabicyclo[2.2.1]Heptane-1-Carboxylic Acid, CAS:1445949-59-6, Molecular Weight: 390.4302, C20H26N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)N1C2CCC1(C[C@H]2NC(=O)OCC1=CC=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(2S,3aS,6aS-1-((benzyloxycarbonyl-5-(tert-butoxycarbonyloctahydropyrrolo[3,4-b]pyrrole-2-carboxylic acid, CAS:1251001-87-2, Molecular Weight: 390.4302, C20H26N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2C[C@H](N([C@@H]2C1)C(=O)OCC1=CC=CC=C1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dolasetron (Mesylate hydrate), CAS:878143-33-0, Molecular Weight: 438.4946, C20H26N2O7S, Purity:98, SMILES: O=C(C1=CNC2=C1C=CC=C2)O[C@@H]3C[C@@](CC4C5)([H])[N@](CC4=O)[C@@]5([H])C3.O=S(C)(O)=O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl (4-(4-Benzylmorpholin-2-YlPyrimidin-5-YlCarbamate, CAS:0, Molecular Weight: 370.4454, C20H26N4O3, Purity:95, SMILES: CC(C)(C)OC(=O)NC1=CN=CN=C1C1CN(CC2=CC=CC=C2)CCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Niperotidine, CAS:84845-75-0, Molecular Weight: 434.5092, C20H26N4O5S, Purity:98, SMILES: O=[N+](/C=C(NCCSCC1=CC=C(CN(C)C)O1)\NCC2=CC=C(OCO3)C3=C2)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| SCH-1473759, CAS:1094069-99-4, Molecular Weight: 426.5385, C20H26N8OS, Purity:98, SMILES: CC1=CN2C(C(NC3=CC(CN(C(C)(CO)C)CC)=NS3)=N1)=NC=C2C4=CNN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Norethindrone, CAS:68-22-4, Molecular Weight: 298.4193, C20H26O2, Purity:98, SMILES: C[C@@]1([C@]2(O)C#C)[C@](CC2)([H])[C@@](CCC3=CC4=O)([H])[C@]([C@@]3([H])CC4)([H])CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (8S,13S,14S)-13-methyl-1,2,6,7,8,12,13,14,15,16-decahydrospiro[cyclopenta[a]phenanthrene-3,2'-[1,3]dioxolan]-17(4H)-one, CAS:5571-36-8, Molecular Weight: 314.4186, C20H26O3, Purity:95, SMILES: [H][C@@]12CCC(=O)[C@@]1(C)CC=C1[C@H]2CCC2=C1CCC1(C2)OCCO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| β-Estradiol 17-acetate, CAS:1743-60-8, Molecular Weight: 314.4186, C20H26O3, Purity:98, SMILES: C[C@@]1([C@H]2OC(C)=O)[C@](CC2)([H])[C@@](CCC3=C4C=CC(O)=C3)([H])[C@]4([H])CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(2-(2-(benzyloxyethoxyethoxyethyl 4-methylbenzenesulfonate, CAS:84131-04-4, Molecular Weight: 394.482, C20H26O6S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)OCCOCCOCCOCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ambutonium (bromide), CAS:115-51-5, Molecular Weight: 391.34518, C20H27BrN2O, Purity:98, SMILES: C[N+](C)(CC)CCC(C1=CC=CC=C1)(C(N)=O)C2=CC=CC=C2.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| GW791343 (trihydrochloride), CAS:309712-55-8, Molecular Weight: 483.8104, C20H27Cl3F2N4O, Purity:98, SMILES: O=C(NC1=CC(CN2CCNCC2)=CC=C1C)CNC3=CC=C(F)C(F)=C3.[H]Cl.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Itopride (hydrochloride), CAS:122892-31-3, Molecular Weight: 394.8924, C20H27ClN2O4, Purity:98, SMILES: O=C(NCC1=CC=C(OCCN(C)C)C=C1)C2=CC=C(OC)C(OC)=C2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl ((2S,3S-4-chloro-3-hydroxy-1-(4-((2-methylthiazol-4-ylmethoxyphenylbutan-2-ylcarbamate, CAS:0, Molecular Weight: 426.957, C20H27ClN2O4S, Purity:95, SMILES: CC1=NC(COC2=CC=C(C[C@H](NC(=O)OC(C)(C)C)[C@H](O)CCl)C=C2)=CS1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SCH-1473759 (hydrochloride), CAS:1094067-13-6, Molecular Weight: 462.9994, C20H27ClN8OS, Purity:98, SMILES: [H]Cl.CC1=CN2C(C(NC3=CC(CN(C(C)(CO)C)CC)=NS3)=N1)=NC=C2C4=CNN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| A37203, CAS:220519-06-2, Molecular Weight: 456.5281896, C20H27F3N6OS, Purity:98, SMILES: O=C1NC(SCCCN2CCN(C3=NC(C(C)(C)C)=NC(C(F)(F)F)=C3)CC2)=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3aR,4R,6aS-tert-butyl 4-(benzyloxycarbonylamino-3a-fluorohexahydrocyclopenta[c]pyrrole-2(1H-carboxylate, CAS:1391728-16-7, Molecular Weight: 378.4378, C20H27FN2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2CC[C@@H](NC(=O)OCC3=CC=CC=C3)[C@]2(F)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3aR,4S,6aS-tert-butyl 4-(benzyloxycarbonylamino-3a-fluorohexahydrocyclopenta[c]pyrrole-2(1H-carboxylate, CAS:1391728-17-8, Molecular Weight: 378.4378, C20H27FN2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2CC[C@H](NC(=O)OCC3=CC=CC=C3)[C@]2(F)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3aS,4S,6aR-tert-butyl 4-(benzyloxycarbonylamino-3a-fluorohexahydrocyclopenta[c]pyrrole-2(1H-carboxylate, CAS:1391728-15-6, Molecular Weight: 378.4378, C20H27FN2O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2CC[C@H](NC(=O)OCC3=CC=CC=C3)[C@@]2(F)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzamide, 4-[(1S,2S)-2-[[(2R)-4-cyclobutyl-2-methyl-1-piperazinyl]carbonyl]cyclopropyl]-, CAS:1240914-03-7, Molecular Weight: 341.44728, C20H27N3O2, Purity:98, SMILES: O=C(N)C1=CC=C([C@@H]2[C@@H](C(N3[C@H](C)CN(C4CCC4)CC3)=O)C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-(1-Benzyl-1H-Imidazol-2-Yl-4-Hydroxypiperidine-1-Carboxylate, CAS:1823794-46-2, Molecular Weight: 357.4467, C20H27N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(O)(CC1)C1=NC=CN1CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Benzyl 2-Tert-Butyl 10-Oxo-2,6,9-Triazaspiro[4.5]Decane-2,6-Dicarboxylate, CAS:1251020-61-7, Molecular Weight: 389.4455, C20H27N3O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)N(CCNC2=O)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Benzyl 2-Tert-Butyl 8-Oxo-2,6,9-Triazaspiro[4.5]Decane-2,6-Dicarboxylate, CAS:1251009-05-8, Molecular Weight: 389.4455, C20H27N3O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)CNC(=O)CN2C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oxolamine (citrate), CAS:1949-20-8, Molecular Weight: 437.4437, C20H27N3O8, Purity:98, SMILES: CCN(CC)CCC1=NC(C2=CC=CC=C2)=NO1.O=C(CC(C(O)=O)(O)CC(O)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Asp-Asp-Asp-Asp-Asp, CAS:, Molecular Weight: 593.4, C20H27N5O16, Purity:98, SMILES: [DDDDD], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cilostazol, CAS:73963-72-1, Molecular Weight: 369.4607, C20H27N5O2, Purity:98, SMILES: O=C1NC2=C(C=C(OCCCCC3=NN=NN3C4CCCCC4)C=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tegaserod (maleate), CAS:189188-57-6, Molecular Weight: 417.4589, C20H27N5O5, Purity:98, SMILES: O=C(O)/C=C\C(O)=O.COC1=CC=C(NC=C2/C=N/NC(NCCCCC)=N)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cerdulatinib, CAS:1198300-79-6, Molecular Weight: 445.5385, C20H27N7O3S, Purity:98, SMILES: O=S(N(CC1)CCN1C2=CC=C(NC3=NC=C(C(N)=O)C(NC4CC4)=N3)C=C2)(CC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ETP-46321, CAS:1252594-99-2, Molecular Weight: 473.5519, C20H27N9O3S, Purity:98, SMILES: NC(N=C1)=NC=C1C2=CN3C=C(CN4CCN(S(=O)(C)=O)CC4)N=C3C(N5CCOCC5)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amygdalin, CAS:29883-15-6, Molecular Weight: 457.42848, C20H27NO11, Purity:98, SMILES: O[C@H]1[C@H](O[C@@H](C#N)C2=CC=CC=C2)O[C@H](CO[C@H]3[C@@H]([C@H]([C@@H]([C@@H](CO)O3)O)O)O)[C@@H](O)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| D2343, CAS:72734-63-5, Molecular Weight: 329.43328, C20H27NO3, Purity:98, SMILES: OC(C1=CC=C(O)C=C1)CNC(C)(C)CCC2=C(C=CC=C2)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trilostane, CAS:13647-35-3, Molecular Weight: 329.4333, C20H27NO3, Purity:98, SMILES: OC1=C(C#N)C[C@@]2(C)[C@@]3(CC[C@]4([H])[C@]2([H])CC[C@@]5(C)[C@@]4([H])CC[C@@H]5O)[C@@H]1O3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1'-(Tert-Butoxycarbonyl-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-3-YlAcetic Acid, CAS:185526-66-3, Molecular Weight: 345.4327, C20H27NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(CC(O)=O)C3=C2C=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1'-(Tert-ButoxycarbonylSpiro[Chroman-2,4'-Piperidine]-4-YlAcetic Acid, CAS:952681-82-2, Molecular Weight: 361.4321, C20H27NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CC(CC(O)=O)C1=C(O2)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Tert-Butyl 2-(2-(Benzyloxy-2-OxoethylTetrahydro-2H-Furo[2,3-C]Pyrrole-5(3H-Carboxylate, CAS:0, Molecular Weight: 361.4321, C20H27NO5, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2CC(CC(=O)OCC3=CC=CC=C3)O[C@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 5,6-Dimethoxy-3-Oxo-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-1'-Carboxylate, CAS:948033-75-8, Molecular Weight: 361.4321, C20H27NO5, Purity:95, SMILES: COC1=C(OC)C=C2C(=C1)C(=O)CC21CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| L-Leucine benzyl ester p-toluenesulfonate, CAS:1738-77-8, Molecular Weight: 393.497, C20H27NO5S, Purity:97, SMILES: N[C@H](C(=O)OCc1ccccc1)CC(C)C.Cc1ccc(cc1)S(=O)(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Reboxetine (mesylate), CAS:98769-84-7, Molecular Weight: 409.49648, C20H27NO6S, Purity:98, SMILES: CS(=O)(O)=O.CCOC1=C(C=CC=C1)O[C@]([C@@]2([H])CNCCO2)([H])C3=CC=CC=C3.[relative stereochemistry], HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-(diphenyl((trimethylsilyl)oxy)methyl)pyrrolidine, CAS:848821-58-9, Molecular Weight: 325.52, C20H27NOSi, Purity:95, SMILES: C[Si](C)(C)OC([C@@H]1CCCN1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [1,1'-biphenyl]-2-yldi-tert-bu, CAS:224311-51-7, Molecular Weight: 298.4021, C20H27P, Purity:95, SMILES: CC(C)(C)P(c1ccccc1-c1ccccc1)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-(Phenylmethyl)-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-8-azabicyclo[3.2.1]oct-2-ene, CAS:1123661-15-3, Molecular Weight: 325.253, C20H28BNO2, Purity:95, SMILES: CC1(C)OB(OC1(C)C)C1=CC2CCC(C1)N2CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Imidapril (hydrochloride), CAS:89396-94-1, Molecular Weight: 441.9058, C20H28ClN3O6, Purity:98, SMILES: O=C([C@H](CN1C)N(C([C@@H](N[C@H](C(OCC)=O)CCC2=CC=CC=C2)C)=O)C1=O)O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cyclobutanecarboxamide, 3-fluoro-3-[3-fluoro-4-(1-pyrrolidinylmethyl)phenyl]-N-(2-methylpropyl)-, cis-, CAS:935840-13-4, Molecular Weight: 350.4459264, C20H28F2N2O, Purity:98, SMILES: F[C@@]1(C2=CC(F)=C(CN3CCCC3)C=C2)C[C@@H](C(NCC(C)C)=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-butyl 4-ethyl 4-(4-fluorobenzyl)piperidine-1,4-dicarboxylate(with Methy ester analog), CAS:917755-77-2, Molecular Weight: 365.439, C20H28FNO4, Purity:95, SMILES: CCOC(=O)C1(CC2=CC=C(F)C=C2)CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-tert-butyl 4-Ethyl 4-(4-fluorobenzyl)piperidine-1,4-dicarboxylate(with Methy ester analog), CAS:917755-77-2, Molecular Weight: 365.439, C20H28FNO4, Purity:95, SMILES: CCOC(=O)C1(CCN(CC1)C(=O)OC(C)(C)C)Cc1ccc(cc1)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-benzyl-7-Boc-2,7-diazaspiro[4,5]decan-1-one, CAS:1198284-76-2, Molecular Weight: 344.4479, C20H28N2O3, Purity:95, SMILES: O=C(N1CCCC2(C1)CCN(C2=O)Cc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Enalapril, CAS:75847-73-3, Molecular Weight: 376.4467, C20H28N2O5, Purity:98, SMILES: O=C(O)[C@H]1N(C([C@H](C)N[C@H](C(OCC)=O)CCC2=CC=CC=C2)=O)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(3aS,7S,7aS-tert-butyl 7-(benzyloxycarbonylaminohexahydrofuro[3,2-c]pyridine-5(6H-carboxylate, CAS:0, Molecular Weight: 376.4467, C20H28N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@@H]2CCO[C@@H]2[C@H](C1)NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-2-Benzyl 5-Tert-Butyl 3A-(HydroxymethylTetrahydropyrrolo[3,4-C]Pyrrole-2,5(1H,3H-Dicarboxylate, CAS:1823269-90-4, Molecular Weight: 376.4467, C20H28N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2CN(CC2(CO)C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 9-(Benzyloxycarbonylamino-3-Oxa-7-Azabicyclo[3.3.1]Nonane-7-Carboxylate, CAS:1341035-20-8, Molecular Weight: 376.4467, C20H28N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2COCC(C1)C2NC(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tamsulosin, CAS:106133-20-4, Molecular Weight: 408.5117, C20H28N2O5S, Purity:98, SMILES: O=S(C1=CC(C[C@H](NCCOC2=CC=CC=C2OCC)C)=CC=C1OC)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,4-Piperidinedicarboxylic Acid, 4-[[(1,1-DimethylethoxyCarbonyl]Amino]-, 4-Methyl 1-(Phenylmethyl Ester, CAS:115655-43-1, Molecular Weight: 392.4461, C20H28N2O6, Purity:95, SMILES: COC(=O)C1(CCN(CC1)C(=O)OCC1=CC=CC=C1)NC(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl 3-methyl 5-(tert-butoxycarbonylamino)piperidine-1,3-dicarboxylate, CAS:1221819-24-4, Molecular Weight: 392.4461, C20H28N2O6, Purity:95, SMILES: COC(=O)C1CC(NC(=O)OC(C)(C)C)CN(C1)C(=O)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GM6001, CAS:142880-36-2, Molecular Weight: 388.4607, C20H28N4O4, Purity:98, SMILES: O=C(N[C@@H](CC1=CNC2=C1C=CC=C2)C(NC)=O)[C@H](CC(C)C)CC(NO)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CVT-313, CAS:199986-75-9, Molecular Weight: 400.4747, C20H28N6O3, Purity:98, SMILES: CC(N1C=NC2=C(NCC3=CC=C(OC)C=C3)N=C(N(CCO)CCO)N=C12)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| All-trans-retinal, CAS:116-31-4, Molecular Weight: 284.4357, C20H28O, Purity:95, SMILES: O=C/C=C(/C=C/C=C(/C=C/C1=C(C)CCCC1(C)C)\C)\C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isotretinoin, CAS:4759-48-2, Molecular Weight: 300.43512, C20H28O2, Purity:98, SMILES: CC1(C)C(/C=C/C(C)=C/C=C/C(C)=C\C(O)=O)=C(C)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Retinoic acid, CAS:302-79-4, Molecular Weight: 300.4351, C20H28O2, Purity:98, SMILES: CC1(C)C(/C=C/C(C)=C/C=C/C(C)=C/C(O)=O)=C(C)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Retinoic acid, CAS:302-79-4, Molecular Weight: 300.4351, C20H28O2, Purity:97, SMILES: CC(C=CC1=C(C)CCCC1(C)C)=CC=CC(C)=CC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 14-Deoxy-11,12-didehydroandrographolide, CAS:42895-58-9, Molecular Weight: 332.4339, C20H28O4, Purity:98, SMILES: O=C1OCC=C1/C=C/[C@@H]2C(CC[C@]3([H])[C@](C)(CO)[C@H](O)CC[C@@]23C)=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 20-Deoxyingenol, CAS:54706-99-9, Molecular Weight: 332.4339, C20H28O4, Purity:98, SMILES: O=C1[C@@]2(C=C(C)[C@@H]3O)[C@]3(O)[C@H](O)C(C)=C[C@@]1([H])[C@@]4([H])[C@@](C4(C)C)([H])C[C@H]2C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dehydroandrographolide, CAS:134418-28-3, Molecular Weight: 332.4339, C20H28O4, Purity:98, SMILES: C[C@@]([C@H]1C/C=C(C=CO2)/C2=O)(CC[C@H]3O)[C@@](CCC1=C)([H])[C@]3(C)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ingenol, CAS:30220-46-3, Molecular Weight: 348.4333, C20H28O5, Purity:98, SMILES: O[C@@]([C@@H](C(CO)=C[C@@]1([H])[C@H](C2(C)C)[C@H]2C3)O)([C@H]4O)[C@]([C@@H]3C)(C=C4C)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phorbol, CAS:17673-25-5, Molecular Weight: 364.4327, C20H28O6, Purity:98, SMILES: O=C1C(C)=C[C@@]2([H])[C@]3(O)[C@@]([C@@](C4(C)C)([H])[C@@]4(O)[C@H](O)[C@H]3C)([H])C=C(CO)C[C@]12O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oxyphencyclimine (hydrochloride), CAS:125-52-0, Molecular Weight: 380.9089, C20H29ClN2O3, Purity:98, SMILES: O=C(OCC1=NCCCN1C)C(O)(C2CCCCC2)C3=CC=CC=C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Quinine (hydrochloride dihydrate), CAS:6119-47-7, Molecular Weight: 396.9083, C20H29ClN2O4, Purity:98, SMILES: COC1=CC2=C(N=CC=C2[C@H]([C@@]3([H])[N@](C[C@@H]4C=C)CC[C@@]4([H])C3)O)C=C1.Cl.O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tamsulosin (hydrochloride), CAS:106463-17-6, Molecular Weight: 444.9727, C20H29ClN2O5S, Purity:98, SMILES: O=S(C1=CC(C[C@H](NCCOC2=CC=CC=C2OCC)C)=CC=C1OC)(N)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AC260584, CAS:560083-42-3, Molecular Weight: 348.4549, C20H29FN2O2, Purity:98, SMILES: O=C1COC2=CC(F)=CC=C2N1CCCN3CCC(CCCC)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fluoxymesterone, CAS:76-43-7, Molecular Weight: 336.4409, C20H29FO3, Purity:98, SMILES: C[C@@]12[C@@](C)(O)CC[C@@]1([H])[C@]3([H])CCC4=CC(CC[C@]4(C)[C@@]3(F)[C@@H](O)C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 1-Benzyl-3-Iodo-1,8-Diazaspiro[4.5]Decane-8-Carboxylate, CAS:0, Molecular Weight: 456.3609, C20H29IN2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(I)CN2CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sivelestat (sodium tetrahydrate), CAS:201677-61-4, Molecular Weight: 528.5059, C20H29N2NaO11S, Purity:98, SMILES: [O-]C(CNC(C1=CC=CC=C1NS(C2=CC=C(OC(C(C)(C)C)=O)C=C2)(=O)=O)=O)=O.[Na+].O.O.O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dibucaine, CAS:85-79-0, Molecular Weight: 343.4632, C20H29N3O2, Purity:98, SMILES: O=C(C1=CC(OCCCC)=NC2=CC=CC=C12)NCCN(CC)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-Benzyl 2-Tert-Butyl 2,6,9-Triazaspiro[4.5]Decane-2,6-Dicarboxylate, CAS:1160247-10-8, Molecular Weight: 375.462, C20H29N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)CNCCN2C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9-Benzyl 2-Tert-Butyl 2,6,9-Triazaspiro[4.5]Decane-2,9-Dicarboxylate, CAS:1160247-08-4, Molecular Weight: 375.462, C20H29N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(C1)CN(CCN2)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 1-Boc-3-benzylpiperidine-3-carboxylate, CAS:170842-80-5, Molecular Weight: 347.4486, C20H29NO4, Purity:99, SMILES: CCOC(=O)C1(CCCN(C1)C(=O)OC(C)(C)C)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sch-42495 (racemate), CAS:145841-10-7, Molecular Weight: 411.57856, C20H29NO4S2, Purity:98, SMILES: CSCC[C@@H](C(OCC)=O)NC(C(CSC(C)=O)CC1=CC=CC=C1C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-tert-butyl 2-((1R,2R)-3-(benzyloxy)-1-hydroxy-2-methyl-3-oxopropyl)pyrrolidine-1-carboxylate, CAS:163768-51-2, Molecular Weight: 363.448, C20H29NO5, Purity:99, SMILES: O=C([C@@H]([C@H]([C@@H]1CCCN1C(=O)OC(C)(C)C)O)C)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 6-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-Yl-3,4-Dihydroisoquinoline-2(1H-Carboxylate, CAS:893566-72-8, Molecular Weight: 359.268, C20H30BNO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2=CC(=CC=C2C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 7-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-3,4-dihydroisoquinoline-2(1H)-carboxylate, CAS:937048-76-5, Molecular Weight: 359.268, C20H30BNO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCc2ccc(cc2C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-((tert-butoxycarbonyl)amino)-3-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)propanoic acid, CAS:216439-76-8, Molecular Weight: 391.266, C20H30BNO6, Purity:95, SMILES: CC(C)(C)OC(=O)N[C@@H](Cc1ccc(cc1)B1OC(C)(C)C(C)(C)O1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ipratropium (bromide), CAS:22254-24-6, Molecular Weight: 412.3611, C20H30BrNO3, Purity:98, SMILES: C[N+]1([C@H]2CC[C@H]1CC(OC(C(CO)C3=CC=CC=C3)=O)C2)C(C)C.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dibucaine (hydrochloride), CAS:61-12-1, Molecular Weight: 379.9241, C20H30ClN3O2, Purity:98, SMILES: O=C(C1=CC(OCCCC)=NC2=CC=CC=C12)NCCN(CC)CC.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6H05, CAS:1469338-01-9, Molecular Weight: 476.1191, C20H30ClN3O2S3, Purity:98, SMILES: O=C(C1CCN(C(CSC2=CC=C(Cl)C=C2)=O)CC1)NCCSSCCN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dobupride, CAS:106707-51-1, Molecular Weight: 411.9229, C20H30ClN3O4, Purity:98, SMILES: O=C(NC1CCN(CC2OCCO2)CC1)C3=CC(Cl)=C(N)C=C3OCCCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Urapidil (hydrochloride), CAS:64887-14-5, Molecular Weight: 423.9369, C20H30ClN5O3, Purity:98, SMILES: O=C1N(C)C(C=C(NCCCN2CCN(C3=CC=CC=C3OC)CC2)N1C)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML RR-S2 CDA (ammonium salt), CAS:1638750-96-5, Molecular Weight: 724.604124, C20H30N12O10P2S2, Purity:98, SMILES: OC1([H])[C@](O[P@]([S-])(OC[C@](O[C@@H](N2C3=NC=NC(N)=C3N=C2)[C@@H]4O)([H])[C@@]4([H])O5)=O)([H])[C@H](N6C7=NC=NC(N)=C7N=C6)O[C@]1([H])CO[P@]5([S-])=O.[NH4+].[NH4+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-Tert-Butyl 6-Benzyloctahydropyrrolo[3,4-D]Azepine-2(1H-Carboxylate, CAS:236406-44-3, Molecular Weight: 330.4644, C20H30N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2CCN(CC3=CC=CC=C3)CC[C@H]2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(5S,9R-Tert-Butyl 7-Benzyl-9-(Hydroxymethyl-2,7-Diazaspiro[4.4]Nonane-2-Carboxylate, CAS:0, Molecular Weight: 346.4638, C20H30N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC[C@]2(CN(CC3=CC=CC=C3)C[C@@H]2CO)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racemic-(5S,9S-Tert-Butyl 7-Benzyl-9-(Hydroxymethyl-2,7-Diazaspiro[4.4]Nonane-2-Carboxylate, CAS:0, Molecular Weight: 346.4638, C20H30N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC[C@]2(CN(CC3=CC=CC=C3)C[C@H]2CO)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-Benzyl-1-Oxa-4,8-Diazaspiro[5.5]Undecane-8-Carboxylate, CAS:1445950-77-5, Molecular Weight: 346.4638, C20H30N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCCC2(CN(CC3=CC=CC=C3)CCO2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pergolide (mesylate), CAS:66104-23-2, Molecular Weight: 410.5938, C20H30N2O3S2, Purity:98, SMILES: [H][C@@]1(N(CCC)C[C@H](CSC)C[C@@]12[H])CC3=CNC4=CC=CC2=C43.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2-(1-(((BenzyloxyCarbonylAminoEthylPiperidine-1-Carboxylate, CAS:0, Molecular Weight: 362.4632, C20H30N2O4, Purity:95, SMILES: CC(NC(=O)OCC1=CC=CC=C1)C1CCCCN1C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Z-Ile-Leu-aldehyde, CAS:161710-10-7, Molecular Weight: 362.4632, C20H30N2O4, Purity:98, SMILES: O=C(OCC1=CC=CC=C1)N[C@H](C(N[C@H](C=O)CC(C)C)=O)[C@@H](C)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-methylpiperidin-4-amine bis(4-methylbenzenesulfonate), CAS:1195748-61-8, Molecular Weight: 458.592, C20H30N2O6S2, Purity:95, SMILES: CC1(N)CCNCC1.Cc1ccc(cc1)S(O)(=O)=O.Cc1ccc(cc1)S(O)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3S,4S)-4-methoxy-N-methylpyrrolidin-3-amine; bis(4-methylbenzene-1-sulfonic acid), CAS:372482-03-6, Molecular Weight: 474.591, C20H30N2O7S2, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)O.Cc1ccc(cc1)S(=O)(=O)O.CN[C@H]1CNC[C@@H]1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ac-DEVD-CHO, CAS:169332-60-9, Molecular Weight: 502.4724, C20H30N4O11, Purity:98, SMILES: O=C(N[C@@H](C(C)C)C(N[C@H](C=O)CC(O)=O)=O)[C@H](CCC(O)=O)NC([C@@H](NC(C)=O)CC(O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pracinostat, CAS:929016-96-6, Molecular Weight: 358.4778, C20H30N4O2, Purity:98, SMILES: ONC(/C=C/C1=CC=C2N(C(CCCC)=NC2=C1)CCN(CC)CC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(3-isopropyl-5-methyl-4H-1,2,4-triazol-4-yl)-8-aza-bicyclo[3.2.1]octane 4-methylbenzenesulfonate, CAS:423165-08-6, Molecular Weight: 406.542, C20H30N4O3S, Purity:95, SMILES: Cc1nnc(n1[C@@H]1C[C@H]2CC[C@@H](C1)N2)C(C)C.Cc1ccc(cc1)S(=O)(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Eicosapentaenoic Acid, CAS:10417-94-4, Molecular Weight: 302.451, C20H30O2, Purity:98, SMILES: CC/C=C\C/C=C\C/C=C\C/C=C\C/C=C\CCCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Peretinoin, CAS:81485-25-8, Molecular Weight: 302.451, C20H30O2, Purity:98, SMILES: C/C(C)=C/CC/C(C)=C/CC/C(C)=C/C=C/C(C)=C/C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Androst-4-en-3-one, 4,17-dihydroxy-17-methyl-, (17α)-, CAS:145841-84-5, Molecular Weight: 318.4504, C20H30O3, Purity:98, SMILES: C[C@@]12[C@](C)(O)CC[C@@]1([H])[C@]3([H])CCC4=C(O)C(CC[C@]4(C)[C@@]3([H])CC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isosteviol, CAS:27975-19-5, Molecular Weight: 318.4504, C20H30O3, Purity:98, SMILES: C[C@]([C@]1([H])CC2)(CCC[C@@]1(C)C(O)=O)[C@@]3([H])[C@@]2(CC4=O)C[C@]4(C)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Deoxyandrographolide, CAS:79233-15-1, Molecular Weight: 334.4498, C20H30O4, Purity:98, SMILES: C[C@@](C(CCC1=CCOC1=O)=C(C)CC2)(CC[C@H]3O)[C@@]2([H])[C@]3(C)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lathyrol, CAS:34420-19-4, Molecular Weight: 334.4498, C20H30O4, Purity:98, SMILES: O[C@@]1(C(/C(C)=C\[C@@H](C2(C)C)[C@@H]2CCC3=C)=O)[C@]([C@H]3O)([H])[C@@H](O)[C@@H](C)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7beta-Hydroxylathyrol, CAS:34208-98-5, Molecular Weight: 350.4492, C20H30O5, Purity:98, SMILES: C[C@H]1C[C@@](C(/C(C)=C\[C@@H](C2(C)C)[C@@H]2C[C@@H](O)C([C@@H]3O)=C)=O)(O)[C@]3([H])[C@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Andrographolide, CAS:5508-58-7, Molecular Weight: 350.4492, C20H30O5, Purity:98, SMILES: O=C1OC[C@@H](O)/C1=C\C[C@@H]2C(CC[C@]3([H])[C@](C)(CO)[C@H](O)CC[C@@]23C)=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Folinic acid (calcium salt pentahydrate), CAS:6035-45-6, Molecular Weight: 601.58, C20H31CaN7O12, Purity:98, SMILES: O=CN1C(C2=O)=C(NC(N)=N2)NCC1CNC3=CC=C(C(N[C@H](C([O-])=O)CCC([O-])=O)=O)C=C3.O.O.O.O.[Ca+2].O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PHT-427, CAS:1191951-57-1, Molecular Weight: 409.609, C20H31N3O2S2, Purity:98, SMILES: CCCCCCCCCCCCC1=CC=C(C=C1)S(NC2=NN=CS2)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Deramciclane, CAS:120444-71-5, Molecular Weight: 301.46624, C20H31NO, Purity:98, SMILES: CC1(C)[C@]2(C)[C@@](OCCN(C)C)(C3=CC=CC=C3)C[C@@]1([H])CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| S-2474, CAS:158089-95-3, Molecular Weight: 365.53, C20H31NO3S, Purity:98, SMILES: OC1=C(C(C)(C)C)C=C(/C=C2CCN(CC)S\2(=O)=O)C=C1C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vernakalant, CAS:794466-70-9, Molecular Weight: 349.4644, C20H31NO4, Purity:98, SMILES: COC1=C(C=C(C=C1)CCO[C@H]2[C@@H](CCCC2)N3CC[C@H](C3)O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2-(2-chloro-3-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenoxy)ethyl)-4-methylpiperazine, CAS:1799612-11-5, Molecular Weight: 394.744, C20H32BClN2O3, Purity:95, SMILES: CN1CCN(CCOc2ccc(B3OC(C)(C)C(C)(C)O3)c(C)c2Cl)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(4-Tert-Butoxycarbonylpiperazin-1-YlPyridine-4-Boronic Acid, Pinacol Ester, CAS:936250-21-4, Molecular Weight: 389.297, C20H32BN3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC1)C1=NC=CC(=C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridin-2-yl)piperazine-1-carboxylate, CAS:496786-98-2, Molecular Weight: 389.297, C20H32BN3O4, Purity:99, SMILES: CC(C)(C)OC(=O)N1CCN(CC1)c1ccc(cn1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl (2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-ylphenylpropan-2-ylcarbamate, CAS:335592-60-4, Molecular Weight: 361.283, C20H32BNO4, Purity:95, SMILES: CC(C)(C)OC(=O)NC(C)(C)C1=CC=C(C=C1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SRI-011381 (hydrochloride), CAS:, Molecular Weight: 365.9406, C20H32ClN3O, Purity:98, SMILES: O=C(NC1CCCCC1)N(CC2=CC=CC=C2)CC3CCNCC3.Cl[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trihexyphenidyl (hydrochloride), CAS:52-49-3, Molecular Weight: 337.9272, C20H32ClNO, Purity:98, SMILES: OC(C1=CC=CC=C1)(C2CCCCC2)CCN3CCCCC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Drofenine (hydrochloride), CAS:548-66-3, Molecular Weight: 353.9266, C20H32ClNO2, Purity:98, SMILES: O=C(OCCN(CC)CC)C(C1CCCCC1)C2=CC=CC=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vernakalant (Hydrochloride), CAS:748810-28-8, Molecular Weight: 385.9254, C20H32ClNO4, Purity:98, SMILES: COC1=C(OC)C=C(CCO[C@H]2[C@H](N3CC[C@@H](O)C3)CCCC2)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lubiprostone, CAS:136790-76-6, Molecular Weight: 390.4619, C20H32F2O5, Purity:98, SMILES: O=C(C(F)(F)CCCC)CC[C@@H]([C@@H](C1)O)[C@H](C1=O)CCCCCCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-Butyl 4-(4-amino-5-isopropoxy-2-methylphenyl)piperidine-1-carboxylate, CAS:1032903-63-1, Molecular Weight: 348.4797, C20H32N2O3, Purity:99, SMILES: CC(C)Oc1cc(C2CCN(CC2)C(=O)OC(C)(C)C)c(C)cc1N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Carbosulfan, CAS:55285-14-8, Molecular Weight: 380.5447, C20H32N2O3S, Purity:98, SMILES: O=C(OC1=C(OC(C)(C)C2)C2=CC=C1)N(SN(CCCC)CCCC)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Adefovir dipivoxil, CAS:142340-99-6, Molecular Weight: 501.4706, C20H32N5O8P, Purity:98, SMILES: NC1=C2N=CN(CCOCP(OCOC(C(C)(C)C)=O)(OCOC(C(C)(C)C)=O)=O)C2=NC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methandriol, CAS:521-10-8, Molecular Weight: 304.46688, C20H32O2, Purity:98, SMILES: C[C@@]12[C@](O)(C)CC[C@@]1([H])[C@]3([H])CC=C4C[C@@H](O)CC[C@]4(C)[C@@]3([H])CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 20-HETE, CAS:79551-86-3, Molecular Weight: 320.4663, C20H32O3, Purity:98, SMILES: O=C(O)CCC/C=C\C/C=C\C/C=C\C/C=C\CCCCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ginkgolic Acid (C13:0), CAS:20261-38-5, Molecular Weight: 320.4663, C20H32O3, Purity:98, SMILES: O=C(O)C1=C(CCCCCCCCCCCCC)C=CC=C1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prostaglandin E2, CAS:363-24-6, Molecular Weight: 352.46508, C20H32O5, Purity:98, SMILES: CCCCC[C@H](O)/C=C/[C@@H]1[C@H](C(C[C@H]1O)=O)C/C=C\CCCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pentaerythritol tris(3-(1-aziridinyl)propionate), CAS:571170-81-5, Molecular Weight: 427.4919, C20H33N3O7, Purity:99, SMILES: OCC(COC(=O)CCN1CC1)(COC(=O)CCN1CC1)COC(=O)CCN1CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Acetyl-Ser-Asp-Lys-Pro, CAS:127103-11-1, Molecular Weight: 487.50412, C20H33N5O9, Purity:98, SMILES: O=C([C@@H](CC(O)=O)NC([C@H](CO)NC(C)=O)=O)N[C@@H](CCCCN)C(N1[C@@H](CCC1)C(O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Desvenlafaxine (succinate hydrate), CAS:386750-22-7, Molecular Weight: 399.4785, C20H33NO7, Purity:98, SMILES: OC1=CC=C(C(C2(O)CCCCC2)CN(C)C)C=C1.O=C(O)CCC(O)=O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Quinagolide (hydrochloride), CAS:94424-50-7, Molecular Weight: 432.0203, C20H34ClN3O3S, Purity:98, SMILES: OC1=C2C(C[C@](N(CCC)C[C@@H](NS(N(CC)CC)(=O)=O)C3)([H])[C@@]3([H])C2)=CC=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-1-(3-Ethoxy-4-methoxyphenyl)-2-(methylsulfonyl)ethylamine n-acetyl-l-leucine salt, CAS:608141-43-1, Molecular Weight: 446.558, C20H34N2O7S, Purity:95, SMILES: CC(C)C[C@H](NC(C)=O)C(O)=O.CCOC1=C(OC)C=CC(=C1)[C@H](N)CS(C)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dinoprost, CAS:551-11-1, Molecular Weight: 354.481, C20H34O5, Purity:98, SMILES: CCCCC[C@H](O)/C=C/[C@H]1[C@H](O)C[C@H](O)[C@@H]1C/C=C\CCCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prostaglandin E1, CAS:745-65-3, Molecular Weight: 354.481, C20H34O5, Purity:98, SMILES: CCCCC[C@H](O)/C=C/[C@@H]1[C@H](C(C[C@H]1O)=O)CCCCCCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,5-di-tert-butyl 3-ethyl 3-acetylpentane-1,3,5-tricarboxylate, CAS:0, Molecular Weight: 386.4798, C20H34O7, Purity:95, SMILES: CCOC(=O)C(CCC(=O)OC(C)(C)C)(CCC(=O)OC(C)(C)C)C(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cevimeline (hydrochloride hemihydrate), CAS:153504-70-2, Molecular Weight: 435.0871, C20H35ClN2O2S2, Purity:98, SMILES: C[C@H](SC1)O[C@]21CN3CCC2CC3.C[C@@H](SC4)O[C@@]54CN6CCC5CC6.[H]Cl.[0.5 H2O], HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(1-(tert-Butoxycarbonyl)piperidin-4-ylamino)-3,3-difluoropiperidine-1-carboxylate, CAS:, Molecular Weight: 419.5064, C20H35F2N3O4, Purity:95, SMILES: O=C(N1CCC(CC1)NC1CCN(CC1(F)F)C(=O)OC(C)(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,2S,5S)-methyl 3-((S)-2-(3-(tert-butyl)ureido)-3,3-dimethylbutanoyl)-6,6-dimethyl-3-azabicyclo[3.1.0]hexane-2-carboxylate, CAS:, Molecular Weight: 381.5096, C20H35N3O4, Purity:95, SMILES: CC1([C@H]2[C@@H]1CN([C@@H]2C(OC)=O)C([C@H](C(C)(C)C)NC(NC(C)(C)C)=O)=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Reparixin (L-lysine salt), CAS:266359-93-7, Molecular Weight: 429.574, C20H35N3O5S, Purity:98, SMILES: N[C@@H](CCCCN)C(O)=O.CS(=O)(NC([C@@H](C1=CC=C(CC(C)C)C=C1)C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GPRP (acetate), CAS:157009-81-9, Molecular Weight: 485.5346, C20H35N7O7, Purity:98, SMILES: O=C(O)[C@H]1N(C([C@H](CCCNC(N)=N)NC([C@H]2N(C(CN)=O)CCC2)=O)=O)CCC1.OC(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dopropidil, CAS:79700-61-1, Molecular Weight: 321.4974, C20H35NO2, Purity:98, SMILES: CC#CC1(OCC(N2CCCC2)COCC(C)C)CCCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Suloctidil, CAS:54767-75-8, Molecular Weight: 337.563, C20H35NOS, Purity:98, SMILES: O[C@H]([C@H](NCCCCCCCC)C)C1=CC=C(SC(C)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Auranofin, CAS:34031-32-8, Molecular Weight: 680.4998, C20H36AuO9PS, Purity:98, SMILES: CC(O[C@@H]1[C@@H](OC(C)=O)[C@H]([SH-][Au+]P(CC)(CC)CC)O[C@H](COC(C)=O)[C@H]1OC(C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-Hexadecylthiophene, CAS:119269-24-8, Molecular Weight: 308.565, C20H36S, Purity:95, SMILES: CCCCCCCCCCCCCCCCC1=CSC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hygromycin B, CAS:31282-04-9, Molecular Weight: 527.5201, C20H37N3O13, Purity:98, SMILES: O[C@H]([C@H]1O)C2(O[C@@]([C@@H](N)CO)([H])[C@@H]1O)O[C@@]([C@@H](O[C@@H]3CO)O[C@@]([C@H]([C@H](N)C4)O)([H])[C@@H]([C@H]4NC)O)([H])[C@@]([C@H]3O)([H])O2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| di-tert-butyl 4,4'-Azanediyldipiperidine-1-carboxylate, CAS:, Molecular Weight: 383.5255, C20H37N3O4, Purity:95, SMILES: O=C(N1CCC(CC1)NC1CCN(CC1)C(=O)OC(C)(C)C)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MG-101, CAS:110044-82-1, Molecular Weight: 383.5255, C20H37N3O4, Purity:98, SMILES: O=C(N[C@H](C=O)CCCC)[C@@H](NC([C@@H](NC(C)=O)CC(C)C)=O)CC(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Docusate (Sodium), CAS:577-11-7, Molecular Weight: 444.5583, C20H37NaO7S, Purity:98, SMILES: O=C(OCC(CC)CCCC)C(S(=O)([O-])=O)CC(OCC(CC)CCCC)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Leupeptin (hemisulfate), CAS:103476-89-7, Molecular Weight: 475.59, C20H38N6O4 . 1/2H2SO4, Purity:98, SMILES: O=C[C@@H](NC([C@@H](NC([C@@H](NC(C)=O)CC(C)C)=O)CC(C)C)=O)CCCNC(N)=N.[0.5H2SO4], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Icosanal, CAS:2400-66-0, Molecular Weight: 296.531, C20H40O, Purity:95, SMILES: CCCCCCCCCCCCCCCCCCCC=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Arachidic acid, CAS:506-30-9, Molecular Weight: 312.5304, C20H40O2, Purity:95, SMILES: CCCCCCCCCCCCCCCCCCCC(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl nonadecanoate, CAS:1731-94-8, Molecular Weight: 312.5304, C20H40O2, Purity:95, SMILES: CCCCCCCCCCCCCCCCCCC(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Polyoxyethylene stearate, CAS:9004-99-3, Molecular Weight: 328.5298, C20H40O3, Purity:98, SMILES: O=C(OCCO)CCCCCCCCCCCCCCCCC.[n].[n].[=].[10], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 9-(Bromomethyl)nonadecane, CAS:69620-20-8, Molecular Weight: 361.444, C20H41Br, Purity:95, SMILES: CCCCCCCCCCC(CCCCCCCC)CBr, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Eicosanol, CAS:629-96-9, Molecular Weight: 298.5469, C20H42O, Purity:95, SMILES: CCCCCCCCCCCCCCCCCCCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((3R,5R)-3,5-bis(tert-butyldimethylsilyloxy)cyclohexylidene)ethanol, CAS:139356-37-9, Molecular Weight: 386.7167, C20H42O3Si2, Purity:95, SMILES: OC/C=C/1\C[C@H](C[C@@H](C1)O[Si](C(C)(C)C)(C)C)O[Si](C(C)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-octyldodecan-1-amine, CAS:62281-06-5, Molecular Weight: 297.5621, C20H43N, Purity:95, SMILES: CCCCCCCCCCC(CCCCCCCC)CN, HPLC, NMR, LCMS is ok, stock more than 10g. |
| G-418 (disulfate), CAS:108321-42-2, Molecular Weight: 692.70936, C20H44N4O18S2, Purity:98, SMILES: O=S(O)(O)=O.O[C@@H]([C@@H]1O[C@@]([C@@H]([C@@H](O)[C@@H]2O)N)([H])O[C@]2([H])[C@H](O)C)[C@H]([C@@H](C[C@@H]1N)N)O[C@](OC[C@](C)(O)[C@@H]3NC)([H])[C@@H]3O.O=S(O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir 13CD3, CAS:, Molecular Weight: 533.4636653718, C21 13CH26D3FN3O9P, Purity:98, SMILES: O=C1N([C@H]2[C@]([C@H](O)[C@@H](CO[P@](OC3=CC=CC=C3)(N[C@@H](C)C(OC(C)C)=O)=O)O2)([13C]([2H])([2H])[2H])F)C=CC(N1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thymosin beta 4, CAS:77591-33-4, Molecular Weight: 4963.44, C212H350N56O78S, Purity:98, SMILES: C[Thymosin beta 4], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lixisenatide, CAS:320367-13-3, Molecular Weight: 4858.49, C215H347N61O65S, Purity:98, SMILES: [Lixisenatide], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Human growth hormone-releasing factor, CAS:83930-13-6, Molecular Weight: 5039.65, C215H358N72O66S, Purity:98, SMILES: [Human growth hormone-releasing factor], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5(6)-FITC, CAS:27072-45-3, Molecular Weight: 389.38, C21H11NO5S, Purity:98, SMILES: OC1=CC=C(C2(O3)C(C=C(N=C=S)C=C4)=C4C3=O)C(OC5=C2C=CC(O)=C5)=C1.OC6=CC=C(C7(O8)C(C=CC(N=C=S)=C9)=C9C8=O)C(OC%10=C7C=CC(O)=C%10)=C6, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-FITC, CAS:3326-31-6, Molecular Weight: 389.3807, C21H11NO5S, Purity:98, SMILES: O=C1OC2(C3=C(OC4=C2C=CC(O)=C4)C=C(O)C=C3)C5=C1C(N=C=S)=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FITC, CAS:3326-32-7, Molecular Weight: 389.3807, C21H11NO5S, Purity:98, SMILES: O=C1OC2(C3=C(OC4=C2C=CC(O)=C4)C=C(O)C=C3)C5=C1C=C(N=C=S)C=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LXR-623, CAS:875787-07-8, Molecular Weight: 422.778396, C21H12ClF5N2, Purity:98, SMILES: ClC1=C(CN2N=C(C(C(F)(F)F)=CC=C3)C3=C2C4=CC=C(F)C=C4)C=CC(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,3-Bis(4-FluorophenylQuinoxaline-6-Carboxylic Acid, CAS:355397-64-7, Molecular Weight: 362.329, C21H12F2N2O2, Purity:95, SMILES: OC(=O)C1=CC=C2N=C(C3=CC=C(F)C=C3)C(=NC2=C1)C1=CC=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Deferasirox (Fe3+ chelate), CAS:554435-83-5, Molecular Weight: 426.1827, C21H12FeN3O4, Purity:98, SMILES: O=C([O-])C1=CC=C(N2N=C3[N]4=C2C5=CC=CC=C5[O-][Fe+3]4[O-]C6=CC=CC=C63)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Carboxyfluorescein, CAS:76823-03-5, Molecular Weight: 376.3158, C21H12O7, Purity:95, SMILES: OC(=O)C1=CC=C2C(=C1)C(=O)OC21C2=CC=C(O)C=C2OC2=CC(O)=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-FAM, CAS:76823-03-5, Molecular Weight: 376.3158, C21H12O7, Purity:98, SMILES: O=C1OC2(C3=C(OC4=C2C=CC(O)=C4)C=C(O)C=C3)C5=C1C=C(C(O)=O)C=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-FAM, CAS:3301-79-9, Molecular Weight: 376.3158, C21H12O7, Purity:98, SMILES: O=C1OC2(C3=C(OC4=C2C=CC(O)=C4)C=C(O)C=C3)C5=C1C=CC(C(O)=O)=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RQ-00203078, CAS:1254205-52-1, Molecular Weight: 554.8467, C21H13ClF6N2O5S, Purity:98, SMILES: O=C(O)C1=CC=C(S(=O)(N(C2=NC=C(C(F)(F)F)C=C2Cl)CC3=CC=C(OC(F)(F)F)C=C3)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ziprasidone D8, CAS:1126745-58-1, Molecular Weight: 420.9849, C21H13D8ClN4OS, Purity:98, SMILES: O=C1CC2=CC(CCN(C([2H])([2H])C3([2H])[2H])C([2H])([2H])C([2H])([2H])N3C4=NSC5=C4C=CC=C5)=C(Cl)C=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HT-2157, CAS:303149-14-6, Molecular Weight: 366.3359, C21H13F3N2O, Purity:98, SMILES: O=C1N(C2=CC=CC=C2)C3=C(C=CC=C3)/C1=N/C4=CC=CC(C(F)(F)F)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4'-(4-Bromophenyl)-2,6':2',2''-terpyridine, CAS:89972-76-9, Molecular Weight: 388.26, C21H14BrN3, Purity:95, SMILES: Brc1ccc(cc1)c1ccnc(c1c1ccccn1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-[3-Chloro-4-[(3-fluorobenzyl)oxy]phenyl]-6-iodoquinazolin-4-amine, CAS:231278-20-9, Molecular Weight: 505.711, C21H14ClFIN3O, Purity:95, SMILES: FC1=CC=CC(COC2=C(Cl)C=C(NC3=NC=NC4=CC=C(I)C=C34)C=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4'-(4-chlorophenyl)-2,2':6',2''-terpyridine, CAS:89972-75-8, Molecular Weight: 343.809, C21H14ClN3, Purity:95, SMILES: Clc1ccc(cc1)-c1cc(nc(c1)-c1ccccn1)-c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| L-701324, CAS:142326-59-8, Molecular Weight: 363.7938, C21H14ClNO3, Purity:98, SMILES: O=C1NC2=C(C=CC(Cl)=C2)C(O)=C1C3=CC=CC(OC4=CC=CC=C4)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AMI-1, CAS:20324-87-2, Molecular Weight: 548.4534, C21H14N2Na2O9S2, Purity:98, SMILES: O=C(NC1=CC2=CC(S(=O)([O-])=O)=CC(O)=C2C=C1)NC3=CC4=CC(S(=O)([O-])=O)=CC(O)=C4C=C3.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Regorafenib, CAS:755037-03-7, Molecular Weight: 482.8154, C21H15ClF4N4O3, Purity:98, SMILES: O=C(NC1=CC=C(C(C(F)(F)F)=C1)Cl)NC2=CC=C(OC3=CC(C(NC)=O)=NC=C3)C=C2F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| p38 MAPK-IN-1, CAS:1006378-90-0, Molecular Weight: 349.3534, C21H15F2N2O, Purity:98, SMILES: FC1=CC(F)=C(C2=CC=NC(C2=CC=[NH+]3[O-])=C3C4=C(C)C=CC=C4)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GNE-617, CAS:1362154-70-8, Molecular Weight: 427.4239, C21H15F2N3O3S, Purity:98, SMILES: O=C(NCC1=CC=C(S(C2=CC(F)=CC(F)=C2)(=O)=O)C=C1)C3=CN4C(C=C3)=NC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ARN-509, CAS:956104-40-8, Molecular Weight: 477.4347, C21H15F4N5O2S, Purity:98, SMILES: O=C(NC)C1=CC=C(N(C(N(C2=CC(C(F)(F)F)=C(C#N)N=C2)C3=O)=S)C43CCC4)C=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Deferasirox, CAS:201530-41-8, Molecular Weight: 373.3615, C21H15N3O4, Purity:98, SMILES: O=C(O)C1=CC=C(N2N=C(C3=CC=CC=C3O)N=C2C4=CC=CC=C4O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PNRI-299, CAS:550368-41-7, Molecular Weight: 401.3749, C21H15N5O4, Purity:98, SMILES: O=C1N2N(C(C(NCC3=CC=CC=C3)=O)=CC(C2)=O)C(N1C4=CC(C#N)=CC=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzoic acid, 4,4',4''-nitrilotris-, CAS:118996-38-6, Molecular Weight: 377.3469, C21H15NO6, Purity:95, SMILES: OC(=O)c1ccc(cc1)N(c1ccc(cc1)C(=O)O)c1ccc(cc1)C(=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Regorafenib (Hydrochloride), CAS:835621-07-3, Molecular Weight: 519.2764, C21H16Cl2F4N4O3, Purity:98, SMILES: ClC1=C(C(F)(F)F)C=C(NC(NC2=C(F)C=C(OC3=CC=NC(C(NC)=O)=C3)C=C2)=O)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PD173955, CAS:260415-63-2, Molecular Weight: 443.3489, C21H16Cl2N4OS, Purity:98, SMILES: O=C1C(C2=C(Cl)C=CC=C2Cl)=CC3=CN=C(NC4=CC=CC(SC)=C4)N=C3N1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GNE-617 (hydrochloride), CAS:, Molecular Weight: 463.8849, C21H16ClF2N3O3S, Purity:98, SMILES: O=C(NCC1=CC=C(S(C2=CC(F)=CC(F)=C2)(=O)=O)C=C1)C3=CN4C(C=C3)=NC=C4.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FLT3-IN-2, CAS:923562-23-6, Molecular Weight: 416.8268, C21H16ClF3N4, Purity:98, SMILES: FC(C1=CC=C(CNC2=NC=C(CC3=CNC4=NC=C(Cl)C=C43)C=C2)C=C1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sorafenib, CAS:284461-73-0, Molecular Weight: 464.825, C21H16ClF3N4O3, Purity:98, SMILES: O=C(NC(C=C1)=CC=C1OC2=CC(C(NC)=O)=NC=C2)NC3=CC=C(Cl)C(C(F)(F)F)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| STING agonist-1, CAS:702662-50-8, Molecular Weight: 430.8797432, C21H16ClFN2O3S, Purity:98, SMILES: O=C(C1=CC=C(SCC(N2CC3=C(F)C=CC=C3Cl)=O)C2=C1)NCC4=CC=CO4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| S1P1 Agonist III, CAS:1324003-64-6, Molecular Weight: 415.3652, C21H16F3N3O3, Purity:98, SMILES: COC1=CC=NC=C1C(NC(NC2=CC(C(F)(F)F)=C(C3=CC=CC=C3)C=C2)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SKLB610, CAS:1125780-41-7, Molecular Weight: 415.3652, C21H16F3N3O3, Purity:98, SMILES: O=C(C1=NC=CC(OC2=CC=C(NC(C3=CC=CC(C(F)(F)F)=C3)=O)C=C2)=C1)NC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK429286A, CAS:864082-47-3, Molecular Weight: 432.3709, C21H16F4N4O2, Purity:98, SMILES: O=C(C(C(C1=CC=C(C(F)(F)F)C=C1)C2)=C(C)NC2=O)NC3=CC4=C(NN=C4)C=C3F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Enzalutamide, CAS:915087-33-1, Molecular Weight: 464.4359, C21H16F4N4O2S, Purity:98, SMILES: S=C(N(C(C1(C)C)=O)C2=CC=C(C#N)C(C(F)(F)F)=C2)N1C3=CC(F)=C(C(NC)=O)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB 203580, CAS:152121-47-6, Molecular Weight: 377.4346, C21H16FN3OS, Purity:98, SMILES: O=S(C1=CC=C(C2=NC(C3=CC=C(F)C=C3)=C(C4=CC=NC=C4)N2)C=C1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AMG319, CAS:1608125-21-8, Molecular Weight: 385.3970432, C21H16FN7, Purity:98, SMILES: C[C@H](NC1=C2N=CNC2=NC=N1)C3=CC4=CC=C(F)C=C4N=C3C5=NC=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acalisib, CAS:870281-34-8, Molecular Weight: 401.3965, C21H16FN7O, Purity:98, SMILES: O=C1N(C2=CC=CC=C2)C([C@@H](NC3=C4N=CNC4=NC=N3)C)=NC5=C1C=C(F)C=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-iodo-1-trityl-1H-1,2,4-triazole, CAS:151899-62-6, Molecular Weight: 437.2763, C21H16IN3, Purity:95, SMILES: Ic1ncn(n1)C(c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cambinol, CAS:14513-15-6, Molecular Weight: 360.429, C21H16N2O2S, Purity:98, SMILES: O=C(C(CC1=C2C=CC=CC2=CC=C1O)=C(C3=CC=CC=C3)N4)NC4=S, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PI3K inhibitor X, CAS:956958-53-5, Molecular Weight: 448.5208, C21H16N6O2S2, Purity:98, SMILES: O=S(C1=CC=C(C)C=C1)(NC2=NC3=CC=CC=C3N=C2NC4=CC5=NSN=C5C=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Coumetarol, CAS:4366-18-1, Molecular Weight: 380.34754, C21H16O7, Purity:98, SMILES: COCC(C1=C(O)C2=CC=CC=C2OC1=O)C3=C(O)C4=CC=CC=C4OC3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Salubrinal, CAS:405060-95-9, Molecular Weight: 479.8099, C21H17Cl3N4OS, Purity:98, SMILES: O=C(NC(NC(NC1=CC=CC2=C1N=CC=C2)=S)C(Cl)(Cl)Cl)/C=C/C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pocapavir, CAS:146949-21-5, Molecular Weight: 423.71688, C21H17Cl3O3, Purity:98, SMILES: ClC1=C(OCC2=CC=C(COC3=CC=C(OC)C=C3Cl)C=C2)C(Cl)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Eleclazine (hydrochloride), CAS:1448754-43-5, Molecular Weight: 451.8262, C21H17ClF3N3O3, Purity:98, SMILES: O=C1N(CC2=NC=CC=N2)CCOC3=CC=C(C4=CC=C(OC(F)(F)F)C=C4)C=C13.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Regorafenib (monohydrate), CAS:1019206-88-2, Molecular Weight: 500.8307, C21H17ClF4N4O4, Purity:98, SMILES: O=C(NC1=CC=C(C(C(F)(F)F)=C1)Cl)NC2=CC=C(OC3=CC(C(NC)=O)=NC=C3)C=C2F.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB 203580 (hydrochloride), CAS:869185-85-3, Molecular Weight: 413.8956, C21H17ClFN3OS, Purity:98, SMILES: O=S(C1=CC=C(C2=NC(C3=CC=C(F)C=C3)=C(C4=CC=NC=C4)N2)C=C1)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rhodamine 123, CAS:62669-70-9, Molecular Weight: 380.8243, C21H17ClN2O3, Purity:98, SMILES: O=C(C1=CC=CC=C1C2=C3C=CC(N)=CC3=[O+]C4=C2C=CC(N)=C4)OC.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| TM5441, CAS:1190221-43-2, Molecular Weight: 428.82248, C21H17ClN2O6, Purity:98, SMILES: ClC1=CC=C(NC(COCC(NC2=CC=CC(C3=CC=CO3)=C2)=O)=O)C(C(O)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PLX647, CAS:873786-09-5, Molecular Weight: 382.3817, C21H17F3N4, Purity:98, SMILES: FC(C1=CC=C(CNC2=NC=C(CC3=CNC4=NC=CC=C43)C=C2)C=C1)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-methyl-4-(4-(3-(3-(trifluoromethyl)phenyl)ureido)phenoxy)picolinamide, CAS:1285533-84-7, Molecular Weight: 430.3799, C21H17F3N4O3, Purity:95, SMILES: CNC(=O)c1nccc(c1)Oc1ccc(cc1)NC(=O)Nc1cccc(c1)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SNG-1153, CAS:1446712-19-1, Molecular Weight: 406.3519, C21H17F3O5, Purity:98, SMILES: FC(F)(F)C(C=C1)=CC=C1C2=C(O)C(C(C(O)=CC(O)=C3C/C=C(C)/C)=C3O2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GW0742, CAS:317318-84-6, Molecular Weight: 471.4882, C21H17F4NO3S2, Purity:98, SMILES: O=C(O)COC1=CC=C(SCC2=C(C)N=C(C3=CC=C(C(F)(F)F)C(F)=C3)S2)C=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lp-PLA2 -IN-1, CAS:1420367-28-7, Molecular Weight: 468.3767, C21H17F5N4O3, Purity:98, SMILES: CN1C(N2CCC1)=CC(OCC3=CC(F)=C(OC4=CC=C(C(F)(F)F)N=C4)C(F)=C3)=NC2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| OC000459, CAS:851723-84-7, Molecular Weight: 348.3703, C21H17FN2O2, Purity:98, SMILES: O=C(O)CN1C(C)=C(CC2=NC3=CC=CC=C3C=C2)C4=C1C=CC(F)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(TRIPHENYLMETHYL)-1H-1,2,4-TRIAZOLE, CAS:31250-99-4, Molecular Weight: 311.3798, C21H17N3, Purity:95, SMILES: c1ncn(n1)C(c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| iCRT 14, CAS:677331-12-3, Molecular Weight: 375.4436, C21H17N3O2S, Purity:98, SMILES: O=C(S/1)N(C2=CC=CC=C2)C(C1=C\C3=C(C)N(C(C)=C3)C4=CN=CC=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nortadalafil, CAS:171596-36-4, Molecular Weight: 375.3774, C21H17N3O4, Purity:98, SMILES: O=C1NCC(N([C@@H]1C2)[C@H](C3=CC=C(OCO4)C4=C3)C5=C2C6=C(N5)C=CC=C6)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trimethyl [2,2':6',2''-terpyridine]-4,4',4''-tricarboxylate, CAS:330680-46-1, Molecular Weight: 407.3762, C21H17N3O6, Purity:95, SMILES: COC(=O)c1cc(nc(c1)c1nccc(c1)C(=O)OC)c1nccc(c1)C(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-(Benzhydryloxy)-1H-indole, CAS:135328-49-3, Molecular Weight: 299.3658, C21H17NO, Purity:95, SMILES: c1ccc(cc1)C(c1ccccc1)Oc1cccc2c1[nH]cc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BHPI, CAS:56632-39-4, Molecular Weight: 331.3646, C21H17NO3, Purity:98, SMILES: O=C1NC2=C(C=CC=C2C)C1(C3=CC=C(O)C=C3)C4=CC=C(O)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BIBR 1532, CAS:321674-73-1, Molecular Weight: 331.3646, C21H17NO3, Purity:98, SMILES: O=C(O)C1=CC=CC=C1NC(/C=C(C2=CC=C3C=CC=CC3=C2)\C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KU-55933, CAS:587871-26-9, Molecular Weight: 395.4946, C21H17NO3S2, Purity:98, SMILES: O=C1C=C(OC(C2=C3SC4=C(SC3=CC=C2)C=CC=C4)=C1)N5CCOCC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| P7C3, CAS:301353-96-8, Molecular Weight: 474.1884, C21H18Br2N2O, Purity:98, SMILES: OC(CNC1=CC=CC=C1)CN2C3=CC=C(Br)C=C3C4=CC(Br)=CC=C24, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RI-2, CAS:1417162-36-7, Molecular Weight: 433.2846, C21H18Cl2N2O4, Purity:98, SMILES: O=C(C(C1=CC=C(OC)C=C1)=C2N3CCOCC3)N(C4=CC=C(Cl)C(Cl)=C4)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GDC-0994, CAS:1453848-26-4, Molecular Weight: 440.858, C21H18ClFN6O2, Purity:98, SMILES: O=C1C=C(C2=NC(NC3=CC=NN3C)=NC=C2)C=CN1[C@@H](C4=CC=C(Cl)C(F)=C4)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PSI-697, CAS:851546-61-7, Molecular Weight: 367.8255, C21H18ClNO3, Purity:98, SMILES: O=C(C1=C(O)C(CC2=CC=C(Cl)C=C2)=NC3=C(CCCC4)C4=CC=C13)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chelerythrine Chloride, CAS:3895-92-9, Molecular Weight: 383.8249, C21H18ClNO4, Purity:98, SMILES: C[N+]1=CC2=C(C(OC)=CC=C2C3=C1C4=CC5=C(OCO5)C=C4C=C3)OC.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acemetacin, CAS:53164-05-9, Molecular Weight: 415.8237, C21H18ClNO6, Purity:98, SMILES: O=C(OCC(O)=O)CC1=C(C)N(C(C2=CC=C(Cl)C=C2)=O)C3=C1C=C(OC)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LJI308, CAS:1627709-94-7, Molecular Weight: 368.3766, C21H18F2N2O2, Purity:98, SMILES: OC1=C(F)C=C(C2=C(C3=CC=C(N4CCOCC4)C=C3)C=CN=C2)C=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AGI-6780, CAS:1432660-47-3, Molecular Weight: 481.5111, C21H18F3N3O3S2, Purity:98, SMILES: O=S(C1=CC=C(C2=CSC=C2)C(NC(NC3=CC=CC(C(F)(F)F)=C3)=O)=C1)(NC4CC4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GW 501516, CAS:317318-70-0, Molecular Weight: 453.4977, C21H18F3NO3S2, Purity:98, SMILES: OC(COC1=CC=C(C=C1C)SCC2=C(N=C(S2)C3=CC=C(C=C3)C(F)(F)F)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Linifanib, CAS:796967-16-3, Molecular Weight: 375.3989, C21H18FN5O, Purity:98, SMILES: O=C(NC1=CC=C(C2=C3C(N)=NNC3=CC=C2)C=C1)NC4=C(C=CC(C)=C4)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ro 5126766, CAS:946128-88-7, Molecular Weight: 471.4615, C21H18FN5O5S, Purity:98, SMILES: O=S(NC)(NC1=NC=CC(CC2=C(C)C3=CC=C(OC4=NC=CC=N4)C=C3OC2=O)=C1F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZSET-845, CAS:324077-62-5, Molecular Weight: 314.38042, C21H18N2O, Purity:98, SMILES: O=C1N=C2C=CC=CN2C1(CC3=CC=CC=C3)CC4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HS-173, CAS:1276110-06-5, Molecular Weight: 422.457, C21H18N4O4S, Purity:98, SMILES: O=C(C1=CN=C2C=CC(C3=CC(NS(=O)(C4=CC=CC=C4)=O)=CN=C3)=CN21)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4',4''-(1,3,5-Triazine-2,4,6-triyl)trianiline, CAS:14544-47-9, Molecular Weight: 354.4078, C21H18N6, Purity:98, SMILES: Nc1ccc(cc1)-c1nc(nc(n1)-c1ccc(N)cc1)-c1ccc(N)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Baicalin, CAS:21967-41-9, Molecular Weight: 446.361, C21H18O11, Purity:98, SMILES: O[C@H]([C@H]([C@@H]([C@@H](C(O)=O)O1)O)O)[C@@H]1OC2=C(O)C(O)=C3C(C=C(C4=CC=CC=C4)OC3=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Scutellarin, CAS:27740-01-8, Molecular Weight: 462.3604, C21H18O12, Purity:98, SMILES: O=C(C=C(C1=CC=C(O)C=C1)OC2=CC(O[C@@H]([C@@H]([C@@H](O)[C@@H]3O)O)O[C@@H]3C(O)=O)=C4O)C2=C4O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Miquelianin, CAS:22688-79-5, Molecular Weight: 478.3598, C21H18O13, Purity:98, SMILES: O=C1C2=C(O)C=C(O)C=C2OC(C3=CC=C(O)C(O)=C3)=C1O[C@@H]4O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]4O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3,5-Dibenzyloxybenzaldehyde, CAS:14615-72-6, Molecular Weight: 318.3658, C21H18O3, Purity:97, SMILES: O=Cc1cc(OCc2ccccc2)cc(c1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(4-Phenoxybutoxy)psoralen, CAS:870653-45-5, Molecular Weight: 350.3646, C21H18O5, Purity:95, SMILES: O=c1cc(OCCCCOc2ccccc2)c2cc3ccoc3cc2o1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PAP-1, CAS:870653-45-5, Molecular Weight: 350.3646, C21H18O5, Purity:98, SMILES: O=C1C=CC(C(O1)=CC2=C3C=CO2)=C3OCCCCOC4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZCL278, CAS:587841-73-4, Molecular Weight: 584.8937, C21H19BrClN5O4S2, Purity:98, SMILES: O=C(NC(NC1=CC=C(S(=O)(NC2=NC(C)=CC(C)=N2)=O)C=C1)=S)COC3=CC=C(Br)C=C3Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GDC-0994 (hydrochloride), CAS:2070009-58-2, Molecular Weight: 477.319, C21H19Cl2FN6O2, Purity:98, SMILES: O=C1C=C(C2=NC(NC3=CC=NN3C)=NC=C2)C=CN1[C@@H](C4=CC=C(Cl)C(F)=C4)CO.Cl[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY2874455, CAS:1254473-64-7, Molecular Weight: 444.3139, C21H19Cl2N5O2, Purity:98, SMILES: ClC1=CN=CC(Cl)=C1[C@@H](C)OC2=CC=C(NN=C3/C=C/C4=CN(CCO)N=C4)C3=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| K-Ras G12C-IN-3, CAS:1629268-19-4, Molecular Weight: 453.7462, C21H19Cl3N2O3, Purity:98, SMILES: ClC(C=C(OC)C(C(N1CCN(C(C=C)=O)CC1)=O)=C2)=C2C3=CC(Cl)=CC=C3Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Laropiprant, CAS:571170-77-9, Molecular Weight: 435.8963, C21H19ClFNO4S, Purity:98, SMILES: O=S(C1=CC(F)=CC2=C1N(C3=C2CC[C@@H]3CC(O)=O)CC4=CC=C(Cl)C=C4)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GKT137831, CAS:1218942-37-0, Molecular Weight: 394.8542, C21H19ClN4O2, Purity:98, SMILES: O=C1N(C2=CC=CC=C2Cl)NC(C1=C(C3=CC=CC(N(C)C)=C3)N4C)=CC4=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB 242084, CAS:181632-25-7, Molecular Weight: 394.8542, C21H19ClN4O2, Purity:98, SMILES: O=C(N1CCC2=C1C=C(Cl)C(C)=C2)NC3=CC=C(OC4=CC=CN=C4C)N=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lenvatinib, CAS:417716-92-8, Molecular Weight: 426.853, C21H19ClN4O4, Purity:98, SMILES: O=C(N)C1=C(C=C2N=CC=C(C2=C1)OC3=CC=C(C(Cl)=C3)NC(NC4CC4)=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nucleozin, CAS:341001-38-5, Molecular Weight: 426.853, C21H19ClN4O4, Purity:98, SMILES: CC1=C(C(C2=CC=CC=C2)=NO1)C(N3CCN(C4=C(C=C(C=C4)[N+]([O-])=O)Cl)CC3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4,4'-(chloro(phenyl)methylene)bis(methoxybenzene), CAS:40615-36-9, Molecular Weight: 338.827, C21H19ClO2, Purity:95, SMILES: COc1ccc(cc1)C(Cl)(c1ccccc1)c1ccc(OC)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Haloperidol (D4'), CAS:136765-35-0, Molecular Weight: 379.8889, C21H19D4ClFNO2, Purity:98, SMILES: OC1(CCN(CCCC(C2=C([2H])C([2H])=C(F)C([2H])=C2[2H])=O)CC1)C3=CC=C(Cl)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Haloperidol D4, CAS:1189986-59-1, Molecular Weight: 379.8889, C21H19D4ClFNO2, Purity:98, SMILES: ClC1=C([2H])C([2H])=C(C2(O)CCN(CCCC(C3=CC=C(F)C=C3)=O)CC2)C([2H])=C1[2H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cetirizine (D8 dihydrochloride), CAS:, Molecular Weight: 469.859, C21H19D8Cl3N2O3, Purity:98, SMILES: ClC1=CC=C(C(N2C([2H])([2H])C([2H])([2H])N(CCOCC(O)=O)C([2H])([2H])C2([2H])[2H])C3=CC=CC=C3)C=C1.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RWJ-51204, CAS:205701-85-5, Molecular Weight: 399.3907, C21H19F2N3O3, Purity:98, SMILES: O=C(C1=C2N(COCC)C3=CC(F)=CC=C3N2CCC1=O)NC4=CC=CC=C4F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SEA0400, CAS:223104-29-8, Molecular Weight: 371.3773, C21H19F2NO3, Purity:98, SMILES: NC1=CC(OCC)=CC=C1OC2=CC=C(OCC3=CC(F)=CC=C3F)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY-2584702 (free base), CAS:1082949-67-4, Molecular Weight: 445.4161, C21H19F4N7, Purity:98, SMILES: CN1C=C(C2=CC=C(F)C(C(F)(F)F)=C2)N=C1C3CCN(C4=C5C(NN=C5)=NC=N4)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RGFP966, CAS:1357389-11-7, Molecular Weight: 362.4002, C21H19FN4O, Purity:98, SMILES: O=C(NC1=CC=C(F)C=C1N)/C=C/C2=CN(C/C=C/C3=CC=CC=C3)N=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-06463922, CAS:1454846-35-5, Molecular Weight: 406.413, C21H19FN6O2, Purity:98, SMILES: CN1C(C#N)=C2C(CN(C)C(C3=C([C@@H](C)OC4=C(N)N=CC2=C4)C=C(F)C=C3)=O)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HSF1A, CAS:1196723-93-9, Molecular Weight: 409.52446, C21H19N3O2S2, Purity:98, SMILES: O=S(C1=CC=C(CC)C=C1)(NC2=CC(C3=CC=CS3)=NN2C4=CC=CC=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amsacrine, CAS:51264-14-3, Molecular Weight: 393.4589, C21H19N3O3S, Purity:98, SMILES: CS(=O)(NC1=CC=C(NC2=C(C=CC=C3)C3=NC4=CC=CC=C42)C(OC)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK'481, CAS:1622849-58-4, Molecular Weight: 377.3932, C21H19N3O4, Purity:98, SMILES: O=C(C1=NOC(CC2=CC=CC=C2)=C1)N[C@H]3COC4=CC=CC=C4N(C)C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML355, CAS:1532593-30-8, Molecular Weight: 441.5233, C21H19N3O4S2, Purity:98, SMILES: O=S(NC1=NC2=CC=CC=C2S1)(C3=CC=C(NCC4=CC=CC(OC)=C4O)C=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fruquintinib, CAS:1194506-26-7, Molecular Weight: 393.3927, C21H19N3O5, Purity:98, SMILES: O=C(C1=C(C)OC2=CC(OC3=C4C=C(OC)C(OC)=CC4=NC=N3)=CC=C12)NC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BAM7, CAS:331244-89-4, Molecular Weight: 405.4729, C21H19N5O2S, Purity:98, SMILES: CCOC1=CC=CC=C1N/N=C2C(C)=NN(C3=NC(C4=CC=CC=C4)=CS3)C\2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PDE10-IN-1, CAS:1516896-09-5, Molecular Weight: 369.4225, C21H19N7, Purity:98, SMILES: CC1=C([C@H]2[C@H](C3=NN4C(C(C)=NC=C4C)=N3)C2)N=C5C6=C(N=CC=C6)C=CN51, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ATB-346, CAS:1226895-20-0, Molecular Weight: 365.4455, C21H19NO3S, Purity:98, SMILES: COC1=CC=C(C=C(C(C)C(OC2=CC=C(C(N)=S)C=C2)=O)C=C3)C3=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dihydrochelerythrine, CAS:6880-91-7, Molecular Weight: 349.3799, C21H19NO4, Purity:98, SMILES: CN1C(C2=CC(OCO3)=C3C=C2C=C4)=C4C5=CC=C(OC)C(OC)=C5C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 2-(triphenylphosphoranylidene)acetate, CAS:2605-67-6, Molecular Weight: 334.3481, C21H19O2P, Purity:95, SMILES: COC(=O)C=P(c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl (5-bromo-2-(6-fluoronicotinoylbenzofuran-3-yl(3-methoxypropylcarbamate, CAS:1431434-22-8, Molecular Weight: 479.296, C21H20BrFN2O5, Purity:95, SMILES: CCOC(=O)N(CCCOC)C1=C(OC2=C1C=C(Br)C=C2)C(=O)C1=CN=C(F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2-Carboxyethyl)triphenylphosphonium bromide, CAS:51114-94-4, Molecular Weight: 415.26, C21H20BrO2P, Purity:95, SMILES: OC(=O)CC[P+](c1ccccc1)(c1ccccc1)c1ccccc1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Permethrin, CAS:52645-53-1, Molecular Weight: 391.2877, C21H20Cl2O3, Purity:98, SMILES: O=C(C1C(C)(C)C1/C=C(Cl)\Cl)OCC2=CC=CC(OC3=CC=CC=C3)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY-2584702 (hydrochloride), CAS:1082948-81-9, Molecular Weight: 481.877, C21H20ClF4N7, Purity:98, SMILES: CN1C=C(C2=CC=C(F)C(C(F)(F)F)=C2)N=C1C3CCN(C4=C5C(NN=C5)=NC=N4)CC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amsacrine (hydrochloride), CAS:54301-15-4, Molecular Weight: 429.9198, C21H20ClN3O3S, Purity:98, SMILES: CS(=O)(NC1=CC=C(NC2=C(C=CC=C3)C3=NC4=CC=CC=C42)C(OC)=C1)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HIV-1 integrase inhibitor 2, CAS:957890-42-5, Molecular Weight: 353.842, C21H20ClNO2, Purity:98, SMILES: ClC1=CC=C(N=C(C)C(C(CCC)C(O)=O)=C2C3=CC=CC=C3)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Asenapine (maleate), CAS:85650-56-2, Molecular Weight: 401.8402, C21H20ClNO5, Purity:98, SMILES: CN1C[C@]2([H])C3=CC=CC=C3OC4=CC=C(Cl)C=C4[C@]2(C1)[H].O=C(O)/C=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Flavopiridol, CAS:146426-40-6, Molecular Weight: 401.8402, C21H20ClNO5, Purity:98, SMILES: O=C1C2=C(C=C(C([C@]3([H])[C@H](O)CN(C)CC3)=C2OC(C4=CC=CC=C4Cl)=C1)O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Perphenazine (D8 Dihydrochloride), CAS:, Molecular Weight: 484.9398, C21H20D8Cl3N3OS, Purity:98, SMILES: [H]Cl.[H]Cl.ClC1=CC=C2SC3=C(N(CCCN4C([2H])([2H])C([2H])([2H])N(CCO)C([2H])([2H])C4([2H])[2H])C2=C1)C=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-562271, CAS:717907-75-0, Molecular Weight: 507.4888, C21H20F3N7O3S, Purity:98, SMILES: CS(=O)(N(C)C1=NC=CC=C1CNC2=NC(NC3=CC4=C(C=C3)NC(C4)=O)=NC=C2C(F)(F)F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tarafenacin, CAS:385367-47-5, Molecular Weight: 408.3893, C21H20F4N2O2, Purity:98, SMILES: O=C(O[C@H]1CN2CCC1CC2)N(C3=CC=CC(F)=C3)CC4=CC(F)=C(F)C(F)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JW 642, CAS:1416133-89-5, Molecular Weight: 462.3855, C21H20F6N2O3, Purity:98, SMILES: O=C(OC(C(F)(F)F)C(F)(F)F)N(CC1)CCN1CC2=CC(OC3=CC=CC=C3)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AMG-3969, CAS:1361224-53-4, Molecular Weight: 522.4639, C21H20F6N4O3S, Purity:98, SMILES: CC#C[C@@H]1N(C2=CC=C(C(C(F)(F)F)(O)C(F)(F)F)C=C2)CCN(S(=O)(C3=CN=C(N)C=C3)=O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bitopertin, CAS:845614-11-1, Molecular Weight: 543.4550224, C21H20F7N3O4S, Purity:98, SMILES: FC1=CC(C(F)(F)F)=CN=C1N2CCN(C(C3=CC(S(=O)(C)=O)=CC=C3O[C@H](C(F)(F)F)C)=O)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bitopertin (R enantiomer), CAS:845614-12-2, Molecular Weight: 543.4550224, C21H20F7N3O4S, Purity:98, SMILES: FC1=CC(C(F)(F)F)=CN=C1N2CCN(C(C3=CC(S(=O)(C)=O)=CC=C3O[C@@H](C(F)(F)F)C)=O)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PK14105, CAS:107257-28-3, Molecular Weight: 381.4002, C21H20FN3O3, Purity:98, SMILES: O=C(C1=CC2=C(C(C3=CC([N+]([O-])=O)=CC=C3F)=N1)C=CC=C2)N(C)C(C)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Basmisanil, CAS:1159600-41-5, Molecular Weight: 445.464, C21H20FN3O5S, Purity:98, SMILES: O=C(N1CCS(CC1)(=O)=O)C2=CC=C(OCC3=C(C)ON=C3C4=CC=C(F)C=C4)N=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prulifloxacin, CAS:123447-62-1, Molecular Weight: 461.4634, C21H20FN3O6S, Purity:98, SMILES: O=C(C1=C(SC2C)N2C3=C(C=C(F)C(N4CCN(CC5=C(C)OC(O5)=O)CC4)=C3)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TAK-438, CAS:1260141-27-2, Molecular Weight: 461.4634, C21H20FN3O6S, Purity:98, SMILES: FC(C=CC=C1)=C1C2=CC(CNC)=CN2S(=O)(C3=CC=CN=C3)=O.OC(/C=C/C(O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NS-018, CAS:1239358-86-1, Molecular Weight: 389.4288, C21H20FN7, Purity:98, SMILES: CN1N=CC(C2=CC(N[C@H](C3=CC=C(F)C=C3)C)=NC(NC4=NC=CN=C4)=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| OTS514, CAS:1338540-63-8, Molecular Weight: 364.4607, C21H20N2O2S, Purity:98, SMILES: O=C1NC2=C(C(C3=CC=C([C@@H](C)CN)C=C3)=C(O)C=C2C)C4=C1SC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MKC3946, CAS:1093119-54-0, Molecular Weight: 380.4601, C21H20N2O3S, Purity:98, SMILES: O=CC1=C(O)C=CC2=C1C=CC(C3=CC=C(C(N4CCN(C)CC4)=O)S3)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZINC00881524, CAS:557782-81-7, Molecular Weight: 380.4601, C21H20N2O3S, Purity:98, SMILES: O=C(NC1=NC2=C(CCC3=C2C=CC=C3)S1)CC4=CC=C(OC)C(OC)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Varespladib, CAS:172732-68-2, Molecular Weight: 380.3939, C21H20N2O5, Purity:98, SMILES: O=C(O)COC1=CC=CC2=C1C(C(C(N)=O)=O)=C(CC)N2CC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SW033291, CAS:459147-39-8, Molecular Weight: 412.5913, C21H20N2OS3, Purity:98, SMILES: NC1=C(S(CCCC)=O)SC2=NC(C3=CC=CS3)=CC(C4=CC=CC=C4)=C21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-((1H-benzo[d][1,2,3]triazol-1-yl)Methyl)-N-benzyl-1-phenylMethanaMine, CAS:57684-32-9, Molecular Weight: 328.4103, C21H20N4, Purity:95, SMILES: C(N(Cc1ccccc1)Cn1nnc2ccccc12)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Serdemetan, CAS:881202-45-5, Molecular Weight: 328.4103, C21H20N4, Purity:98, SMILES: C1(NCCC2=CNC3=C2C=CC=C3)=CC=C(C=C1)NC4=CC=NC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GK921, CAS:1025015-40-0, Molecular Weight: 344.4097, C21H20N4O, Purity:98, SMILES: C12=NC=CC=C1N=C(OCCN3CCCC3)C(C#CC4=CC=CC=C4)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BMH-21, CAS:896705-16-1, Molecular Weight: 360.4091, C21H20N4O2, Purity:98, SMILES: O=C(C1=CC=CN2C1=NC3=C(C=C4C(C=CC=C4)=C3)C2=O)NCCN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Entinostat, CAS:209783-80-2, Molecular Weight: 376.4085, C21H20N4O3, Purity:98, SMILES: O=C(NCC1=CC=C(C=C1)C(NC2=CC=CC=C2N)=O)OCC3=CC=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AS-35, CAS:108427-72-1, Molecular Weight: 420.4213, C21H20N6O4, Purity:98, SMILES: O=C1C(C2=NN=NN2)=CN=C3N1C=CC=C3COC4=CC=C(C(C)=O)C(O)=C4CCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Apigenin 7-glucoside, CAS:578-74-5, Molecular Weight: 432.3775, C21H20O10, Purity:98, SMILES: O=C(C=C(C1=CC=C(O)C=C1)OC2=CC(O[C@@H]([C@@H]([C@@H](O)[C@@H]3O)O)O[C@@H]3CO)=C4)C2=C4O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Genistin, CAS:529-59-9, Molecular Weight: 432.3775, C21H20O10, Purity:98, SMILES: O=C(C(C1=CC=C(O)C=C1)=COC2=CC(O[C@@H]([C@@H]([C@@H](O)[C@@H]3O)O)O[C@@H]3CO)=C4)C2=C4O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Astragalin, CAS:480-10-4, Molecular Weight: 448.3769, C21H20O11, Purity:98, SMILES: OC1=CC2=C(C(C(O[C@@H]3O[C@H](CO)[C@@H](O)[C@H](O)[C@H]3O)=C(C4=CC=C(O)C=C4)O2)=O)C(O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cynaroside, CAS:5373-11-5, Molecular Weight: 448.3769, C21H20O11, Purity:98, SMILES: O=C(C=C(C1=CC(O)=C(O)C=C1)OC2=CC(O[C@@H]([C@@H]([C@@H](O)[C@@H]3O)O)O[C@@H]3CO)=C4)C2=C4O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isoorientin, CAS:4261-42-1, Molecular Weight: 448.3769, C21H20O11, Purity:98, SMILES: OC1=C(C2=O)C(OC(C3=CC(O)=C(O)C=C3)=C2)=CC(O)=C1[C@@H]([C@@H]([C@@H](O)[C@@H]4O)O)O[C@@H]4CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Quercitrin, CAS:522-12-3, Molecular Weight: 448.3769, C21H20O11, Purity:98, SMILES: OC1=CC(O)=C(C(C(O[C@H]2[C@H](O)[C@H](O)[C@@H](O)[C@H](C)O2)=C(C3=CC(O)=C(O)C=C3)O4)=O)C4=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (9H-fluoren-9-yl)methyl 4,7-dioxoheptanoate, CAS:1040404-88-3, Molecular Weight: 336.3811, C21H20O4, Purity:95, SMILES: O=CCCC(=O)CCC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Curcumin, CAS:458-37-7, Molecular Weight: 368.3799, C21H20O6, Purity:98, SMILES: O=C(CC(/C=C/C1=CC=C(O)C(OC)=C1)=O)/C=C/C2=CC=C(O)C(OC)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Curcumin, CAS:458-37-7, Molecular Weight: 368.3799, C21H20O6, Purity:95, SMILES: COc1cc(ccc1O)\C=C\C(=O)CC(=O)\C=C\c1ccc(O)c(OC)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Icaritin, CAS:118525-40-9, Molecular Weight: 368.3799, C21H20O6, Purity:98, SMILES: O=C1C(O)=C(C2=CC=C(OC)C=C2)OC3=C(C/C=C(C)\C)C(O)=CC(O)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sophoflavescenol, CAS:216450-65-6, Molecular Weight: 368.3799, C21H20O6, Purity:98, SMILES: O=C1C(O)=C(C2=CC=C(O)C=C2)OC3=C(C/C=C(C)\C)C(O)=CC(OC)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4'-Demethylepipodophyllotoxin, CAS:6559-91-7, Molecular Weight: 400.3787, C21H20O8, Purity:98, SMILES: O=C1OC[C@]2([H])[C@H](O)C3=C(C=C4OCOC4=C3)[C@@H](C5=CC(OC)=C(O)C(OC)=C5)[C@]21[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Daidzin, CAS:552-66-9, Molecular Weight: 416.3781, C21H20O9, Purity:98, SMILES: OC1=CC=C(C2=COC(C=C(O[C@H]3[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O3)C=C4)=C4C2=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Puerarin, CAS:3681-99-0, Molecular Weight: 416.3781, C21H20O9, Purity:98, SMILES: O=C1C(C2=CC=C(O)C=C2)=COC3=C([C@H]4[C@@H]([C@H]([C@@H]([C@@H](CO)O4)O)O)O)C(O)=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NIBR189, CAS:1599432-08-2, Molecular Weight: 429.307, C21H21BrN2O3, Purity:98, SMILES: O=C(N1CCN(C(C2=CC=C(OC)C=C2)=O)CC1)/C=C/C3=CC=C(Br)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SBI-0206965, CAS:1884220-36-3, Molecular Weight: 489.3192, C21H21BrN4O5, Purity:98, SMILES: CNC(C1=CC=CC=C1OC2=NC(NC3=CC(OC)=C(OC)C(OC)=C3)=NC=C2Br)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-[(3aR,4R,6R,6aR)-6-(6-amino-8-bromopurin-9-yl)-2,2-dimethyl-tetrahydrofuro[3,4-d][1,3]dioxol-4-ylmethoxymethyl]benzonitrile, CAS:1134156-53-8, Molecular Weight: 501.333, C21H21BrN6O4, Purity:95, SMILES: CC1(C)OC2[C@@H](COCc3ccc(cc3)C#N)O[C@H]([C@@H]2O1)n1c(Br)nc2c(N)ncnc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CGP11952, CAS:64078-09-7, Molecular Weight: 446.32974, C21H21Cl2N5O2, Purity:98, SMILES: O=C(C1=NN(C2=CC=C(Cl)C=C2C(C3=CC=CC=C3Cl)=O)C(CN(C)C)=N1)NCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Flavopiridol (Hydrochloride), CAS:131740-09-5, Molecular Weight: 438.3011, C21H21Cl2NO5, Purity:98, SMILES: O=C1C2=C(C=C(C([C@]3([H])[C@H](O)CN(C)CC3)=C2OC(C4=CC=CC=C4Cl)=C1)O)O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB 242084 (hydrochloride), CAS:1049747-87-6, Molecular Weight: 467.776, C21H21Cl3N4O2, Purity:98, SMILES: O=C(N1CCC2=C1C=C(Cl)C(C)=C2)NC3=CC=C(OC4=CC=CN=C4C)N=C3.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 450191S, CAS:85815-37-8, Molecular Weight: 511.78884, C21H21Cl3N6O3, Purity:98, SMILES: NCC(NCC1=NC(C(N(C)C)=O)=NN1C2=C(C=C(Cl)C=C2)C(C3=C(C=CC=C3)Cl)=O)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MK-0752, CAS:471905-41-6, Molecular Weight: 442.9038, C21H21ClF2O4S, Purity:98, SMILES: O=C(CC[C@H]1CC[C@@](S(=O)(C2=CC=C(C=C2)Cl)=O)(CC1)C3=CC(F)=CC=C3F)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Teijin compound 1, CAS:226226-39-7, Molecular Weight: 439.8585496, C21H21ClF3N3O2, Purity:98, SMILES: O=C(NCC(N[C@H]1CN(CC2=CC=C(Cl)C=C2)CC1)=O)C3=CC=CC(C(F)(F)F)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MK-2048, CAS:869901-69-9, Molecular Weight: 461.8739, C21H21ClFN5O4, Purity:98, SMILES: FC1=C(Cl)C=C(CN2C(C(C(O)=C3N4[C@@H](C)CN(CC)C3=O)=C4C(C(NC)=O)=N2)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NS-018 (hydrochloride), CAS:1239358-85-0, Molecular Weight: 425.8897, C21H21ClFN7, Purity:98, SMILES: [H]Cl.CN1N=CC(C2=CC(N[C@H](C3=CC=C(F)C=C3)C)=NC(NC4=NC=CN=C4)=C2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ziprasidone, CAS:146939-27-7, Molecular Weight: 412.9356, C21H21ClN4OS, Purity:98, SMILES: ClC1=CC2=C(CC(N2)=O)C=C1CCN(CC3)CCN3C4=NSC5=C4C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Kuromanin (chloride), CAS:7084-24-4, Molecular Weight: 484.8378, C21H21ClO11, Purity:98, SMILES: O[C@H]([C@@H](O)[C@@H]1O)[C@@H](O[C@@H]1CO)OC(C(C2=CC(O)=C(O)C=C2)=[O+]C3=CC(O)=C4)=CC3=C4O.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Propafenone (D7 hydrochloride), CAS:1219799-06-0, Molecular Weight: 384.9481, C21H21D7ClNO3, Purity:98, SMILES: OC(CNC([2H])([2H])C([2H])([2H])C([2H])([2H])[2H])COC1=C(C(CCC2=CC=CC=C2)=O)C=CC=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cobimetinib, CAS:934660-93-2, Molecular Weight: 531.31, C21H21F3IN3O2, Purity:98, SMILES: OC1([C@H]2NCCCC2)CN(C1)C(C3=C(C(F)=C(C=C3)F)NC4=C(C=C(C=C4)I)F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cobimetinib (racemate), CAS:934662-91-6, Molecular Weight: 531.31, C21H21F3IN3O2, Purity:98, SMILES: FC1=C(F)C=CC(C(N2CC(C3CCCCN3)(O)C2)=O)=C1NC4=CC=C(I)C=C4F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cobimetinib (R-enantiomer), CAS:934660-94-3, Molecular Weight: 531.31, C21H21F3IN3O2, Purity:98, SMILES: FC1=C(F)C=CC(C(N2CC([C@H]3CCCCN3)(O)C2)=O)=C1NC4=CC=C(I)C=C4F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RS102895, CAS:300815-41-2, Molecular Weight: 390.3989, C21H21F3N2O2, Purity:98, SMILES: O=C1NC2=CC=CC=C2C3(CCN(CCC4=CC=C(C(F)(F)F)C=C4)CC3)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML390, CAS:, Molecular Weight: 406.3983, C21H21F3N2O3, Purity:98, SMILES: O=C(NCCC(N[C@H]1C(C=CC=C2)=C2CCC1)=O)C3=CC=C(OC(F)(F)F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ramatroban, CAS:116649-85-5, Molecular Weight: 416.4659, C21H21FN2O4S, Purity:98, SMILES: O=C(O)CCN1C2=C(C3=C1C=CC=C3)C[C@H](NS(=O)(C4=CC=C(F)C=C4)=O)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dovitinib, CAS:405169-16-6, Molecular Weight: 392.4294, C21H21FN6O, Purity:98, SMILES: O=C1NC(C=CC=C2F)=C2C(N)=C1C3=NC4=CC=C(N5CCN(C)CC5)C=C4N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ipragliflozin, CAS:761423-87-4, Molecular Weight: 404.4518, C21H21FO5S, Purity:98, SMILES: FC1=CC=C([C@H]2[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O2)C=C1CC3=CC(C=CC=C4)=C4S3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cyproheptadine (hydrochloride sesquihydrate), CAS:41354-29-4, Molecular Weight: 350.88, C21H21N . 3/2H2O . HCl, Purity:98, SMILES: CN1CC/C(CC1)=C2C3=CC=CC=C3C=CC4=CC=CC=C/24.[H]Cl.[1.5H2O], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dihydroethidium, CAS:104821-25-2, Molecular Weight: 315.4115, C21H21N3, Purity:98, SMILES: NC1=CC=C2C3=C(C=C(N)C=C3)C(C4=CC=CC=C4)N(CC)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD1208, CAS:1204144-28-4, Molecular Weight: 379.4753, C21H21N3O2S, Purity:98, SMILES: O=C(NC/1=O)SC1=C/C2=C(N3C[C@H](N)CCC3)C(C4=CC=CC=C4)=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4-((BenzyloxyCarbonylPiperazin-1-YlIndolizine-6-Carboxylic Acid, CAS:0, Molecular Weight: 379.4091, C21H21N3O4, Purity:95, SMILES: OC(=O)C1=CN2C(=CC=C2N2CCN(CC2)C(=O)OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB 525334, CAS:356559-20-1, Molecular Weight: 343.4249, C21H21N5, Purity:98, SMILES: CC(C)(C1=NC(C2=CC=CC(C)=N2)=C(C3=CC=C4N=CC=NC4=C3)N1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NCB-0846, CAS:1792999-26-8, Molecular Weight: 375.4237, C21H21N5O2, Purity:98, SMILES: O[C@@H](CC1)CC[C@@H]1OC2=CC=CC(C=N3)=C2N=C3NC4=CC=C(N=CN5)C5=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IRAK inhibitor 3, CAS:1012343-93-9, Molecular Weight: 439.4875, C21H21N5O4S, Purity:98, SMILES: O=S(C1=CC=C(CNC2=NN3C(C4=CC(OC)=C(C=C4)OC)=CN=C3C=C2)C=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Ribocil-C, CAS:1825355-56-3, Molecular Weight: 419.5027, C21H21N7OS, Purity:98, SMILES: #671Ets6bjb9Z7h6bKs6Zts6jtgpE8bofrNYJFrtZrN6Eih6ZtZ9ZrHoZtj9E8b9
Zrb9EKjpZtsON546b789EKd=
, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(Trityl-Amino-Ethanol, CAS:24070-16-4, Molecular Weight: 303.3975, C21H21NO, Purity:95, SMILES: OCCNC(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tazarotene, CAS:118292-40-3, Molecular Weight: 351.4619, C21H21NO2S, Purity:98, SMILES: O=C(C1=CC=C(C#CC2=CC=C3C(C(C)(C)CCS3)=C2)N=C1)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-2-methylpent-4-enoic acid, CAS:288617-76-5, Molecular Weight: 351.3957, C21H21NO4, Purity:95, SMILES: C[C@](CC=C)(NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)hex-5-enoic acid, CAS:865352-21-2, Molecular Weight: 351.3957, C21H21NO4, Purity:95, SMILES: OC(=O)[C@@H](CCC=C)NC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)hex-5-enoic acid, CAS:851909-08-5, Molecular Weight: 351.3957, C21H21NO4, Purity:95, SMILES: OC(=O)[C@H](CCC=C)NC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Hexenoic acid, 2-[[(9H-fluoren-9-ylmethoxy)carbonyl]amino]-, CAS:193223-97-1, Molecular Weight: 351.3957, C21H21NO4, Purity:95, SMILES: OC(=O)C(CCC=C)NC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-2-((((9H-Fluoren-9-YlMethoxyCarbonylAminoCyclopentanecarboxylic Acid, CAS:352707-76-7, Molecular Weight: 351.3957, C21H21NO4, Purity:95, SMILES: OC(=O)[C@H]1CCC[C@H]1NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-D-beta-homoproline, CAS:193693-61-7, Molecular Weight: 351.3957, C21H21NO4, Purity:95, SMILES: OC(=O)C[C@H]1CCCN1C(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-L-beta-homoproline, CAS:193693-60-6, Molecular Weight: 351.3957, C21H21NO4, Purity:95, SMILES: OC(=O)C[C@@H]1CCCN1C(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| XEN907, CAS:912656-34-9, Molecular Weight: 351.3958, C21H21NO4, Purity:98, SMILES: O=C(C12COC3=C1C=C(OCO4)C4=C3)N(CCCCC)C5=C2C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2S,4R)-1-((9H-Fluoren-9-yl)methyl) 2-methyl 4-hydroxypyrrolidine-1,2-dicarboxylate, CAS:122350-59-8, Molecular Weight: 367.3951, C21H21NO5, Purity:95, SMILES: COC(=O)[C@@H]1C[C@H](CN1C(=O)OCC1c2ccccc2c2c1cccc2)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenepropanoic acid,-[(1,3-dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]-, 1,1-dimethylethyl ester, (R)-, CAS:380886-37-3, Molecular Weight: 367.3951, C21H21NO5, Purity:95, SMILES: O=C([C@H](ON1C(=O)c2c(C1=O)cccc2)Cc1ccccc1)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hydrastine, CAS:118-08-1, Molecular Weight: 383.3945, C21H21NO6, Purity:98, SMILES: O=C1O[C@H]([C@@H]2N(C)CCC3=C2C=C(OCO4)C4=C3)C5=C1C(OC)=C(OC)C=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tris(4-methoxyphenyl)phosphine, CAS:855-38-9, Molecular Weight: 352.3634, C21H21O3P, Purity:95, SMILES: COc1ccc(cc1)P(c1ccc(OC)cc1)c1ccc(OC)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tri-o-tolylphosphine, CAS:6163-58-2, Molecular Weight: 304.3652, C21H21P, Purity:99, SMILES: Cc1ccccc1P(c1ccccc1C)c1ccccc1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Crizotinib, CAS:877399-52-5, Molecular Weight: 450.3367, C21H22Cl2FN5O, Purity:98, SMILES: ClC1=C(F)C=CC(Cl)=C1[C@H](OC2=CC(C3=CN(N=C3)C4CCNCC4)=CN=C2N)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Demeclocycline (hydrochloride), CAS:64-73-3, Molecular Weight: 501.314, C21H22Cl2N2O8, Purity:98, SMILES: O=C(C(C1=O)=C(O)[C@@H](N(C)C)[C@]2([H])C[C@]3([H])[C@H](O)C4=C(C(C3=C(O)[C@@]21O)=O)C(O)=CC=C4Cl)N.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| VRT752271, CAS:869886-67-9, Molecular Weight: 433.331, C21H22Cl2N4O2, Purity:98, SMILES: O=C(C1=CC(C2=CC(NC(C)C)=NC=C2Cl)=CN1)N[C@@H](C3=CC=CC(Cl)=C3)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ziprasidone (hydrochloride), CAS:122883-93-6, Molecular Weight: 449.3966, C21H22Cl2N4OS, Purity:98, SMILES: ClC1=CC2=C(CC(N2)=O)C=C1CCN(CC3)CCN3C4=NSC5=C4C=CC=C5.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RS102895 (hydrochloride), CAS:1173022-16-6, Molecular Weight: 426.8598, C21H22ClF3N2O2, Purity:98, SMILES: [H]Cl.O=C1NC2=CC=CC=C2C3(CCN(CCC4=CC=C(C(F)(F)F)C=C4)CC3)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cyproheptadine (hydrochloride), CAS:969-33-5, Molecular Weight: 323.8591, C21H22ClN, Purity:98, SMILES: CN1CC/C(CC1)=C2C3=CC=CC=C3C=CC4=CC=CC=C/24.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Naftifine (hydrochloride), CAS:65473-14-5, Molecular Weight: 323.8591, C21H22ClN, Purity:98, SMILES: CN(C/C=C/C1=CC=CC=C1)CC2=CC=CC3=CC=CC=C23.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SAR7334, CAS:1333210-07-3, Molecular Weight: 367.87188, C21H22ClN3O, Purity:98, SMILES: N[C@@H](C1)CCCN1[C@@H]2CC3=CC=CC=C3[C@H]2OC4=C(Cl)C=C(C#N)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tolfenpyrad, CAS:129558-76-5, Molecular Weight: 383.8713, C21H22ClN3O2, Purity:98, SMILES: O=C(C1=C(Cl)C(CC)=NN1C)NCC2=CC=C(OC3=CC=C(C)C=C3)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| OSI-420, CAS:183320-51-6, Molecular Weight: 415.8701, C21H22ClN3O4, Purity:98, SMILES: OCCOC1=CC2=C(N=CN=C2NC3=CC=CC(C#C)=C3)C=C1OCCOC.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NSC632839, CAS:157654-67-6, Molecular Weight: 339.8585, C21H22ClNO, Purity:98, SMILES: O=C1/C(CNC/C1=C\C2=CC=C(C)C=C2)=C/C3=CC=C(C)C=C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Palmatine (chloride), CAS:10605-02-4, Molecular Weight: 387.8567, C21H22ClNO4, Purity:98, SMILES: COC1=C(OC)C2=C[N+]3=C(C4=CC(OC)=C(OC)C=C4CC3)C=C2C=C1.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trimethobenzamide D6, CAS:, Molecular Weight: 394.4944, C21H22D6N2O5, Purity:98, SMILES: O=C(NCC1=CC=C(OCCN(C([2H])([2H])[2H])C([2H])([2H])[2H])C=C1)C2=CC(OC)=C(OC)C(OC)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LOXO-101, CAS:1223403-58-4, Molecular Weight: 428.4352, C21H22F2N6O2, Purity:98, SMILES: O=C(N1C[C@@H](O)CC1)NC2=C3N=C(N4[C@@H](C5=CC(F)=CC=C5F)CCC4)C=CN3N=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PAC-14028, CAS:1005168-10-4, Molecular Weight: 491.4747, C21H22F5N3O3S, Purity:98, SMILES: O=C(N[C@@H](C1=CC(F)=C(NS(=O)(C)=O)C(F)=C1)C)/C=C/C2=CC=C(C(F)(F)F)N=C2CCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MBP146-78, CAS:188343-77-3, Molecular Weight: 335.4178832, C21H22FN3, Purity:98, SMILES: CN1CCC(C2=CC(C3=CC=NC=C3)=C(C4=CC=C(F)C=C4)N2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY 344864, CAS:186544-26-3, Molecular Weight: 351.4173, C21H22FN3O, Purity:98, SMILES: O=C(NC1=CC2=C(NC3=C2C[C@H](N(C)C)CC3)C=C1)C4=CC=C(F)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY 344864 (S-enantiomer), CAS:186544-27-4, Molecular Weight: 351.4173, C21H22FN3O, Purity:98, SMILES: O=C(NC1=CC2=C(NC3=C2C[C@@H](N(C)C)CC3)C=C1)C4=CC=C(F)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Flumorph, CAS:211867-47-9, Molecular Weight: 371.4021, C21H22FNO4, Purity:98, SMILES: O=C(N1CCOCC1)/C=C(C2=CC=C(OC)C(OC)=C2)\C3=CC=C(F)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ISOPROPYLTRIPHENYLPHOSPHONIUM IODIDE, CAS:24470-78-8, Molecular Weight: 432.2776, C21H22IP, Purity:98, SMILES: [I-].CC(C)[P+](c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SKF96067, CAS:115607-61-9, Molecular Weight: 334.41158, C21H22N2O2, Purity:98, SMILES: CCCC(C1=C(NC2=CC=CC=C2C)C3=CC=CC(OC)=C3N=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,2R)-(-)-N-(4-Toluenesulfonyl)-1,2-diphenylethylenediamine, CAS:144222-34-4, Molecular Weight: 366.477, C21H22N2O2S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)N[C@@H]([C@@H](c1ccccc1)N)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1R,2R)-(-)-N-P-TOSYL-1,2-DIPHENYLETHYLENEDIAMINE, CAS:224454-16-4, Molecular Weight: 366.477, C21H22N2O2S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)N[C@@H]([C@H](N)C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-((1S,2S)-2-Amino-1,2-diphenylethyl)-4-methylbenzenesulfonamide, CAS:167316-27-0, Molecular Weight: 366.477, C21H22N2O2S, Purity:98, SMILES: Cc1ccc(cc1)S(=O)(=O)N[C@H]([C@@H](N)c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-[(1S,2S)-2-amino-1,2-diphenylethyl]-4-methylbenzenesulfonamide, CAS:224454-16-4, Molecular Weight: 366.477, C21H22N2O2S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)N[C@H]([C@@H](N)C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-((BenzyloxyCarbonyl-5-Phenyloctahydropyrrolo[3,4-C]Pyrrole-3A-Carboxylic Acid, CAS:0, Molecular Weight: 366.4104, C21H22N2O4, Purity:95, SMILES: OC(=O)C12CN(CC1CN(C2)C1=CC=CC=C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sancycline, CAS:808-26-4, Molecular Weight: 414.4086, C21H22N2O7, Purity:98, SMILES: O=C(C(C1=O)=C(O)[C@@H](N(C)C)[C@]2([H])C[C@]3([H])CC4=C(C(C3=C(O)[C@@]21O)=O)C(O)=CC=C4)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IQ-1, CAS:331001-62-8, Molecular Weight: 362.42498, C21H22N4O2, Purity:98, SMILES: CC(C1=CC=C(/N=N/C(C(N)=O)=C2NC(C)(C)CC3=CC=CC=C3/2)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RIP2 kinase inhibitor 1, CAS:1423186-80-4, Molecular Weight: 458.5538, C21H22N4O4S2, Purity:98, SMILES: CC(C)(C)S(C1=C(OCCO)C=C(N=CN=C2NC3=CC(N=CS4)=C4C=C3)C2=C1)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Alosetron ((Z)-2-butenedioate), CAS:122852-43-1, Molecular Weight: 410.4232, C21H22N4O5, Purity:98, SMILES: O=C(C(C1=C2C=CC=C1)=C(N2C)CC3)N3CC4=C(NC=N4)C.O=C(/C=C\C(O)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Raltitrexed, CAS:112887-68-0, Molecular Weight: 458.48758, C21H22N4O6S, Purity:98, SMILES: CC(NC1=O)=NC2=C1C=C(CN(C)C3=CC=C(C(N[C@H](C(O)=O)CCC(O)=O)=O)S3)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-04449913, CAS:1095173-27-5, Molecular Weight: 374.439, C21H22N6O, Purity:98, SMILES: O=C(NC1=CC=C(C#N)C=C1)N[C@H]2C[C@H](C3=NC4=CC=CC=C4N3)N(C)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| OSI-027, CAS:936890-98-1, Molecular Weight: 406.4378, C21H22N6O3, Purity:98, SMILES: O=C([C@H]1CC[C@H](C2=NC(C(N3)=CC4=C3C(OC)=CC=C4)=C5C(N)=NC=NN52)CC1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bavachinin, CAS:19879-30-2, Molecular Weight: 338.397, C21H22O4, Purity:98, SMILES: O=C1C[C@@H](C2=CC=C(O)C=C2)OC3=CC(OC)=C(C/C=C(C)\C)C=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Licochalcone A, CAS:58749-22-7, Molecular Weight: 338.397, C21H22O4, Purity:98, SMILES: O=C(C1=CC=C(O)C=C1)/C=C/C2=CC(C(C)(C)C=C)=C(O)C=C2OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Xanthohumol, CAS:6754-58-1, Molecular Weight: 354.3964, C21H22O5, Purity:98, SMILES: O=C(C1=C(OC)C=C(O)C(C/C=C(C)\C)=C1O)/C=C/C2=CC=C(O)C=C2.[(E)], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nobiletin, CAS:478-01-3, Molecular Weight: 402.3946, C21H22O8, Purity:98, SMILES: O=C1C=C(C2=CC=C(OC)C(OC)=C2)OC3=C(OC)C(OC)=C(OC)C(OC)=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Aloin, CAS:1415-73-2, Molecular Weight: 418.394, C21H22O9, Purity:98, SMILES: O=C1C2=C(C=CC=C2O)[C@H]([C@]3([H])O[C@H](CO)[C@@H](O)[C@H](O)[C@H]3O)C4=CC(CO)=CC(O)=C14, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Aloin B, CAS:28371-16-6, Molecular Weight: 418.394, C21H22O9, Purity:98, SMILES: O[C@H]([C@H]1O)[C@](O[C@H](CO)[C@H]1O)([H])[C@@](C2=CC=CC(O)=C23)([H])C(C=C(CO)C=C4O)=C4C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bromperidol, CAS:10457-90-6, Molecular Weight: 420.3152, C21H23BrFNO2, Purity:98, SMILES: O=C(C1=CC=C(F)C=C1)CCCN2CCC(O)(C3=CC=C(Br)C=C3)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RG3039, CAS:1005504-62-0, Molecular Weight: 432.34622, C21H23Cl2N5O, Purity:98, SMILES: NC1=NC(N)=C2C(OCC3CCN(CC4=C(Cl)C=CC=C4Cl)CC3)=CC=CC2=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NVP-BEP800, CAS:847559-80-2, Molecular Weight: 480.4106, C21H23Cl2N5O2S, Purity:98, SMILES: O=C(C1=CC2=C(N=C(N=C2S1)N)C3=CC(OCCN4CCCC4)=C(C=C3Cl)Cl)NCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clevidipine, CAS:167221-71-8, Molecular Weight: 456.3164, C21H23Cl2NO6, Purity:98, SMILES: O=C(C1=C(C)NC(C)=C(C(OCOC(CCC)=O)=O)C1C2=CC=CC(Cl)=C2Cl)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Crizotinib (hydrochloride), CAS:1415560-69-8, Molecular Weight: 486.7976, C21H23Cl3FN5O, Purity:98, SMILES: ClC1=C(F)C=CC(Cl)=C1[C@H](OC2=CC(C3=CN(N=C3)C4CCNCC4)=CN=C2N)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Haloperidol, CAS:52-86-8, Molecular Weight: 375.8642, C21H23ClFNO2, Purity:98, SMILES: ClC(C=C1)=CC=C1C2(O)CCN(CCCC(C3=CC=C(F)C=C3)=O)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CCT-251921, CAS:1607837-31-9, Molecular Weight: 410.8999, C21H23ClN6O, Purity:98, SMILES: O=C1NCCC12CCN(C3=C(Cl)C(N)=NC=C3C4=CC5=C(N(C)N=C5)C=C4)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzeneacetic acid, 4-chloro-2-[[4-(2-methoxyethoxy)phenoxy]methyl]-α-(methoxymethylene)-, methyl ester, (αE)-, CAS:872313-42-3, Molecular Weight: 406.85672, C21H23ClO6, Purity:98, SMILES: COC(/C(C1=C(C=C(Cl)C=C1)COC2=CC=C(OCCOC)C=C2)=C/OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methylnaltrexone D3 (Bromide), CAS:, Molecular Weight: 439.3579, C21H23D3BrNO4, Purity:98, SMILES: OC1=C(O[C@H]2C3=O)C([C@]2(CC[N@@+]4(C([2H])([2H])[2H])CC5CC5)[C@](CC3)(O)[C@H]4C6)=C6C=C1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cetirizine (D4 dihydrochloride), CAS:, Molecular Weight: 465.8343, C21H23D4Cl3N2O3, Purity:98, SMILES: ClC1=CC=C(C(N2CCN(C([2H])([2H])C([2H])([2H])OCC(O)=O)CC2)C3=CC=CC=C3)C=C1.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Hydroxy Propafenone (D5 Hydrochloride), CAS:1215370-87-8, Molecular Weight: 398.9351, C21H23D5ClNO4, Purity:98, SMILES: OC1=CC(C(CCC2=CC=CC=C2)=O)=C(OC([2H])([2H])C([2H])(O)C([2H])([2H])NCCC)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Doxylamine (D5 succinate), CAS:1216840-94-6, Molecular Weight: 393.4882, C21H23D5N2O5, Purity:98, SMILES: CC(C1=C([2H])C([2H])=C([2H])C([2H])=C1[2H])(OCCN(C)C)C2=CC=CC=N2.OC(CCC(O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-iodo-4-methyl-N-(4-((4-methylpiperazin-1-yl)methyl)-3-(trifluoromethyl)phenyl)benzamide, CAS:943320-50-1, Molecular Weight: 517.3265, C21H23F3IN3O, Purity:95, SMILES: CN1CCN(Cc2ccc(NC(=O)c3ccc(C)c(I)c3)cc2C(F)(F)F)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| E3 ligase Ligand-Linker Conjugates 16, CAS:1799711-25-3, Molecular Weight: 516.4245296, C21H23F3N4O8, Purity:98, SMILES: NCCCCNC(COC1=C(C(N2C(CCC3=O)C(N3)=O)=O)C(C2=O)=CC=C1)=O.FC(F)(F)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CC-930, CAS:899805-25-5, Molecular Weight: 448.4415, C21H23F3N6O2, Purity:98, SMILES: O[C@H]1CC[C@H](NC2=NC=C3N=C(NC4=C(F)C=C(F)C=C4F)N([C@@H]5COCC5)C3=N2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Telomerase-IN-1, CAS:666859-49-0, Molecular Weight: 386.4167232, C21H23FN2O4, Purity:98, SMILES: O=C(C1=CC=C(F)C=C1)C2CCN(CC(OC)C3=CC=C([N+]([O-])=O)C=C3)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(3,5-Dimethylphenyl-5-Isobutylquinoline, CAS:1404491-67-3, Molecular Weight: 289.414, C21H23N, Purity:95, SMILES: CC(C)CC1=C2C=CC(=NC2=CC=C1)C1=CC(C)=CC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nafcillin (sodium monohydrate), CAS:7177-50-6, Molecular Weight: 454.4719, C21H23N2NaO6S, Purity:98, SMILES: [O-]C([C@@H]1N(C2=O)[C@]([C@@H]2NC(C(C3=CC=CC=C3C=C4)=C4OCC)=O)([H])SC1(C)C)=O.[Na+].O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MDA 19, CAS:1048973-47-2, Molecular Weight: 349.4262, C21H23N3O2, Purity:98, SMILES: O=C(N/N=C1C(N(CCCCCC)C2=C\1C=CC=C2)=O)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML324, CAS:1222800-79-4, Molecular Weight: 349.4262, C21H23N3O2, Purity:98, SMILES: O=C(NCCCN(C)C)C1=CC=C(C2=CC(O)=C3N=CC=CC3=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Panobinostat, CAS:404950-80-7, Molecular Weight: 349.4262, C21H23N3O2, Purity:98, SMILES: O=C(/C=C/C1=CC=C(CNCCC2=C(NC3=C2C=CC=C3)C)C=C1)NO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Obatoclax, CAS:803712-79-0, Molecular Weight: 413.49, C21H23N3O4S, Purity:98, SMILES: COC1=CC(C2=CC3=C(C=CC=C3)N2)=N/C1=C\C4=C(C=C(N4)C)C.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Cit-OH, CAS:133174-15-9, Molecular Weight: 397.4244, C21H23N3O5, Purity:98, SMILES: NC(=O)NCCC[C@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PCI-24781, CAS:783355-60-2, Molecular Weight: 397.4244, C21H23N3O5, Purity:98, SMILES: O=C(NCCOC1=CC=C(C=C1)C(NO)=O)C2=C(C3=CC=CC=C3O2)CN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SCH 527123, CAS:473727-83-2, Molecular Weight: 397.4244, C21H23N3O5, Purity:98, SMILES: O=C1C(C(NC2=CC=CC(C(N(C)C)=O)=C2O)=C1N[C@H](CC)C3=CC=C(O3)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GLPG0634, CAS:1206161-97-8, Molecular Weight: 425.504, C21H23N5O3S, Purity:98, SMILES: O=C(C1CC1)NC2=NN3C(C4=CC=C(CN5CCS(CC5)(=O)=O)C=C4)=CC=CC3=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD3264, CAS:1609281-86-8, Molecular Weight: 441.5034, C21H23N5O4S, Purity:98, SMILES: O=C(C1=C(NC(N)=O)SC(C2=CC=C(C3=C(C)ON=C3C)C=C2O[C@@H]4CNCC4)=C1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Talarozole, CAS:201410-53-9, Molecular Weight: 377.5058, C21H23N5S, Purity:98, SMILES: CCC(CC)C(C1=CC=C(NC2=NC3=CC=CC=C3S2)C=C1)N4N=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Talarozole (R enantiomer), CAS:870093-23-5, Molecular Weight: 377.5058, C21H23N5S, Purity:98, SMILES: CCC(CC)[C@H](C1=CC=C(NC2=NC3=CC=CC=C3S2)C=C1)N4N=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pazopanib, CAS:444731-52-6, Molecular Weight: 437.518, C21H23N7O2S, Purity:98, SMILES: O=S(C1=CC(NC2=NC=CC(N(C3=CC4=NN(C(C)=C4C=C3)C)C)=N2)=CC=C1C)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD2858, CAS:486424-20-8, Molecular Weight: 453.5174, C21H23N7O3S, Purity:98, SMILES: O=C(C1=NC(C2=CC=C(S(=O)(N3CCN(C)CC3)=O)C=C2)=CN=C1N)NC4=CC=CN=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7-METHOXY-SPIRO[CHROMAN-2,4-(1-BenzylPIPERIDIN)]-4-ONE, CAS:868361-89-1, Molecular Weight: 337.4122, C21H23NO3, Purity:95, SMILES: COC1=CC2=C(C=C1)C(=O)CC1(CCN(CC3=CC=CC=C3)CC1)O2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AMG9810, CAS:545395-94-6, Molecular Weight: 337.41222, C21H23NO3, Purity:98, SMILES: O=C(NC1=CC=C(OCCO2)C2=C1)/C=C/C3=CC=C(C(C)(C)C)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2R,3S)-tert-Butyl 6-oxo-2,3-diphenylmorpholine-4-carboxylate, CAS:112741-49-8, Molecular Weight: 353.4116, C21H23NO4, Purity:95, SMILES: O=C1CN(C(=O)OC(C)(C)C)[C@H]([C@H](O1)c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2S,3R)-tert-Butyl 6-oxo-2,3-diphenylmorpholine-4-carboxylate, CAS:112741-50-1, Molecular Weight: 353.4116, C21H23NO4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC(=O)O[C@H]([C@H]1c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-2,3-dimethylbutanoic acid, CAS:169566-81-8, Molecular Weight: 353.4116, C21H23NO4, Purity:95, SMILES: CC(C)[C@](C)(NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-ε-Acp-OH, CAS:88574-06-5, Molecular Weight: 353.4116, C21H23NO4, Purity:98, SMILES: OC(=O)CCCCCNC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-D-Leu-OH, CAS:114360-54-2, Molecular Weight: 353.4116, C21H23NO4, Purity:95, SMILES: CC(C)C[C@@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-L-beta-homovaline, CAS:172695-33-9, Molecular Weight: 353.4116, C21H23NO4, Purity:95, SMILES: CC(C)[C@@H](CC(O)=O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-N-Me-D-Nva-OH, CAS:35661-60-0, Molecular Weight: 353.4116, C21H23NO4, Purity:98, SMILES: CC(C)C[C@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-N-Me-Val-OH, CAS:84000-11-3, Molecular Weight: 353.4116, C21H23NO4, Purity:98, SMILES: CC(C)[C@H](N(C)C(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Tle-OH, CAS:132684-60-7, Molecular Weight: 353.4116, C21H23NO4, Purity:95, SMILES: CC(C)(C)[C@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Fmoc-L-norleucine, CAS:77284-32-3, Molecular Weight: 353.4116, C21H23NO4, Purity:95, SMILES: CCCC[C@H](NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Racecadotril, CAS:81110-73-8, Molecular Weight: 385.4766, C21H23NO4S, Purity:98, SMILES: O=C(OCC1=CC=CC=C1)CNC(C(CSC(C)=O)CC2=CC=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-(2R,3S)-2-amino-3-hydroxy-4-methylpentanoic acid, CAS:1217833-77-6, Molecular Weight: 369.411, C21H23NO5, Purity:95, SMILES: CC(C)[C@@H](O)[C@H](NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(9H-fluoren-9-yl)-3-oxo-2,7,10-trioxa-4-azadodecan-12-oic acid, CAS:166108-71-0, Molecular Weight: 385.4104, C21H23NO6, Purity:95, SMILES: OC(=O)COCCOCCNC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Toluene-4-sulfonyl)-1H-indole-3-boronic acid pinacol ester, CAS:1073354-51-4, Molecular Weight: 397.296, C21H24BNO4S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)n1cc(c2c1cccc2)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Toluene-4-Sulfonyl-1H-Indole-3-Boronic Acid Pinacol Ester, CAS:1073354-51-4, Molecular Weight: 397.296, C21H24BNO4S, Purity:95, SMILES: CC1=CC=C(C=C1)S(=O)(=O)N1C=C(B2OC(C)(C)C(C)(C)O2)C2=C1C=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Haloperidol (hydrochloride), CAS:1511-16-6, Molecular Weight: 412.3252, C21H24Cl2FNO2, Purity:98, SMILES: ClC(C=C1)=CC=C1C2(O)CCN(CCCC(C3=CC=C(F)C=C3)=O)CC2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ziprasidone (hydrochloride monohydrate), CAS:138982-67-9, Molecular Weight: 467.4119, C21H24Cl2N4O2S, Purity:98, SMILES: O=C1CC2=CC(CCN3CCN(C4=NSC5=C4C=CC=C5)CC3)=C(Cl)C=C2N1.[H]Cl.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Spirodiclofen, CAS:148477-71-8, Molecular Weight: 411.3188, C21H24Cl2O4, Purity:98, SMILES: CCC(C)(C)C(OC1=C(C2=CC=C(Cl)C=C2Cl)C(OC13CCCCC3)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SAR7334 (hydrochloride), CAS:1333207-63-8, Molecular Weight: 440.79376, C21H24Cl3N3O, Purity:98, SMILES: N[C@@H](C1)CCCN1[C@@H]2CC3=CC=CC=C3[C@H]2OC4=CC=C(C#N)C=C4Cl.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BX471, CAS:217645-70-0, Molecular Weight: 434.8917, C21H24ClFN4O3, Purity:98, SMILES: O=C(N)NC1=CC(Cl)=CC=C1OCC(N2[C@H](C)CN(CC3=CC=C(F)C=C3)CC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lenampicillin (hydrochloride), CAS:80734-02-7, Molecular Weight: 497.9492, C21H24ClN3O7S, Purity:98, SMILES: O=C([C@@H]1N(C2=O)[C@]([C@@H]2NC([C@@H](C3=CC=CC=C3)N)=O)([H])SC1(C)C)OCC(OC4=O)=C(O4)C.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vps34-IN-1, CAS:1383716-33-3, Molecular Weight: 425.9146, C21H24ClN7O, Purity:98, SMILES: CC(C)(O)CNC1=NC=C(C2=CC=NC(NC3=CC=NC(Cl)=C3)=N2)C(CC4CC4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pazopanib (Hydrochloride), CAS:635702-64-6, Molecular Weight: 473.979, C21H24ClN7O2S, Purity:98, SMILES: CC1=CC=C(C=C1S(N)(=O)=O)NC2=NC=CC(N(C3=CC4=NN(C(C)=C4C=C3)C)C)=N2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dapoxetine (hydrochloride), CAS:129938-20-1, Molecular Weight: 341.8744, C21H24ClNO, Purity:98, SMILES: CN(C)[C@H](C1=CC=CC=C1)CCOC2=C3C(C=CC=C3)=CC=C2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Olopatadine (hydrochloride), CAS:140462-76-6, Molecular Weight: 373.8732, C21H24ClNO3, Purity:98, SMILES: O=C(O)CC1=CC=C(C/2=C1)OCC3=CC=CC=C3C2=C\CCN(C)C.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LCB-2853, CAS:141335-10-6, Molecular Weight: 421.93756, C21H24ClNO4S, Purity:98, SMILES: O=C(O)CC1=CC=C(CC2(CNS(=O)(C3=CC=C(Cl)C=C3)=O)CCCC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LOXO-101 (sulfate), CAS:1223405-08-0, Molecular Weight: 526.5137, C21H24F2N6O6S, Purity:98, SMILES: O=S(O)(O)=O.O=C(N1CC[C@H](O)C1)NC2=C3N=C(N4[C@@H](C5=CC(F)=CC=C5F)CCC4)C=CN3N=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD3965, CAS:1448671-31-5, Molecular Weight: 515.506, C21H24F3N5O5S, Purity:98, SMILES: O=C1N(C(C)C)C2=C(C(C(N3OC[C@@](C)(O)C3)=O)=C(CC4=C(C)NN=C4C(F)(F)F)S2)C(N1C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK2256294A, CAS:1142090-23-0, Molecular Weight: 447.4568, C21H24F3N7O, Purity:98, SMILES: O=C([C@H]1C[C@@H](NC2=NC(NC)=NC(C)=N2)CCC1)NCC3=CC=C(C#N)C=C3C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WNK463, CAS:2012607-27-9, Molecular Weight: 463.4562, C21H24F3N7O2, Purity:98, SMILES: FC(F)(F)C1=NN=C(O1)C2=CN=C(N3CCC(N4C=NC=C4C(NC(C)(C)C)=O)CC3)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Moxifloxacin, CAS:151096-09-2, Molecular Weight: 401.4314, C21H24FN3O4, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N(C4)C[C@]5([H])[C@@]4([H])CCCN5)=C3OC)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| APD668, CAS:832714-46-2, Molecular Weight: 477.5091632, C21H24FN5O5S, Purity:98, SMILES: O=C(OC(C)C)N(CC1)CCC1OC2=C3C(N(C4=CC=C(S(=O)(C)=O)C=C4F)N=C3)=NC=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AR 231453, CAS:733750-99-7, Molecular Weight: 505.5225632, C21H24FN7O5S, Purity:98, SMILES: CC(C)C1=NOC(C2CCN(C3=NC=NC(NC4=CC=C(S(=O)(C)=O)C=C4F)=C3[N+]([O-])=O)CC2)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzyl 5-Methylspiro[Indoline-3,4'-Piperidine]-1'-Carboxylate, CAS:1160247-23-3, Molecular Weight: 336.4275, C21H24N2O2, Purity:95, SMILES: CC1=CC2=C(NCC22CCN(CC2)C(=O)OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Catharanthine, CAS:2468-21-5, Molecular Weight: 336.4275, C21H24N2O2, Purity:98, SMILES: O=C([C@@]12C3=C(CC[N@](C4)[C@]1([H])C(CC)=C[C@@]4([H])C2)C5=CC=CC=C5N3)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (1-Benzyl-4-cyanopiperidin-4-yl)methyl 4-methylbenzenesulfonate, CAS:270257-39-1, Molecular Weight: 384.492, C21H24N2O3S, Purity:90, SMILES: N#CC1(CCN(CC1)Cc1ccccc1)COS(=O)(=O)c1ccc(cc1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| H-Lys(Fmoc)-OH, CAS:84624-28-2, Molecular Weight: 368.4263, C21H24N2O4, Purity:98, SMILES: [H][C@](N)(CCCCNC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Intoplicine, CAS:125974-72-3, Molecular Weight: 348.44146, C21H24N4O, Purity:98, SMILES: OC1=CC=C2C3=C(NC4=C3C(NCCCN(C)C)=NC=C4C)C=CC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TGX-221, CAS:663619-89-4, Molecular Weight: 364.4409, C21H24N4O2, Purity:98, SMILES: O=C1N2C(C(C(NC3=CC=CC=C3)C)=CC(C)=C2)=NC(N4CCOCC4)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mirabegron, CAS:223673-61-8, Molecular Weight: 396.5059, C21H24N4O2S, Purity:98, SMILES: O=C(NC1=CC=C(CCNC[C@H](O)C2=CC=CC=C2)C=C1)CC3=CSC(N)=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PFI-4, CAS:900305-37-5, Molecular Weight: 380.4402, C21H24N4O3, Purity:98, SMILES: O=C(NC1=C(N2CCCC2)C=C(N3C)C(N(C)C3=O)=C1)C4=CC=CC=C4OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZ20, CAS:1233339-22-4, Molecular Weight: 412.5052, C21H24N4O3S, Purity:98, SMILES: O=S(C1(C2=CC(N3[C@H](C)COCC3)=NC(C4=CC=CC5=C4C=CN5)=N2)CC1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-04620110, CAS:1109276-89-2, Molecular Weight: 396.4397, C21H24N4O4, Purity:98, SMILES: O=C(C[C@@H]1CC[C@H](CC1)C2=CC=C(C=C2)N3CCOC4=NC=NC(N)=C4C3=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mezlocillin (sodium), CAS:42057-22-7, Molecular Weight: 561.5637, C21H24N5NaO8S2, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC([C@H](NC(N3CCN(S(=O)(C)=O)C3=O)=O)C4=CC=CC=C4)=O)N1C2=O)[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Purine-2,6-dione, 3,9-dihydro-8-[1-(phenylmethyl)-1H-pyrazol-4-yl]-1,3-dipropyl-, CAS:531506-36-2, Molecular Weight: 392.45426, C21H24N6O2, Purity:98, SMILES: O=C(N1CCC)N(CCC)C2=C(NC(C3=CN(CC4=CC=CC=C4)N=C3)=N2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rigosertib (sodium), CAS:592542-60-4, Molecular Weight: 473.4719, C21H24NNaO8S, Purity:98, SMILES: COC1=CC=C(C=C1NCC([O-])=O)CS(/C=C/C2=C(C=C(C=C2OC)OC)OC)(=O)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phloridzin, CAS:60-81-1, Molecular Weight: 436.4093, C21H24O10, Purity:98, SMILES: OC[C@H]1O[C@@H](Oc2cc(O)cc(O)c2C(=O)CCc2ccc(O)cc2)[C@H](O)[C@@H](O)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phlorizin, CAS:60-81-1, Molecular Weight: 436.4093, C21H24O10, Purity:98, SMILES: O=C(C1=C(O)C=C(O)C=C1O[C@H]2[C@@H]([C@H]([C@@H]([C@@H](CO)O2)O)O)O)CCC3=CC=C(O)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,2'-((propane-2,2-diylbis(4,1-phenylene))bis(methylene))bis(oxirane), CAS:3530-44-7, Molecular Weight: 308.4141, C21H24O2, Purity:95, SMILES: CC(C)(c1ccc(CC2CO2)cc1)c1ccc(CC2CO2)cc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gestrinone, CAS:16320-04-0, Molecular Weight: 308.41406, C21H24O2, Purity:98, SMILES: C#C[C@]1(O)CC[C@@]2([H])[C@]3([H])CCC4=CC(CCC4=C3C=C[C@]12CC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Arctigenin, CAS:7770-78-7, Molecular Weight: 372.4117, C21H24O6, Purity:98, SMILES: O=C1OC[C@H](CC2=CC=C(OC)C(OC)=C2)[C@H]1CC3=CC=C(O)C(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phillygenin, CAS:487-39-8, Molecular Weight: 372.4117, C21H24O6, Purity:98, SMILES: OC1=CC=C([C@H]2OC[C@@]3([H])[C@]2([H])CO[C@H]3C4=CC=C(OC)C(OC)=C4)C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetrahydrocurcumin, CAS:36062-04-1, Molecular Weight: 372.4117, C21H24O6, Purity:98, SMILES: O=C(CC(CCC1=CC=C(O)C(OC)=C1)=O)CCC2=CC=C(O)C(OC)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1-tosyl-1H-pyrrolo[2,3-c]pyridin-7(6H)-one, CAS:1445993-89-4, Molecular Weight: 428.31, C21H25BN2O5S, Purity:95, SMILES: Cc1ccc(cc1)S(=O)(=O)n1ccc2c(cn(C)c(=O)c12)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BX471 (hydrochloride), CAS:288262-96-4, Molecular Weight: 471.3526, C21H25Cl2FN4O3, Purity:98, SMILES: O=C(N)NC1=CC(Cl)=CC=C1OCC(N2[C@H](C)CN(CC3=CC=C(F)C=C3)CC2)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DG051, CAS:929915-58-2, Molecular Weight: 426.3335, C21H25Cl2NO4, Purity:98, SMILES: Cl[H].O=C(O)CCCN1CCC[C@H]1COC(C=C2)=CC=C2OC3=CC=C(Cl)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mosapride, CAS:112885-41-3, Molecular Weight: 421.8929, C21H25ClFN3O3, Purity:98, SMILES: O=C(NCC1CN(CC2=CC=C(F)C=C2)CCO1)C3=CC(Cl)=C(N)C=C3OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Moxifloxacin (Hydrochloride), CAS:186826-86-8, Molecular Weight: 437.8923, C21H25ClFN3O4, Purity:98, SMILES: O=C(C1=CN(C2CC2)C3=C(C=C(F)C(N(C4)C[C@]5([H])[C@@]4([H])CCCN5)=C3OC)C1=O)O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Moxifloxacin hydrochloride, CAS:186826-86-8, Molecular Weight: 437.892, C21H25ClFN3O4, Purity:98, SMILES: Cl.[H][C@]12CN(C[C@@]1([H])NCCC2)c1c(F)cc2c(c1OC)n(cc(C(O)=O)c2=O)C1CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cetirizine, CAS:83881-51-0, Molecular Weight: 388.8878, C21H25ClN2O3, Purity:98, SMILES: O=C(O)COCCN1CCN(C(C2=CC=C(Cl)C=C2)C3=CC=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
ACHP (Hydrochloride
), CAS:406209-26-5, Molecular Weight: 400.9018, C21H25ClN4O2, Purity:98, SMILES: N#CC1=C(C=C(N=C1N)C2=C(C=CC=C2OCC3CC3)O)C4CCNCC4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD5363, CAS:1143532-39-1, Molecular Weight: 428.9152, C21H25ClN6O2, Purity:98, SMILES: O=C(C1(N)CCN(C2=C3C(NC=C3)=NC=N2)CC1)N[C@H](C4=CC=C(Cl)C=C4)CCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LX-4211, CAS:1018899-04-1, Molecular Weight: 424.9382, C21H25ClO5S, Purity:98, SMILES: ClC(C=CC([C@@H]1O[C@H](SC)[C@@H](O)[C@H](O)[C@H]1O)=C2)=C2CC3=CC=C(OCC)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dapagliflozin, CAS:461432-26-8, Molecular Weight: 408.8726, C21H25ClO6, Purity:98, SMILES: O[C@H]1[C@H](C2=CC(CC3=CC=C(OCC)C=C3)=C(Cl)C=C2)O[C@H](CO)[C@@H](O)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hydroxyzine (D4 dihydrochloride), CAS:, Molecular Weight: 451.8508, C21H25D4Cl3N2O2, Purity:98, SMILES: ClC1=CC=C(C=C1)C(C2=CC=CC=C2)N3CCN(C([2H])([2H])C([2H])([2H])OCCO)CC3.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PQR620, CAS:, Molecular Weight: 445.4657, C21H25F2N7O2, Purity:98, SMILES: [H][C@]1(CC[C@]([H])2COC1)N2C3=NC(N4[C@]5([H])CC[C@]([H])4COC5)=NC(C6=CN=C(N)C=C6C(F)F)=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Leniolisib, CAS:1354690-24-6, Molecular Weight: 450.4574, C21H25F3N6O2, Purity:98, SMILES: CCC(N1C[C@@H](NC2=C(CN(C3=CC(C(F)(F)F)=C(OC)N=C3)CC4)C4=NC=N2)CC1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-4-(3-phenylpropyl)-1,2,3,6-tetrahydropyridine, CAS:70152-27-1, Molecular Weight: 291.4299, C21H25N, Purity:95, SMILES: C(CC1=CCN(CC2=CC=CC=C2)CC1)CC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-benzyl-4-(3-Phenylpropyl)-1,2,3,6-tetrahydropyridine, CAS:70152-27-1, Molecular Weight: 291.4299, C21H25N, Purity:95, SMILES: c1ccc(cc1)CCCC1=CCN(CC1)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Terbinafine, CAS:91161-71-6, Molecular Weight: 291.4299, C21H25N, Purity:98, SMILES: CN(C/C=C/C#CC(C)(C)C)CC1=C2C=CC=CC2=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK189254A, CAS:720690-73-3, Molecular Weight: 351.4421, C21H25N3O2, Purity:98, SMILES: O=C(NC)C(C=N1)=CC=C1OC2=CC(CC3)=C(C=C2)CCN3C4CCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Quetiapine, CAS:111974-69-7, Molecular Weight: 383.5071, C21H25N3O2S, Purity:98, SMILES: OCCOCCN(CC1)CCN1C2=NC3=CC=CC=C3SC4=C2C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD7687, CAS:1166827-44-6, Molecular Weight: 367.4415, C21H25N3O3, Purity:98, SMILES: CC1=C(C(N)=O)N=C(C2=CC=C([C@H]3CC[C@H](CC(O)=O)CC3)C=C2)C(C)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Soraprazan, CAS:261944-46-1, Molecular Weight: 367.4415, C21H25N3O3, Purity:98, SMILES: O[C@@H]1[C@@H](C2=CC=CC=C2)NC3=C(C=CN4C3=NC(C)=C4C)[C@H]1OCCOC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Quetiapine metabolite Quetiapine sulfoxide, CAS:329216-63-9, Molecular Weight: 399.5065, C21H25N3O3S, Purity:98, SMILES: OCCOCCN(CC1)CCN1C2=NC(C=CC=C3)=C3S(C4=C2C=CC=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WDR5-0103, CAS:890190-22-4, Molecular Weight: 383.4409, C21H25N3O4, Purity:98, SMILES: O=C(OC)C1=CC=C(N2CCN(C)CC2)C(NC(C3=CC=CC(OC)=C3)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,5-Benzothiazepin-4(5H)-one, 2,3-dihydro-3-[(4-methyl-1-piperazinyl)methyl]-2-phenyl-, (2R,3S)-rel-, CAS:72293-17-5, Molecular Weight: 367.5077, C21H25N3OS, Purity:98, SMILES: O=C1[C@H](CN2CCN(C)CC2)[C@H](C3=CC=CC=C3)SC4=CC=CC=C4N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MLi-2, CAS:1627091-47-7, Molecular Weight: 379.4555, C21H25N5O2, Purity:98, SMILES: C[C@@](C1)([H])O[C@](C)([H])CN1C2=CC(C3=NNC4=CC=C(OC5(C)CC5)C=C43)=NC=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MLN4924, CAS:905579-51-3, Molecular Weight: 443.5193, C21H25N5O4S, Purity:98, SMILES: O=S(OC[C@@H]1C[C@@H](N2C3=NC=NC(N[C@H]4CCC5=C4C=CC=C5)=C3C=C2)C[C@@H]1O)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nafamostat (mesylate), CAS:82956-11-4, Molecular Weight: 539.5819, C21H25N5O8S2, Purity:98, SMILES: CS(=O)(O)=O.O=C(OC1=CC=C2C=C(C(N)=N)C=CC2=C1)C3=CC=C(NC(N)=N)C=C3.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ENMD-2076, CAS:934353-76-1, Molecular Weight: 375.4701, C21H25N7, Purity:98, SMILES: CC1=CC(NC2=NC(/C=C/C3=CC=CC=C3)=NC(N4CCN(CC4)C)=C2)=NN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acitretin (sodium), CAS:925701-88-8, Molecular Weight: 348.4112, C21H25NaO3, Purity:98, SMILES: [O-]C(/C=C(C)/C=C/C=C(C)/C=C/C(C(C)=CC(OC)=C1C)=C1C)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Piperidolate, CAS:82-98-4, Molecular Weight: 323.4287, C21H25NO2, Purity:98, SMILES: O=C(OC1CN(CC)CCC1)C(C2=CC=CC=C2)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetrahydropalmatine, CAS:2934-97-6, Molecular Weight: 355.4275, C21H25NO4, Purity:98, SMILES: COC1=CC=C2C(CN3CCC4=CC(OC)=C(OC)C=C4C3C2)=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 2-(N-(4-ethoxy-4-oxobutyl-4-methylphenylsulfonamidobenzoate, CAS:100627-39-2, Molecular Weight: 419.491, C21H25NO6S, Purity:95, SMILES: CCOC(=O)CCCN(C1=CC=CC=C1C(=O)OC)S(=O)(=O)C1=CC=C(C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rigosertib, CAS:592542-59-1, Molecular Weight: 451.4901, C21H25NO8S, Purity:98, SMILES: O=S(/C=C/C(C(OC)=C1)=C(OC)C=C1OC)(CC2=CC=C(OC)C(NCC(O)=O)=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2,7-Di-tert-butylfluorene, CAS:58775-05-6, Molecular Weight: 278.4311, C21H26, Purity:95, SMILES: CC(C)(C)C1=CC=C2C(CC3=CC(=CC=C23)C(C)(C)C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mepenzolate (Bromide), CAS:76-90-4, Molecular Weight: 420.34, C21H26BrNO3, Purity:98, SMILES: C[N+]1(C)CC(OC(C(C2=CC=CC=C2)(O)C3=CC=CC=C3)=O)CCC1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methylnaltrexone (Bromide), CAS:73232-52-7, Molecular Weight: 436.3394, C21H26BrNO4, Purity:98, SMILES: OC1=C(O[C@H]2C3=O)C([C@]2(CC[N@@+]4(C)CC5CC5)[C@](CC3)(O)[C@H]4C6)=C6C=C1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trifluoperazine (dihydrochloride), CAS:440-17-5, Molecular Weight: 480.4174, C21H26Cl2F3N3S, Purity:98, SMILES: FC(C(C=C1N2CCCN3CCN(C)CC3)=CC=C1SC4=C2C=CC=C4)(F)F.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clofoctol, CAS:37693-01-9, Molecular Weight: 365.3365, C21H26Cl2O, Purity:98, SMILES: OC1=CC=C(C(C)(C)CC(C)(C)C)C=C1CC2=CC=C(Cl)C=C2Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Terbinafine hydrochloride, CAS:78628-80-5, Molecular Weight: 327.8908, C21H26ClN, Purity:98, SMILES: CN(C/C([H])=C([H])/C#CC(C)(C)C)CC1=CC=CC2=CC=CC=C21.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Perphenazine, CAS:58-39-9, Molecular Weight: 403.9686, C21H26ClN3OS, Purity:98, SMILES: OCCN1CCN(CCCN2C3=C(C=CC=C3)SC4=CC=C(Cl)C=C24)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MLN4924 (hydrochloride), CAS:1160295-21-5, Molecular Weight: 479.9803, C21H26ClN5O4S, Purity:98, SMILES: O=S(OC[C@H]1[C@H](C[C@@H](C1)N2C=CC3=C(N=CN=C32)N[C@H]4CCC5=C4C=CC=C5)O)(N)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Piperidolate (hydrochloride), CAS:129-77-1, Molecular Weight: 359.8896, C21H26ClNO2, Purity:98, SMILES: O=C(OC1CN(CC)CCC1)C(C2=CC=CC=C2)C3=CC=CC=C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vincamine, CAS:1617-90-9, Molecular Weight: 354.4427, C21H26N2O3, Purity:98, SMILES: O=C(OC)[C@@]1(O)C[C@@]2(CC)[C@@]3([H])C(N1C4=CC=CC=C54)=C5CCN3CCC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Yohimbine, CAS:146-48-5, Molecular Weight: 354.4427, C21H26N2O3, Purity:98, SMILES: [H][C@]12C(NC3=C4C=CC=C3)=C4CCN1C[C@@]5(CC[C@H](O)[C@H](C(OC)=O)[C@]5(C2)[H])[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-epsilon-Benzyloxycarbonyl-L-lysine benzyl ester hydrochloride, CAS:6366-70-7, Molecular Weight: 370.4421, C21H26N2O4, Purity:97, SMILES: O=C(OCc1ccccc1)NCCCC[C@@H](C(=O)OCc1ccccc1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Olodaterol, CAS:868049-49-4, Molecular Weight: 386.4415, C21H26N2O5, Purity:98, SMILES: O=C1NC2=CC(O)=CC([C@@H](O)CNC(C)(C)CC3=CC=C(OC)C=C3)=C2OC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3S,4S)-benzyl 3-amino-4-(hydroxymethyl)pyrrolidine-1-carboxylate (S)-2-hydroxy-2-phenylacetate, CAS:, Molecular Weight: 402.4409, C21H26N2O6, Purity:95, SMILES: O=C(N1C[C@@H](N)[C@@H](COC([C@@H](O)C2=CC=CC=C2)=O)C1)OCC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ombrabulin, CAS:181816-48-8, Molecular Weight: 402.4409, C21H26N2O6, Purity:98, SMILES: O=C(NC1=CC(/C=C\C2=CC(OC)=C(OC)C(OC)=C2)=CC=C1OC)[C@@H](N)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SA72, CAS:934809-60-6, Molecular Weight: 402.44094, C21H26N2O6, Purity:98, SMILES: O=C(OCC(N)=O)NCCCC1OCC(C2=C3C=CC(OC)=CC3=CC=C2)CO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nimodipine, CAS:66085-59-4, Molecular Weight: 418.44034, C21H26N2O7, Purity:98, SMILES: O=C(C1=C(C)NC(C)=C(C(OC(C)C)=O)C1C2=CC=CC([N+]([O-])=O)=C2)OCCOC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diethyl 2-Acetamido-2-(4-(1,3-Dioxoisoindolin-2-Yl-3-HydroxybutylMalonate, CAS:64442-12-2, Molecular Weight: 434.4397, C21H26N2O8, Purity:95, SMILES: CCOC(=O)C(CCC(O)CN1C(=O)C2=CC=CC=C2C1=O)(NC(C)=O)C(=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD0865, CAS:248919-64-4, Molecular Weight: 366.4567, C21H26N4O2, Purity:98, SMILES: O=C(C1=CN2C(C(NCC3=C(C)C=CC=C3C)=C1)=NC(C)=C2C)NCCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Camostat (mesylate), CAS:59721-29-8, Molecular Weight: 494.5181, C21H26N4O8S, Purity:98, SMILES: O=C(OCC(N(C)C)=O)CC1=CC=C(OC(C2=CC=C(NC(N)=N)C=C2)=O)C=C1.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Quisinostat, CAS:875320-29-9, Molecular Weight: 394.4702, C21H26N6O2, Purity:98, SMILES: O=C(C1=CN=C(N2CCC(CNCC3=CN(C)C4=C3C=CC=C4)CC2)N=C1)NO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NADPH (tetrasodium salt), CAS:2646-71-1, Molecular Weight: 833.3482, C21H26N7Na4O17P3, Purity:98, SMILES: [O-]P(OP([O-])(OC[C@@H]1[C@@H](O)[C@@H](OP([O-])([O-])=O)[C@H](N2C3=NC=NC(N)=C3N=C2)O1)=O)(OC[C@@H]4[C@@H](O)[C@@H](O)[C@H](N5C=C(C(N)=O)CC=C5)O4)=O.[Na+].[Na+].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| KHK-IN-1, CAS:1303469-70-6, Molecular Weight: 422.5497, C21H26N8S, Purity:98, SMILES: CSC(C=CC=C1)=C1NC2=NC(N3CCNCC3)=NC4=C2N=CN=C4NCC5CC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Altrenogest, CAS:850-52-2, Molecular Weight: 310.4299, C21H26O2, Purity:98, SMILES: C[C@]([C@]1(O)CC=C)(C=C2)[C@](CC1)([H])[C@@](CC3)([H])C2=C(CC4)C3=CC4=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gestodene, CAS:60282-87-3, Molecular Weight: 310.4299, C21H26O2, Purity:98, SMILES: CC[C@@]1([C@]2(O)C#C)[C@](C=C2)([H])[C@@](CCC3=CC4=O)([H])[C@]([C@@]3([H])CC4)([H])CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mestranol, CAS:72-33-3, Molecular Weight: 310.4299, C21H26O2, Purity:98, SMILES: C[C@@]1([C@]2(O)C#C)[C@](CC2)([H])[C@@](CCC3=C4C=CC(OC)=C3)([H])[C@]4([H])CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acitretin, CAS:55079-83-9, Molecular Weight: 326.4294, C21H26O3, Purity:98, SMILES: CC(/C=C/C(C(C)=CC(OC)=C1C)=C1C)=C\C=C\C(C)=C\C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Buparvaquone, CAS:88426-33-9, Molecular Weight: 326.4294, C21H26O3, Purity:98, SMILES: O=C1C(CC2CCC(C(C)(C)C)CC2)=C(O)C(C3=C1C=CC=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-5-(((Tert-ButyldiphenylsilylOxyMethylDihydrofuran-2(3H-One, CAS:0, Molecular Weight: 354.5148, C21H26O3Si, Purity:95, SMILES: CC(C)(C)[Si](OC[C@@H]1CCC(=O)O1)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prednisone, CAS:53-03-2, Molecular Weight: 358.4281, C21H26O5, Purity:98, SMILES: C[C@@]1(C2)[C@](C(CO)=O)(O)CC[C@@]1([H])[C@]3([H])CCC4=CC(C=C[C@]4(C)[C@@]3([H])C2=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hexahydrocurcumin, CAS:36062-05-2, Molecular Weight: 374.4276, C21H26O6, Purity:98, SMILES: O=C(CC(O)CCC1=CC=C(O)C(OC)=C1)CCC2=CC=C(O)C(OC)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl(cyclopent-3-en-1-yloxydiphenylsilane, CAS:182801-94-1, Molecular Weight: 322.516, C21H26OSi, Purity:95, SMILES: CC(C)(C)[Si](OC1CC=CC1)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(4-Bromo-3-[1,3]Dioxolan-2-Yl-Benzyl-2-Butyl-1,3-Diaza-Spiro[4.4]Non-1-En-4-One, CAS:254744-55-3, Molecular Weight: 435.355, C21H27BrN2O3, Purity:95, SMILES: CCCCC1=NC2(CCCC2)C(=O)N1CC1=CC(C2OCCO2)=C(Br)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Latrepirdine (dihydrochloride), CAS:97657-92-6, Molecular Weight: 392.3652, C21H27Cl2N3, Purity:98, SMILES: CN(C1)CCC2=C1C3=CC(C)=CC=C3N2CCC4=CN=C(C)C=C4.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Quetiapine sulfoxide (dihydrochloride), CAS:329218-11-3, Molecular Weight: 472.4284, C21H27Cl2N3O3S, Purity:98, SMILES: OCCOCCN(CC1)CCN1C2=NC(C=CC=C3)=C3S(C4=C2C=CC=C4)=O.Cl[H].Cl[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cetirizine (dihydrochloride), CAS:83881-52-1, Molecular Weight: 461.8097, C21H27Cl3N2O3, Purity:98, SMILES: O=C(O)COCCN1CCN(C(C2=CC=C(Cl)C=C2)C3=CC=CC=C3)CC1.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hydroxyzine, CAS:68-88-2, Molecular Weight: 374.9043, C21H27ClN2O2, Purity:98, SMILES: ClC1=CC=C(C(N2CCN(CCOCCO)CC2)C3=CC=CC=C3)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rauwolscine (hydrochloride), CAS:6211-32-1, Molecular Weight: 390.90368, C21H27ClN2O3, Purity:98, SMILES: [H]Cl.[H][C@]12C(NC3=C4C=CC=C3)=C4CCN1C[C@@]5([H])CC[C@H](O)[C@@H](C(OC)=O)[C@]5(C2)[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Yohimbine (Hydrochloride), CAS:65-19-0, Molecular Weight: 390.9037, C21H27ClN2O3, Purity:98, SMILES: [H][C@]12C(NC3=C4C=CC=C3)=C4CCN1C[C@@]5(CC[C@H](O)[C@H](C(OC)=O)[C@]5(C2)[H])[H].[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ombrabulin (hydrochloride), CAS:253426-24-3, Molecular Weight: 438.9019, C21H27ClN2O6, Purity:98, SMILES: O=C(NC1=CC(/C=C\C2=CC(OC)=C(OC)C(OC)=C2)=CC=C1OC)[C@@H](N)CO.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Thioridazine (hydrochloride), CAS:130-61-0, Molecular Weight: 407.0355, C21H27ClN2S2, Purity:98, SMILES: CSC(C=C1N2CCC3N(C)CCCC3)=CC=C1SC4=C2C=CC=C4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| K-Ras G12C-IN-2, CAS:1629267-75-9, Molecular Weight: 418.9171, C21H27ClN4O3, Purity:98, SMILES: ClC1=C(C2CC2)C=C(NCC(N3CCN(C4CN(C(C=C)=O)C4)CC3)=O)C(O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KHK-IN-1 (hydrochloride), CAS:1303470-48-5, Molecular Weight: 459.0107, C21H27ClN8S, Purity:98, SMILES: [H]Cl.CSC(C=CC=C1)=C1NC2=NC(N3CCNCC3)=NC4=C2N=CN=C4NCC5CC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity I, CAS:, Molecular Weight: 515.426, C21H27FN3O9P, Purity:98, SMILES: O=[P@@](N[C@@H](C)C(OCC)=O)(OC[C@@H]1[C@@H](O)[C@](F)(C)[C@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Triamcinolone, CAS:124-94-7, Molecular Weight: 394.4339, C21H27FO6, Purity:98, SMILES: F[C@@]1([C@]2(C=C3)C)[C@](CCC2=CC3=O)([H])[C@@](C[C@@H](O)[C@]4(O)C(CO)=O)([H])[C@]4(C)C[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(tert-Butyl)-4,4-diphenylpiperidine, CAS:57982-78-2, Molecular Weight: 293.4458, C21H27N, Purity:95, SMILES: CC(N1CCC(CC1)(c1ccccc1)c1ccccc1)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pimelic Diphenylamide 106 (analog), CAS:, Molecular Weight: 353.45798, C21H27N3O2, Purity:98, SMILES: O=C(NC1=CC=CC=C1N)CCCCCCC(NC2=CC=C(C)C=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nicainoprol, CAS:76252-06-7, Molecular Weight: 369.4574, C21H27N3O3, Purity:98, SMILES: O=C(N1CCCC2=C1C(OCC(O)CNC(C)C)=CC=C2)C3=CC=CN=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pirodavir, CAS:124436-59-5, Molecular Weight: 369.4574, C21H27N3O3, Purity:98, SMILES: O=C(OCC)C1=CC=C(OCCC2CCN(C3=NN=C(C)C=C3)CC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bacampicillin, CAS:50972-17-3, Molecular Weight: 465.52, C21H27N3O7S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC([C@H](N)C3=CC=CC=C3)=O)N1C2=O)OC(OC(OCC)=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-N1-((1H-Benzo[d]imidazol-2-yl)methyl)-N1-(5,6,7,8-tetrahydroquinolin-8-yl)butane-1,4-diamine, CAS:558447-26-0, Molecular Weight: 349.4726, C21H27N5, Purity:95, SMILES: NCCCCN([C@H]1CCCc2c1nccc2)Cc1nc2c([nH]1)cccc2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AMD-070, CAS:558447-26-0, Molecular Weight: 349.4726, C21H27N5, Purity:98, SMILES: NCCCCN(CC1=NC2=C(N1)C=CC=C2)[C@@H]3C4=C(CCC3)C=CC=N4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CC-223, CAS:1228013-30-6, Molecular Weight: 397.4708, C21H27N5O3, Purity:98, SMILES: O=C1CNC2=NC=C(C3=CC=C(C(C)(O)C)N=C3)N=C2N1[C@H]4CC[C@H](OC)CC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glipizide, CAS:29094-61-9, Molecular Weight: 445.5352, C21H27N5O4S, Purity:98, SMILES: O=C(C1=NC=C(C)N=C1)NCCC2=CC=C(S(=O)(NC(NC3CCCCC3)=O)=O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AR-C155858, CAS:496791-37-8, Molecular Weight: 461.5346, C21H27N5O5S, Purity:98, SMILES: O=C(C1=C2SC(CC3=C(NN=C3C)C)=C1C(N4C[C@@H](CO4)O)=O)N(C(N2CC(C)C)=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NADH (disodium salt), CAS:606-68-8, Molecular Weight: 709.4047, C21H27N7Na2O14P2, Purity:98, SMILES: NC1=C2C(N([C@H]3[C@H](O)[C@H](O)[C@@H](COP(OP([O-])(OC[C@@H]4[C@@H](O)[C@@H](O)[C@H](N5C=C(C(N)=O)CC=C5)O4)=O)([O-])=O)O3)C=N2)=NC=N1.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| NADP (disodium salt), CAS:24292-60-2, Molecular Weight: 788.376, C21H27N7Na2O17P3+, Purity:98, SMILES: NC1=C2C(N([C@H]3[C@H](OP(O)(O)=O)[C@H](O)[C@@H](COP(OP([O-])(OC[C@@H]4[C@@H](O)[C@@H](O)[C@H]([N+]5=CC=CC(C(N)=O)=C5)O4)=O)([O-])=O)O3)C=N2)=NC=N1.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| NADP (sodium salt), CAS:1184-16-3, Molecular Weight: 765.3868, C21H27N7NaO17P3, Purity:98, SMILES: NC1=C2C(N([C@H]3[C@H](OP(O)(O)=O)[C@H](O)[C@@H](COP(OP([O-])(OC[C@@H]4[C@@H](O)[C@@H](O)[C@H]([N+]5=CC=CC(C(N)=O)=C5)O4)=O)([O-])=O)O3)C=N2)=NC=N1.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Reversine, CAS:656820-32-5, Molecular Weight: 393.4854, C21H27N7O, Purity:98, SMILES: C1(NC2=CC=C(N3CCOCC3)C=C2)=NC(NC4CCCCC4)=C5C(NC=N5)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NAD+, CAS:53-84-9, Molecular Weight: 663.4251, C21H27N7O14P2, Purity:98, SMILES: O[C@H]([C@@H]1O)[C@@H](O[C@@H]1COP(OP(OC[C@H]2O[C@@H]([N+]3=CC=CC(C(N)=O)=C3)[C@H](O)[C@@H]2O)([O-])=O)(O)=O)N4C(N=CN=C5N)=C5N=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK-690693, CAS:937174-76-0, Molecular Weight: 425.4842, C21H27N7O3, Purity:98, SMILES: CC(O)(C)C#CC1=NC=C(OC[C@@H]2CNCCC2)C3=C1N=C(C4=NON=C4N)N3CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prednisolone (disodium phosphate), CAS:125-02-0, Molecular Weight: 484.3876, C21H27Na2O8P, Purity:98, SMILES: C[C@@]1([C@@]2(O)C(COP([O-])([O-])=O)=O)[C@](CC2)([H])[C@@](CCC3=CC4=O)([H])[C@]([C@]3(C=C4)C)([H])[C@@H](O)C1.[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isoamidone II, CAS:466-40-0, Molecular Weight: 309.44518, C21H27NO, Purity:98, SMILES: CCC(C(C1=CC=CC=C1)(C2=CC=CC=C2)C(C)CN(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ifenprodil (tartrate), CAS:23210-58-4, Molecular Weight: 400.49, C21H27NO2 . 1/2C4H6O6, Purity:98, SMILES: OC(C1=CC=C(O)C=C1)C(C)N(CC2)CCC2CC3=CC=CC=C3.O=C(O)[C@H](O)[C@@H](O)C(O)=O.OC(C4=CC=C(O)C=C4)C(C)N(CC5)CCC5CC6=CC=CC=C6, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(2-((methoxymethoxy)methyl)phenyl)-1-methyl-3-phenylpiperidin-4-ol, CAS:218288-37-0, Molecular Weight: 341.444, C21H27NO3, Purity:90, SMILES: COCOCc1ccccc1C1(O)CCN(CC1c1ccccc1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diphenmanil (methylsulfate), CAS:62-97-5, Molecular Weight: 389.5084, C21H27NO4S, Purity:98, SMILES: [O-]S(=O)(OC)=O.C[N+]1(C)CC/C(CC1)=C(C2=CC=CC=C2)\C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Delanzomib, CAS:847499-27-8, Molecular Weight: 413.27512, C21H28BN3O5, Purity:98, SMILES: CC(C)C[C@@H](B(O)O)NC([C@@H](NC(C1=NC(C2=CC=CC=C2)=CC=C1)=O)[C@H](O)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (6-((tert-Butoxycarbonyl)amino)naphthalen-2-yl)boronic acid pinacol ester, CAS:1312611-41-8, Molecular Weight: 369.262, C21H28BNO4, Purity:95, SMILES: O=C(OC(C)(C)C)Nc1ccc2c(c1)ccc(c2)B1OC(C(O1)(C)C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cimetropium (Bromide), CAS:51598-60-8, Molecular Weight: 438.35532, C21H28BrNO4, Purity:98, SMILES: C[N+]1([C@H]2[C@@H](O3)[C@@H]3[C@@H]1C[C@H](OC([C@@H](C4=CC=CC=C4)CO)=O)C2)CC5CC5.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| DDP-38003 (dihydrochloride), CAS:1831167-98-6, Molecular Weight: 423.37922, C21H28Cl2N4O, Purity:98, SMILES: [H]Cl.O=C(NC1=CC=C([C@@H]2C[C@H]2N)C=C1)C(C=C3)=CC=C3N4CCN(C)CC4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bacampicillin (hydrochloride), CAS:37661-08-8, Molecular Weight: 501.9809, C21H28ClN3O7S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2NC([C@H](N)C3=CC=CC=C3)=O)N1C2=O)OC(OC(OCC)=O)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diphenidol (hydrochloride), CAS:3254-89-5, Molecular Weight: 345.9061, C21H28ClNO, Purity:98, SMILES: OC(C1=CC=CC=C1)(C2=CC=CC=C2)CCCN3CCCCC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Propafenone (hydrochloride), CAS:34183-22-7, Molecular Weight: 377.9049, C21H28ClNO3, Purity:98, SMILES: O=C(C1=CC=CC=C1OCC(O)CNCCC)CCC2=CC=CC=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Flunixin (meglumine), CAS:42461-84-7, Molecular Weight: 491.4581, C21H28F3N3O7, Purity:98, SMILES: CC1=C(C=CC=C1C(F)(F)F)NC(N=CC=C2)=C2C(O)=O.O[C@H]([C@@H](O)CNC)[C@H](O)[C@H](O)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Decloxizine, CAS:3733-63-9, Molecular Weight: 340.4592, C21H28N2O2, Purity:98, SMILES: OCCOCCN1CCN(C(C2=CC=CC=C2)C3=CC=CC=C3)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-benzyl 1-tert-butyl 2-oxo-1,8-diazaspiro[4.5]decane-1,8-dicarboxylate, CAS:0, Molecular Weight: 388.4574, C21H28N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1C(=O)CCC11CCN(CC1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Doxylamine (succinate), CAS:562-10-7, Molecular Weight: 388.4574, C21H28N2O5, Purity:98, SMILES: O=C(O)CCC(O)=O.CC(C1=NC=CC=C1)(C2=CC=CC=C2)OCCN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cis-5-Cbz-2-Boc-3A-H-Octahydro-Pyrrolo[3,4-C]Pyridine-7A-Carboxylicacid, CAS:1217630-99-3, Molecular Weight: 404.4568, C21H28N2O6, Purity:95, SMILES: CC(C)(C)OC(=O)N1C[C@H]2CN(CC[C@]2(C1)C(O)=O)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Benzyl 2-Tert-Butyl 7-Methyl 5-Oxa-2,8-Diazaspiro[3.5]Nonane-2,7,8-Tricarboxylate, CAS:0, Molecular Weight: 420.4562, C21H28N2O7, Purity:95, SMILES: COC(=O)C1COC2(CN(C2)C(=O)OC(C)(C)C)CN1C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB756050, CAS:447410-57-3, Molecular Weight: 500.58562, C21H28N2O8S2, Purity:98, SMILES: O=S(N1CCN(S(=O)(C2=CC=C(OC)C(OC)=C2)=O)CCC1)(C3=CC=C(OC)C(OC)=C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RIP2 kinase inhibitor 2, CAS:1581270-11-2, Molecular Weight: 432.5364, C21H28N4O4S, Purity:98, SMILES: CC(C)(C)S(C1=C(OCCOC)C=C(N=CC=C2NC3=NNC(C)=C3C)C2=C1)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dinaciclib, CAS:779353-01-4, Molecular Weight: 396.486, C21H28N6O2, Purity:98, SMILES: OCC[C@H]1N(CCCC1)C2=NC3=C(C=NN3C(NCC4=C[N+]([O-])=CC=C4)=C2)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GNE-477, CAS:1032754-81-6, Molecular Weight: 504.6288, C21H28N8O3S2, Purity:98, SMILES: NC1=NC=C(C2=NC(N3CCOCC3)=C4C(C(C)=C(CN5CCN(S(=O)(C)=O)CC5)S4)=N2)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dydrogesterone, CAS:152-62-5, Molecular Weight: 312.4458, C21H28O2, Purity:98, SMILES: CC([C@H]1CC[C@@]2([H])[C@]3([H])C=CC4=CC(CC[C@@]4(C)[C@]3([H])CC[C@]12C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethisterone, CAS:434-03-7, Molecular Weight: 312.4458, C21H28O2, Purity:98, SMILES: C[C@@]1([C@]2(O)C#C)[C@](CC2)([H])[C@@](CCC3=CC4=O)([H])[C@]([C@]3(CC4)C)([H])CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Levonorgestrel, CAS:797-63-7, Molecular Weight: 312.4458, C21H28O2, Purity:98, SMILES: O=C1CC[C@]2([H])[C@@]3([H])CC[C@]4(CC)[C@@](C#C)(O)CC[C@@]4([H])[C@]3([H])CCC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cortisone, CAS:53-06-5, Molecular Weight: 360.444, C21H28O5, Purity:98, SMILES: C[C@@]1(C2)[C@](C(CO)=O)(O)CC[C@@]1([H])[C@]3([H])CCC4=CC(CC[C@]4(C)[C@@]3([H])C2=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prednisolone, CAS:50-24-8, Molecular Weight: 360.444, C21H28O5, Purity:98, SMILES: C[C@@]1([C@@]2(O)C(CO)=O)[C@](CC2)([H])[C@@](CCC3=CC4=O)([H])[C@]([C@]3(C=C4)C)([H])[C@@H](O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Octahydrocurcumin, CAS:36062-07-4, Molecular Weight: 376.4434, C21H28O6, Purity:98, SMILES: OC(CC(O)CCC1=CC=C(O)C(OC)=C1)CCC2=CC=C(O)C(OC)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glyoxalase I inhibitor (free base), CAS:174568-92-4, Molecular Weight: 577.446, C21H29BrN4O8S, Purity:98, SMILES: N[C@H](C(OCC)=O)CCC(N[C@@H](CSC(N(O)C1=CC=C(Br)C=C1)=O)C(NCC(OCC)=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| E-4031, CAS:113559-13-0, Molecular Weight: 474.4443, C21H29Cl2N3O3S, Purity:98, SMILES: CS(=O)(NC1=CC=C(C(C2CCN(CCC3=NC(C)=CC=C3)CC2)=O)C=C1)=O.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hydroxyzine (dihydrochloride), CAS:2192-20-3, Molecular Weight: 447.8262, C21H29Cl3N2O2, Purity:98, SMILES: ClC1=CC=C(C=C1)C(C2=CC=CC=C2)N3CCN(CCOCCO)CC3.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DDP-38003 (trihydrochloride), CAS:, Molecular Weight: 459.84016, C21H29Cl3N4O, Purity:98, SMILES: [H]Cl.[H]Cl.O=C(NC1=CC=C([C@@H]2C[C@H]2N)C=C1)C(C=C3)=CC=C3N4CCN(C)CC4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trimethobenzamide hydrochloride, CAS:554-92-7, Molecular Weight: 424.91836, C21H29ClN2O5, Purity:98, SMILES: O=C(NCC1=CC=C(OCCN(C)C)C=C1)C2=CC(OC)=C(OC)C(OC)=C2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fludrocortisone, CAS:127-31-1, Molecular Weight: 380.4504, C21H29FO5, Purity:98, SMILES: C[C@@]12[C@](C(CO)=O)(O)CC[C@@]1([H])[C@]3([H])CCC4=CC(CC[C@]4(C)[C@@]3(F)[C@@H](O)C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tandospirone, CAS:87760-53-0, Molecular Weight: 383.4873, C21H29N5O2, Purity:98, SMILES: O=C1[C@]2([H])[C@]([C@H]3CC[C@@H]2C3)([H])C(N1CCCCN(CC4)CCN4C5=NC=CC=N5)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| APD597, CAS:897732-93-3, Molecular Weight: 479.5499, C21H29N5O6S, Purity:98, SMILES: O=C(OC(C)C)N(CC1)CCC1OC2=C(OC)C(NC3=CC=C(S(=O)(C)=O)N=C3C)=NC=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2R)-isopropyl 2-((((((R)-1-(6-amino-9H-purin-9-yl)propan-2-yl)oxy)methyl)(phenoxy)phosphoryl)amino)propanoate, CAS:379270-36-7, Molecular Weight: 476.4659, C21H29N6O5P, Purity:95, SMILES: [H][C@@](C)(Cn1cnc2c(N)ncnc12)OCP(=O)(N[C@H](C)C(=O)OC(C)C)Oc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2S)-isopropyl 2-((((((R)-1-(6-amino-9H-purin-9-yl)propan-2-yl)oxy)methyl)(phenoxy)phosphoryl)amino)propanoate, CAS:379270-37-8, Molecular Weight: 476.4659, C21H29N6O5P, Purity:95, SMILES: CC(C)OC(=O)[C@H](C)NP(=O)(CO[C@H](C)Cn1cnc2c(N)ncnc12)Oc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GS-7340, CAS:379270-37-8, Molecular Weight: 476.4659, C21H29N6O5P, Purity:98, SMILES: NC1=NC=NC2=C1N=CN2C[C@@H](C)OC[P@](OC3=CC=CC=C3)(N[C@@H](C)C(OC(C)C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GS-7340 (hemifumarate), CAS:1392275-56-7, Molecular Weight: 534.5, C21H29N6O5P.1/2 C4H4O4, Purity:98, SMILES: O=C(O)/C=C/C(O)=O.NC1=NC=NC2=C1N=CN2C[C@@H](C)OC[P@](OC3=CC=CC=C3)(N[C@@H](C)C(OC(C)C)=O)=O.[0.5], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Biperiden, CAS:514-65-8, Molecular Weight: 311.4611, C21H29NO, Purity:98, SMILES: OC([C@H]1C[C@@H]2C=C[C@H]1C2)(CCN3CCCCC3)C4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CP 316311, CAS:175139-41-0, Molecular Weight: 327.4604, C21H29NO2, Purity:98, SMILES: CCC(CC)OC1=C(C)C(OC2=C(C)C=C(C)C=C2C)=NC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Norgestimate metabolite Norelgestromin, CAS:53016-31-2, Molecular Weight: 327.4604, C21H29NO2, Purity:98, SMILES: O/N=C1CC[C@@]2([H])C(CC[C@]3([H])[C@]2([H])CC[C@@]4(CC)[C@@]3([H])CC[C@]4(C#C)O)=C\1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1'-(Tert-Butoxycarbonyl-7-Methyl-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-3-YlAcetic Acid, CAS:1160247-51-7, Molecular Weight: 359.4593, C21H29NO4, Purity:95, SMILES: CC1=C2C(=CC=C1)C(CC(O)=O)CC21CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Pyrrolidinecarboxylic acid, 3-acetyl-4-[3-(cyclopentyloxy)-4-methoxyphenyl]-3-methyl-, methyl ester, (3S,4S)-, CAS:347850-26-4, Molecular Weight: 375.45866, C21H29NO5, Purity:98, SMILES: O=C(N1C[C@@](C)(C(C)=O)[C@H](C2=CC=C(OC)C(OC3CCCC3)=C2)C1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1'-(Tert-Butoxycarbonyl-6-Methoxy-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-3-YlAcetic Acid, CAS:1160247-48-2, Molecular Weight: 375.4587, C21H29NO5, Purity:95, SMILES: COC1=CC2=C(C=C1)C(CC(O)=O)CC21CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glyoxalase I inhibitor, CAS:221174-33-0, Molecular Weight: 613.9069, C21H30BrClN4O8S, Purity:98, SMILES: BrC1=CC=C(N(O)C(SC[C@H](NC(CC[C@H](N)C(OCC)=O)=O)C(NCC(OCC)=O)=O)=O)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Scopolamine (butylbromide), CAS:149-64-4, Molecular Weight: 440.3712, C21H30BrNO4, Purity:98, SMILES: C[N+]1([C@H]2[C@@H](O3)[C@@H]3[C@@H]1C[C@H](OC([C@@H](C4=CC=CC=C4)CO)=O)C2)CCCC.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Decloxizine (dihydrochloride), CAS:13073-96-6, Molecular Weight: 413.3811, C21H30Cl2N2O2, Purity:98, SMILES: OCCOCCN1CCN(C(C2=CC=CC=C2)C3=CC=CC=C3)CC1.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZK756326（dihydrochloride）, CAS:1780259-94-0, Molecular Weight: 429.3805, C21H30Cl2N2O3, Purity:98, SMILES: OCCOCCN1CCN(CC2=CC=CC(OC3=CC=CC=C3)=C2)CC1.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Loxiglumide, CAS:107097-80-3, Molecular Weight: 461.3793, C21H30Cl2N2O5, Purity:98, SMILES: O=C(O)CCC(NC(C1=CC=C(Cl)C(Cl)=C1)=O)C(N(CCCOC)CCCCC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AMD-070 (hydrochloride), CAS:880549-30-4, Molecular Weight: 458.8554, C21H30Cl3N5, Purity:98, SMILES: [H]Cl.[H]Cl.NCCCCN(CC1=NC2=CC=CC=C2N1)[C@@H]3C4=NC=CC=C4CCC3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Biperiden (Hydrochloride), CAS:1235-82-1, Molecular Weight: 347.922, C21H30ClNO, Purity:98, SMILES: OC(C1CC2C=CC1C2)(CCN3CCCCC3)C4=CC=CC=C4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cyclopentanepropanoic acid, 1-[[[3-(4-chlorophenyl)propyl]amino]carbonyl]-α-(2-methoxyethyl)-, CAS:465527-94-0, Molecular Weight: 395.9202, C21H30ClNO4, Purity:98, SMILES: O=C(O)C(CC1(C(NCCCC2=CC=C(Cl)C=C2)=O)CCCC1)CCOC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bunaftide, CAS:32421-46-8, Molecular Weight: 326.4757, C21H30N2O, Purity:98, SMILES: O=C(C1=C2C=CC=CC2=CC=C1)N(CCCC)CCN(CC)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CP 376395, CAS:175140-00-8, Molecular Weight: 326.4757, C21H30N2O, Purity:98, SMILES: CCC(CC)NC1=C(C)C(OC2=C(C)C=C(C)C=C2C)=NC(C)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 9-Benzyl-5-Oxo-2,9-Diazaspiro[5.5]Undecane-2-Carboxylate, CAS:1159982-58-7, Molecular Weight: 358.4745, C21H30N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(=O)C2(CCN(CC3=CC=CC=C3)CC2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY451395, CAS:375345-95-2, Molecular Weight: 438.6039, C21H30N2O4S2, Purity:98, SMILES: C[C@@H](CNS(C(C)C)(=O)=O)C1=CC=C(C2=CC=C(CCNS(C)(=O)=O)C=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-Benzyl 2-Tert-Butyl 8-(Hydroxymethyl-2,5-Diazaspiro[3.5]Nonane-2,5-Dicarboxylate, CAS:1823417-97-5, Molecular Weight: 390.4733, C21H30N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CC2(C1)CC(CO)CCN2C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2R,βR)-GC376, CAS:, Molecular Weight: 507.53296928, C21H30N3NaO8S, Purity:98, SMILES: O=C1C(C[C@](NC([C@H](NC(OCC2=CC=CC=C2)=O)CC(C)C)=O)([H])C(S(=O)([O-])=O)O)CCN1.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| (2R,βS)-GC376, CAS:, Molecular Weight: 507.53296928, C21H30N3NaO8S, Purity:98, SMILES: O=C1C(C[C@](NC([C@@H](NC(OCC2=CC=CC=C2)=O)CC(C)C)=O)([H])C(S(=O)([O-])=O)O)CCN1.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| GC376, CAS:1416992-39-6, Molecular Weight: 507.53, C21H30N3NaO8S, Purity:98, SMILES: O=C(N[C@@H](CC(C)C)C(N[C@@](C(S([O-])(=O)=O)O)([H])CC1C(NCC1)=O)=O)OCC2=CC=CC=C2.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Balapiravir, CAS:690270-29-2, Molecular Weight: 494.4983, C21H30N6O8, Purity:98, SMILES: O=C1N=C(N)C=CN1[C@@H]2O[C@](N=[N+]=[N-])(COC(C(C)C)=O)[C@@H](OC(C(C)C)=O)[C@H]2OC(C(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Progesterone, CAS:57-83-0, Molecular Weight: 314.4617, C21H30O2, Purity:98, SMILES: CC([C@H]1CC[C@@]2([H])[C@]3([H])CCC4=CC(CC[C@]4(C)[C@@]3([H])CC[C@]12C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Org30958, CAS:99957-90-1, Molecular Weight: 378.5917, C21H30O2S2, Purity:98, SMILES: CCSSC[C@@]12[C@]3([H])[C@](CCC1=CC(CC2)=O)([H])[C@@]4([H])[C@@](C)(C(CC4)=O)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 11beta-Hydroxyprogesterone, CAS:600-57-7, Molecular Weight: 330.4611, C21H30O3, Purity:98, SMILES: C[C@@]12[C@]3([H])[C@](CCC1=CC(CC2)=O)([H])[C@@]4([H])[C@@](C)([C@@H](C(C)=O)CC4)C[C@@H]3O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 17-Hydroxyprogesterone, CAS:68-96-2, Molecular Weight: 330.4611, C21H30O3, Purity:98, SMILES: CC([C@@]1(O)CC[C@@]2([H])[C@]3([H])CCC4=CC(CC[C@]4(C)[C@@]3([H])CC[C@]12C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dehydroisoandrosterone 3-acetate, CAS:853-23-6, Molecular Weight: 330.4611, C21H30O3, Purity:98, SMILES: C[C@]1([C@](CC2)([H])[C@]3([H])CC=C4C[C@@H](OC(C)=O)CC[C@]4(C)[C@@]3([H])CC1)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Corticosterone, CAS:50-22-6, Molecular Weight: 346.4605, C21H30O4, Purity:98, SMILES: C[C@@]12[C@@H](C(CO)=O)CC[C@@]1([H])[C@]3([H])CCC4=CC(CC[C@]4(C)[C@@]3([H])[C@@H](O)C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cortodoxone, CAS:152-58-9, Molecular Weight: 346.4605, C21H30O4, Purity:98, SMILES: O=C1CC[C@@]2(C)C(CC[C@]3([H])[C@]2([H])CC[C@@]4(C)[C@@]3([H])CC[C@]4(O)C(CO)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hydrocortisone, CAS:50-23-7, Molecular Weight: 362.4599, C21H30O5, Purity:98, SMILES: C[C@@]1([C@@]2(O)C(CO)=O)[C@](CC2)([H])[C@@](CCC3=CC4=O)([H])[C@]([C@]3(CC4)C)([H])[C@@H](O)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| [4-[4-(4,4,5,5-Tetramethyl-[1,3,2]dioxaborolan-2-yl)phenyl]cyclohexyl]acetic acid methyl ester, CAS:701232-69-1, Molecular Weight: 358.279, C21H31BO4, Purity:95, SMILES: COC(=O)CC1CCC(CC1)c1ccc(cc1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Imisopasem manganese, CAS:218791-21-0, Molecular Weight: 479.348385, C21H31Cl2MnN5, Purity:98, SMILES: Cl[Mn]1234(Cl)[N]5=C6C=CC=C5CN1C7CCCCC7N2CCN3C(CCCC8)C8N4C6, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-N-(4-((4,4-DIMETHYLCYCLOHEXYL)OXY)-5-FLUORO-2-METHOXYBENZYL)PYRROLIDINE-2-CARBOXAMIDE, CAS:1224048-09-2, Molecular Weight: 378.4808, C21H31FN2O3, Purity:95, SMILES: COc1cc(OC2CCC(C)(C)CC2)c(F)cc1CNC(=O)[C@@H]1CCCN1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| D-3263, CAS:947257-66-1, Molecular Weight: 373.4891, C21H31N3O3, Purity:98, SMILES: O=C1N(CCN)C2=CC(OC)=CC=C2N1C([C@H]3[C@H](C(C)C)CC[C@@H](C)C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-Benzyl 9-Tert-Butyl 1,4,9-Triazaspiro[5.5]Undecane-1,9-Dicarboxylate, CAS:1251008-98-6, Molecular Weight: 389.4885, C21H31N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)CNCCN2C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-Octahydro-Pyrazino[2,3-D]Azepine-1,7-Dicarboxylic Acid 7-Benzylester1-Tert-Butyl Ester, CAS:1251004-30-4, Molecular Weight: 389.4885, C21H31N3O4, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN[C@H]2CCN(CC[C@H]12)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lisinopril, CAS:76547-98-3, Molecular Weight: 405.4879, C21H31N3O5, Purity:98, SMILES: O=C(O)[C@H]1N(C([C@H](CCCCN)N[C@H](C(O)=O)CCC2=CC=CC=C2)=O)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| N-Formyl-Met-Leu-Phe, CAS:59880-97-6, Molecular Weight: 437.55294, C21H31N3O5S, Purity:98, SMILES: O=C(O)[C@H](CC1=CC=CC=C1)NC([C@H](CC(C)C)NC([C@H](CCSC)NC=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Almotriptan (malate), CAS:181183-52-8, Molecular Weight: 469.5517, C21H31N3O7S, Purity:98, SMILES: O=C(O)C(O)CC(O)=O.O=S(CC1=CC2=C(NC=C2CCN(C)C)C=C1)(N3CCCC3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CYC065, CAS:1070790-89-4, Molecular Weight: 397.51714, C21H31N7O, Purity:98, SMILES: C[C@@H](O)[C@@H](NC1=NC(NCC2=C(C)C=C(C)N=C2)=C3N=CN(C(C)C)C3=N1)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Spirendolol, CAS:81840-58-6, Molecular Weight: 345.47574, C21H31NO3, Purity:98, SMILES: O=C1C2=C(C(OCC(O)CNC(C)(C)C)=CC=C2)CC31CCCCC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CDDD3602, CAS:113932-41-5, Molecular Weight: 457.53774, C21H31NO8S, Purity:98, SMILES: COS(=O)([O-])=O.C[N+]([C@@H](CC1)C2)(C)[C@H]1C[C@@H]2OC(C(C3=CC=CC=C3)C(OCC)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hydrocortisone (phosphate), CAS:3863-59-0, Molecular Weight: 442.4398, C21H31O8P, Purity:98, SMILES: C[C@@]12[C@](C(COP(O)(O)=O)=O)(O)CC[C@@]1([H])[C@]3([H])CCC4=CC(CC[C@]4(C)[C@@]3([H])[C@@H](O)C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cariprazine, CAS:839712-12-8, Molecular Weight: 427.411, C21H32Cl2N4O, Purity:98, SMILES: O=C(N[C@H]1CC[C@H](CCN2CCN(C3=CC=CC(Cl)=C3Cl)CC2)CC1)N(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| D-3263 (hydrochloride), CAS:1008763-54-9, Molecular Weight: 409.9501, C21H32ClN3O3, Purity:98, SMILES: [H]Cl.O=C1N(CCN)C2=CC(OC)=CC=C2N1C([C@H]3[C@H](C(C)C)CC[C@@H](C)C3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Revexepride, CAS:219984-49-3, Molecular Weight: 425.94948, C21H32ClN3O4, Purity:98, SMILES: O=C(C1=C(OC(C)(C)C2)C2=C(N)C(Cl)=C1)NC[C@H]3[C@H](O)CN(CCCOC)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Buspirone (hydrochloride), CAS:33386-08-2, Molecular Weight: 421.9641, C21H32ClN5O2, Purity:98, SMILES: O=C(N(CCCCN1CCN(C2=NC=CC=N2)CC1)C(C3)=O)CC43CCCC4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Istaroxime, CAS:203737-93-3, Molecular Weight: 360.4904, C21H32N2O3, Purity:98, SMILES: O=C1CC[C@@]2([H])[C@]3([H])CC([C@@]4([H])C/C(CC[C@]4(C)[C@@]3([H])CC[C@@]21C)=N/OCCN)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2-((BenzyloxyMethyl-1,8-Diazaspiro[4.5]Decane-8-Carboxylate, CAS:1823271-87-9, Molecular Weight: 360.4904, C21H32N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CCC(COCC3=CC=CC=C3)N2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 2-Benzyl-4-(Hydroxymethyl-2,8-Diazaspiro[4.5]Decane-8-Carboxylate, CAS:0, Molecular Weight: 360.4904, C21H32N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CN(CC3=CC=CC=C3)CC2CO)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| NCT-501, CAS:1802088-50-1, Molecular Weight: 416.5172, C21H32N6O3, Purity:98, SMILES: O=C(N1C)N(C)C2=C(N(CCC(C)C)C(CN3CCN(C(C4CC4)=O)CC3)=N2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Melittoside, CAS:19467-03-9, Molecular Weight: 524.4698, C21H32O15, Purity:98, SMILES: O[C@H]1[C@@]([C@](C(CO)=C1)([H])[C@@H]2O[C@]([C@@H]([C@@H](O)[C@@H]3O)O)([H])O[C@@H]3CO)(C=CO2)O[C@]([C@@H]([C@@H](O)[C@@H]4O)O)([H])O[C@@H]4CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rehmannioside A, CAS:81720-05-0, Molecular Weight: 524.4698, C21H32O15, Purity:98, SMILES: OCC1(C(C2OC(C(C(O)C3O)O)OC3COC(C(C(O)C4O)O)OC4CO)C(C=CO2)C5O)C5O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Norboletone, CAS:797-58-0, Molecular Weight: 316.47758, C21H32O2, Purity:98, SMILES: CC[C@]1(O)CC[C@@]2([H])[C@]3([H])CCC4=CC(CC[C@]4([H])[C@@]3([H])CC[C@]12CC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pregnenolone, CAS:145-13-1, Molecular Weight: 316.4776, C21H32O2, Purity:98, SMILES: C[C@@](C1=CC2)(CC[C@H](O)C1)[C@]3([H])[C@]2([H])[C@@](CC[C@@H]4C(C)=O)([H])[C@]4(C)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Androstenediol 17-acetate, CAS:5937-72-4, Molecular Weight: 332.47698, C21H32O3, Purity:98, SMILES: C[C@@](C1=CC2)(CC[C@H](O)C1)[C@]3([H])[C@]2([H])[C@@](CC[C@@H]4OC(C)=O)([H])[C@]4(C)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TMPA, CAS:1258275-73-8, Molecular Weight: 380.4752, C21H32O6, Purity:98, SMILES: COC1=C(CC(OCC)=O)C(C(CCCCCCC)=O)=CC(OC)=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)piperazine-1-carboxylate, CAS:470478-90-1, Molecular Weight: 388.309, C21H33BN2O4, Purity:99, SMILES: CC(C)(C)OC(=O)N1CCN(CC1)c1ccc(cc1)B1OC(C)(C)C(C)(C)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cariprazine (hydrochloride), CAS:1083076-69-0, Molecular Weight: 463.8719, C21H33Cl3N4O, Purity:98, SMILES: O=C(N[C@H]1CC[C@H](CCN2CCN(C3=CC=CC(Cl)=C3Cl)CC2)CC1)N(C)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 4-chloro-1-(triisopropylsilyl)-1H-pyrrolo[2,3-b]pyridine-5-carboxylate, CAS:1951439-87-4, Molecular Weight: 409.037, C21H33ClN2O2Si, Purity:95, SMILES: CC(C)[Si](C(C)C)(C(C)C)n1ccc2c(Cl)c(cnc12)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Istaroxime (hydrochloride), CAS:374559-48-5, Molecular Weight: 396.9513, C21H33ClN2O3, Purity:98, SMILES: O=C1CC[C@@]2([H])[C@]3([H])CC([C@@]4([H])C/C(CC[C@]4(C)[C@@]3([H])CC[C@@]21C)=N/OCCN)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-((tert-butyldimethylsilyl)oxy)-3-cyclohexyl-1-(2-iodophenyl)propan-1-one, CAS:1402839-08-0, Molecular Weight: 472.4755, C21H33IO2Si, Purity:90, SMILES: IC1=C(C(CC(O[Si](C)(C)C(C)(C)C)C2CCCCC2)=O)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GI254023X, CAS:260264-93-5, Molecular Weight: 391.5044, C21H33N3O4, Purity:98, SMILES: O=C(N[C@H](C(NC)=O)C(C)(C)C)[C@@H]([C@@H](N(C=O)O)C)CCCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pivmecillinam, CAS:32886-97-8, Molecular Weight: 439.5688, C21H33N3O5S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2/N=C/N3CCCCCC3)N1C2=O)OCOC(C(C)(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pivmecillinam (hydrochloride), CAS:32887-03-9, Molecular Weight: 476.0298, C21H34ClN3O5S, Purity:98, SMILES: O=C([C@@H](C(C)(C)S[C@]1([H])[C@@H]2/N=C/N3CCCCCC3)N1C2=O)OCOC(C(C)(C)C)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IT1t, CAS:864677-55-4, Molecular Weight: 406.65146, C21H34N4S2, Purity:98, SMILES: CC1(C)CN2C(CS/C(NC3CCCCC3)=N\C4CCCCC4)=CSC2=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Phosphonic acid, [(3E)-1-[(2E)-3,7-dimethyl-2,6-octadienyl]-4,8-dimethyl-3,7-nonadienylidene]bis-, tetrasodium salt, CAS:878143-03-4, Molecular Weight: 536.39766112, C21H34Na4O6P2, Purity:98, SMILES: C/C(C)=C\CC/C(C)=C/CC(P([O-])([O-])=O)(P([O-])([O-])=O)C/C=C(C)/CC/C=C(C)\C.[Na+].[Na+].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Allopregnanolone, CAS:516-54-1, Molecular Weight: 318.49346, C21H34O2, Purity:98, SMILES: O=C(C)[C@H]1CC[C@@]2([H])[C@]3([H])CC[C@@]4([H])C[C@H](O)CC[C@]4(C)[C@@]3([H])CC[C@@]21C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lisinopril (dihydrate), CAS:83915-83-7, Molecular Weight: 441.5185, C21H35N3O7, Purity:98, SMILES: O=C(O)[C@H]1N(C([C@H](CCCCN)N[C@H](C(O)=O)CCC2=CC=CC=C2)=O)CCC1.O.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rabacfosadine, CAS:859209-74-8, Molecular Weight: 526.526362, C21H35N8O6P, Purity:98, SMILES: CCOC([C@H](C)NP(N[C@@H](C)C(OCC)=O)(COCCN1C=NC2=C(NC3CC3)N=C(N)N=C12)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IT1t (dihydrochloride), CAS:1092776-63-0, Molecular Weight: 479.57334, C21H36Cl2N4S2, Purity:98, SMILES: CC1(C)CN2C(CS/C(NC3CCCCC3)=N\C4CCCCC4)=CSC2=N1.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amorolfine (hydrochloride), CAS:78613-38-4, Molecular Weight: 353.9696, C21H36ClNO, Purity:98, SMILES: C[C@@H]1O[C@H](C)CN(CC(C)CC2=CC=C(C(C)(C)CC)C=C2)C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-((6aR,8R,9aR-2,2,4,4-tetraisopropyl-9-oxotetrahydro-6H-furo[3,2-f][1,3,5,2,4]trioxadisilocin-8-ylpyrimidine-2,4(1H,3H-dione, CAS:84828-97-7, Molecular Weight: 484.6907, C21H36N2O7Si2, Purity:95, SMILES: CC(C)[Si]1(OC[C@H]2O[C@@H](N3C=CC(=O)NC3=O)C(=O)[C@@H]2O[Si](O1)(C(C)C)C(C)C)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Atractyloside A, CAS:126054-77-1, Molecular Weight: 448.5045, C21H36O10, Purity:98, SMILES: O=C1[C@@](C)(O)[C@]2([H])C[C@H](C(C)(O[C@H]3[C@@H]([C@H]([C@@H]([C@@H](CO)O3)O)O)O)C)CC[C@@](CO)(O)[C@@]2([H])C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Inogatran, CAS:155415-08-0, Molecular Weight: 438.5642, C21H38N6O4, Purity:98, SMILES: O=C(O)CN[C@H](CC1CCCCC1)C(N2[C@H](C(NCCCNC(N)=N)=O)CCCC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cetylpyridinium (chloride monohydrate), CAS:6004-24-6, Molecular Weight: 358.0014, C21H40ClNO, Purity:98, SMILES: CCCCCCCCCCCCCCCC[N+]1=CC=CC=C1.O.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tuftsin, CAS:9063-57-4, Molecular Weight: 500.5923, C21H40N8O6, Purity:98, SMILES: O=C([C@@H](N)[C@H](O)C)N[C@@H](CCCCN)C(N1[C@@H](CCC1)C(N[C@H](C(O)=O)CCCNC(N)=N)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Apramycin, CAS:37321-09-8, Molecular Weight: 539.5771, C21H41N5O11, Purity:98, SMILES: O[C@H]1[C@](O[C@H](O[C@@]([C@H](C[C@H]2N)N)([H])[C@@H]([C@H]2O)O)[C@H](N)C3)([H])[C@@]3([H])O[C@H](O[C@@]([C@@H]([C@@H](O)[C@@H]4N)O)([H])O[C@@H]4CO)[C@H]1NC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LSKL, Inhibitor of Thrombospondin (TSP-1), CAS:, Molecular Weight: 459.6, C21H41N5O6, Purity:98, SMILES: [LSKL], HPLC, NMR, LCMS is ok, stock more than 10g. |
| SLLK, Control Peptide for TSP1 Inhibitor, CAS:, Molecular Weight: 459.59, C21H41N5O6, Purity:98, SMILES: [SLLK], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Netilmicin (sulfate), CAS:56391-57-2, Molecular Weight: 720.78, C21H41N5O7 . 5/2 H2O4S , Purity:98, SMILES: NCC1=CC[C@@H](N)[C@](O[C@@H]2[C@@H](N)C[C@@H](NCC)[C@H](O[C@@]3([H])OC[C@](C)(O)[C@H](NC)[C@H]3O)[C@H]2O)([H])O1.[2.5H2SO4], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dihydrostreptomycin (sulfate), CAS:5490-27-7, Molecular Weight: 730.71, C21H41N7O12 . 3/2 H2SO4, Purity:98, SMILES: O[C@@H]1[C@@H](O)[C@@](O[C@@H]2O[C@@H](C)[C@](O)(CO)[C@H]2O[C@@]3([H])[C@@H](NC)[C@H](O)[C@@H](O)[C@H](CO)O3)([H])[C@@H](NC(N)=N)[C@H](O)[C@H]1NC(N)=N.[1.5H2SO4], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Streptomycin (sulfate), CAS:3810-74-0, Molecular Weight: 728.69, C21H42N7O18S1.5, Purity:98, SMILES: O[C@@]1(C=O)[C@H]([C@@H](O[C@H]1C)O[C@]([C@@H]([C@@H](O)[C@@H]2NC(N)=N)O)([H])[C@H]([C@@H]2O)NC(N)=N)O[C@@](O[C@@H](CO)[C@H](O)[C@H]3O)([H])[C@H]3NC.[1.5H2SO4], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl eicosanoate, CAS:1120-28-1, Molecular Weight: 326.557, C21H42O2, Purity:95, SMILES: CCCCCCCCCCCCCCCCCCCC(=O)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Stearin, 1-mono-, CAS:123-94-4, Molecular Weight: 358.5558, C21H42O4, Purity:99, SMILES: CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Apramycin (sulfate), CAS:65710-07-8, Molecular Weight: 637.6556, C21H43N5O15S, Purity:98, SMILES: O[C@H]1[C@](O[C@H](O[C@@]([C@H](C[C@H]2N)N)([H])[C@@H]([C@H]2O)O)[C@H](N)C3)([H])[C@@]3([H])O[C@H](O[C@@]([C@@H]([C@@H](O)[C@@H]4N)O)([H])O[C@@H]4CO)[C@H]1NC.O=S(O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Hexetidine, CAS:141-94-6, Molecular Weight: 339.6021, C21H45N3, Purity:98, SMILES: NC1(C)CN(CC(CC)CCCC)CN(CC(CC)CCCC)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Miltefosine, CAS:58066-85-6, Molecular Weight: 407.568, C21H46NO4P, Purity:98, SMILES: O=P(OCC[N+](C)(C)C)(OCCCCCCCCCCCCCCCC)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gastric Inhibitory Peptide (GIP), human, CAS:100040-31-1, Molecular Weight: 4983.6, C226H338N60O66S, Purity:98, SMILES: [YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bioymifi, CAS:1420071-30-2, Molecular Weight: 494.3174, C22H12BrN3O4S, Purity:98, SMILES: O=C(/C(SC1=N)=C/C2=CC=C(O2)C3=CC(C(N4)=O)=C(C=C3)C4=O)N1C5=CC=C(C=C5)Br, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Marinopyrrole A, CAS:1227962-62-0, Molecular Weight: 510.1537, C22H12Cl4N2O4, Purity:98, SMILES: OC1=CC=CC=C1C(C2=C(N3C(C(C4=CC=CC=C4O)=O)=CC(Cl)=C3Cl)C(Cl)=C(Cl)N2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| EN460, CAS:496807-64-8, Molecular Weight: 460.7899, C22H12ClF3N2O4, Purity:98, SMILES: FC(F)(F)C1=NN(C2=CC(C(O)=O)=C(Cl)C=C2)C(/C1=C\C3=CC=C(C4=CC=CC=C4)O3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Closantel (sodium), CAS:61438-64-0, Molecular Weight: 685.0555, C22H13Cl2I2N2NaO2, Purity:98, SMILES: O=C(NC1=CC(Cl)=C(C(C2=CC=C(Cl)C=C2)C#N)C=C1C)C3=CC(I)=CC(I)=C3[O-].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Closantel, CAS:57808-65-8, Molecular Weight: 663.0737, C22H14Cl2I2N2O2, Purity:98, SMILES: O=C(NC1=CC(Cl)=C(C(C2=CC=C(Cl)C=C2)C#N)C=C1C)C3=CC(I)=CC(I)=C3O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4E2RCat, CAS:432499-63-3, Molecular Weight: 455.9339, C22H14ClNO4S2, Purity:98, SMILES: O=C(O)C1=CC(C2=CC=C(/C=C(SC(N3CC4=CC=CC=C4)=S)/C3=O)O2)=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| APTO-253, CAS:916151-99-0, Molecular Weight: 367.3784, C22H14FN5, Purity:98, SMILES: CC(N1)=C(C(N2)=NC3=C2C4=CC=CN=C4C5=NC=CC=C53)C6=C1C=CC(F)=C6, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-IAF, CAS:63368-54-7, Molecular Weight: 515.2542, C22H14INO6, Purity:98, SMILES: O=C(NC1=CC2=C(C3(C4=C(OC5=C3C=CC(O)=C5)C=C(O)C=C4)OC2=O)C=C1)CI, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IOWH-032, CAS:1191252-49-9, Molecular Weight: 545.1802, C22H15Br2N3O4, Purity:98, SMILES: BrC1=C(O)C(Br)=CC(C2=NOC(C(NCC3=CC=C(OC4=CC=CC=C4)C=C3)=O)=N2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CPPHA, CAS:693288-97-0, Molecular Weight: 406.8185, C22H15ClN2O4, Purity:98, SMILES: O=C1N(CC2=CC(Cl)=CC=C2NC(C3=CC=CC=C3O)=O)C(C4=CC=CC=C41)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Atovaquone D4, CAS:, Molecular Weight: 370.8621, C22H15D4ClO3, Purity:98, SMILES: O=C1C2=C(C(C(O)=C1[C@@H]3CC[C@@H](C4=CC=C(Cl)C=C4)CC3)=O)C([2H])=C([2H])C([2H])=C2[2H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| NVP-BAW2881, CAS:861875-60-7, Molecular Weight: 424.3753, C22H15F3N4O2, Purity:98, SMILES: O=C(C1=C2C=CC(OC3=NC(N)=NC=C3)=CC2=CC=C1)NC4=CC=CC(C(F)(F)F)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CAY10602, CAS:374922-43-7, Molecular Weight: 418.4435032, C22H15FN4O2S, Purity:98, SMILES: NC1=C(S(=O)(C2=CC=CC=C2)=O)C3=NC4=CC=CC=C4N=C3N1C5=CC=C(F)C=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-([2,2':6',2''-Terpyridin]-4'-yl)benzoic acid, CAS:158014-74-5, Molecular Weight: 353.3734, C22H15N3O2, Purity:95, SMILES: OC(=O)c1ccc(cc1)c1cc(nc(c1)c1ccccn1)c1ccccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KJ Pyr 9, CAS:581073-80-5, Molecular Weight: 385.3722, C22H15N3O4, Purity:98, SMILES: O=C(N)C1=CC=C(C2=CC(C3=CC=CO3)=NC(C4=CC=C([N+]([O-])=O)C=C4)=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Leukadherin-1, CAS:344897-95-6, Molecular Weight: 421.4888, C22H15NO4S2, Purity:98, SMILES: O=C(O)C1=CC=C(C2=CC=C(/C=C(SC(N3CC4=CC=CC=C4)=S)/C3=O)O2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-(3-CHLORO-4-FLUOROPHENYL)-3-METHYL-3-(PYRIMIDIN-5-YLMETHYL)-1-(1H-1,2,4-TRIAZOL-3-YL)INDOLIN-2-ONE, CAS:1141080-15-0, Molecular Weight: 434.853, C22H16ClFN6O, Purity:95, SMILES: CC1(Cc2cncnc2)C(=O)N(c2nc[nH]n2)c2ccc(cc12)-c1ccc(F)c(Cl)c1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Imidazo[1,2-a]pyridine-2-carboxamide, 6-chloro-N-[6-(phenylmethoxy)-1H-benzimidazol-2-yl]-, CAS:1254166-60-3, Molecular Weight: 417.84774, C22H16ClN5O2, Purity:98, SMILES: O=C(C1=CN2C=C(Cl)C=CC2=N1)NC3=NC4=CC=C(OCC5=CC=CC=C5)C=C4N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Banoxantrone (D12), CAS:1562067-05-3, Molecular Weight: 456.554861336, C22H16D12N4O6, Purity:98, SMILES: O=N(C([2H])([2H])[2H])(C([2H])([2H])[2H])CCNC1=CC=C(NCCN(C([2H])([2H])[2H])(C([2H])([2H])[2H])=O)C(C(C2=C(O)C=CC(O)=C23)=O)=C1C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| OSI-930, CAS:728033-96-3, Molecular Weight: 443.4416, C22H16F3N3O2S, Purity:98, SMILES: O=C(C1=C(NCC2=CC=NC3=CC=CC=C23)C=CS1)NC4=CC=C(OC(F)(F)F)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| COH29, CAS:1190932-38-7, Molecular Weight: 420.4378, C22H16N2O5S, Purity:98, SMILES: O=C(NC1=NC(C2=CC=C(O)C(O)=C2)=C(C3=CC=CC=C3)S1)C4=CC=C(O)C(O)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML347, CAS:1062368-49-3, Molecular Weight: 352.3886, C22H16N4O, Purity:98, SMILES: COC1=CC=C(C2=CN3C(N=C2)=C(C4=C5C=CC=NC5=CC=C4)C=N3)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rosabulin, CAS:501948-05-6, Molecular Weight: 400.453, C22H16N4O2S, Purity:98, SMILES: O=C(NC1=CC(C)=NS1)C(C2=C3C=CC=CN3C(CC4=CC=C(C#N)C=C4)=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SB-431542, CAS:301836-41-9, Molecular Weight: 384.3875, C22H16N4O3, Purity:98, SMILES: O=C(C1=CC=C(C=C1)C2=NC(C3=CC=C4OCOC4=C3)=C(N2)C5=NC=CC=C5)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amido Black 1B, CAS:1064-48-8, Molecular Weight: 618.507, C22H16N6Na2O9S2, Purity:95, SMILES: [Na+].[Na+].Nc1c(\N=N\c2ccc(cc2)[N+]([O-])=O)c(cc2cc(c(\N=N\c3ccccc3)c(O)c12)S(O)(=O)=O)S(O)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fluralaner, CAS:864731-61-3, Molecular Weight: 556.2851, C22H17Cl2F6N3O3, Purity:98, SMILES: O=C(NCC(NCC(F)(F)F)=O)C1=CC=C(C2=NOC(C(F)(F)F)(C3=CC(Cl)=CC(Cl)=C3)C2)C=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK-3 inhibitor 1, CAS:603272-51-1, Molecular Weight: 437.8541, C22H17ClFN5O2, Purity:98, SMILES: FC1=CC(CNCC2)=C(N2C=C3C4=C(C5=CN=C6N5C=CC=C6)C(NC4=O)=O)C3=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CJ-42794, CAS:847728-01-2, Molecular Weight: 413.8261, C22H17ClFNO4, Purity:98, SMILES: ClC1=CC=C(OC2=CC=C(F)C=C2)C(C(N[C@H](C3=CC=C(C(O)=O)C=C3)C)=O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clotrimazole, CAS:23593-75-1, Molecular Weight: 344.8368, C22H17ClN2, Purity:98, SMILES: ClC1=CC=CC=C1C(N2C=CN=C2)(C3=CC=CC=C3)C4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TRAM-34, CAS:289905-88-0, Molecular Weight: 344.8368, C22H17ClN2, Purity:98, SMILES: ClC1=CC=CC=C1C(N2N=CC=C2)(C3=CC=CC=C3)C4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Duvelisib, CAS:1201438-56-3, Molecular Weight: 416.863, C22H17ClN6O, Purity:98, SMILES: O=C1N(C2=CC=CC=C2)C([C@@H](NC3=C4N=CNC4=NC=N3)C)=CC5=C1C(Cl)=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Duvelisib (R enantiomer), CAS:1261590-48-0, Molecular Weight: 416.863, C22H17ClN6O, Purity:98, SMILES: ClC1=C(C2=O)C(C=C([C@H](NC3=NC=NC4=C3N=CN4)C)N2C5=CC=CC=C5)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Losartan (D4 Carboxylic Acid), CAS:1246820-62-1, Molecular Weight: 440.9188, C22H17D4ClN6O2, Purity:98, SMILES: ClC1=C(C(O)=O)N(CC2=C([2H])C([2H])=C(C3=CC=CC=C3C4=NN=NN4)C([2H])=C2[2H])C(CCCC)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isavuconazole, CAS:241479-67-4, Molecular Weight: 437.4650864, C22H17F2N5OS, Purity:98, SMILES: FC1=CC=C(F)C=C1[C@](CN2C=NC=N2)(O)[C@@H](C)C3=NC(C4=CC=C(C#N)C=C4)=CS3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ravuconazole, CAS:182760-06-1, Molecular Weight: 437.4650864, C22H17F2N5OS, Purity:98, SMILES: FC1=CC(F)=CC=C1[C@](CN2C=NC=N2)(O)[C@@H](C)C3=NC(C4=CC=C(C#N)C=C4)=CS3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RSV604, CAS:676128-63-5, Molecular Weight: 388.3944, C22H17FN4O2, Purity:98, SMILES: O=C1[C@@H](NC(NC2=C(F)C=CC=C2)=O)N=C(C3=CC=CC=C3)C4=CC=CC=C4N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RSV604 (R enantiomer), CAS:932108-20-8, Molecular Weight: 388.3944, C22H17FN4O2, Purity:98, SMILES: O=C1[C@H](NC(NC2=CC=CC=C2F)=O)N=C(C3=CC=CC=C3)C4=CC=CC=C4N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RSV604 (racemate), CAS:676128-62-4, Molecular Weight: 388.3944, C22H17FN4O2, Purity:98, SMILES: O=C1C(NC(NC2=CC=CC=C2F)=O)N=C(C3=CC=CC=C3)C4=CC=CC=C4N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Iodo-1-trityl-1H-imidazole, CAS:96797-15-8, Molecular Weight: 436.2883, C22H17IN2, Purity:95, SMILES: IC1=CN(C=N1)C(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-Iodo-1-trityl-1H-imidazole, CAS:96797-15-8, Molecular Weight: 436.2883, C22H17IN2, Purity:99, SMILES: Ic1cn(cn1)C(c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-iodo-1-trityl-1H-pyrazole, CAS:191980-54-8, Molecular Weight: 436.2883, C22H17IN2, Purity:95, SMILES: IC1=CN(C(C2=CC=CC=C2)(C3=CC=CC=C3)C4=CC=CC=C4)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RAD51 Inhibitor B02, CAS:1290541-46-6, Molecular Weight: 339.38988, C22H17N3O, Purity:98, SMILES: O=C1N(CC2=CC=CC=C2)C(/C=C/C3=CC=CN=C3)=NC4=C1C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CDD3505, CAS:173865-33-3, Molecular Weight: 355.38928, C22H17N3O2, Purity:98, SMILES: O=[N+]([O-])C1=CN(C(C2=CC=CC=C2)(C3=CC=CC=C3)C4=CC=CC=C4)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| b-AP15, CAS:1009817-63-3, Molecular Weight: 419.38688, C22H17N3O6, Purity:98, SMILES: O=C1/C(CN(C(C=C)=O)C/C1=C\C2=CC=C([N+]([O-])=O)C=C2)=C/C3=CC=C([N+]([O-])=O)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ITX3, CAS:347323-96-0, Molecular Weight: 371.4549, C22H17N3OS, Purity:98, SMILES: O=C(/C1=C\C2=C(C)N(C(C)=C2)C3=CC=CC=C3)N4C(S1)=NC5=CC=CC=C45, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AMG-208, CAS:1002304-34-8, Molecular Weight: 383.4027, C22H17N5O2, Purity:98, SMILES: COC1=CC=C2C(OCC3=NN=C4N3N=C(C=C4)C5=CC=CC=C5)=CC=NC2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CHIR-99021, CAS:252917-06-9, Molecular Weight: 465.3379, C22H18Cl2N8, Purity:98, SMILES: N#CC1=CC=C(N=C1)NCCNC2=NC=C(C(C3=CC=C(Cl)C=C3Cl)=N2)C4=NC=C(N4)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ISA-2011B, CAS:1395347-24-6, Molecular Weight: 423.849, C22H18ClN3O4, Purity:98, SMILES: O=C(N1[C@H](C2=CNC3=C2C=C(Cl)C=C3)C4=C(C=C5C(OCO5)=C4)C[C@]16[H])CN(C)C6=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BET-BAY 002, CAS:1588521-78-1, Molecular Weight: 403.8642, C22H18ClN5O, Purity:98, SMILES: CC1=NN=C(C[C@H]2C3=NN=C(C)N3C4=CC=CC=C4C(C5=CC=C(Cl)C=C5)=C2)O1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BET-BAY 002 (S enantiomer), CAS:, Molecular Weight: 403.8642, C22H18ClN5O, Purity:98, SMILES: CC1=NN=C2N1C3=CC=CC=C3C(C4=CC=C(Cl)C=C4)=C[C@@H]2CC5=NN=C(C)O5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Banoxantrone (D12 dihydrochloride), CAS:1562066-98-1, Molecular Weight: 529.476741336, C22H18D12Cl2N4O6, Purity:98, SMILES: O=N(C([2H])([2H])[2H])(C([2H])([2H])[2H])CCNC1=CC=C(NCCN(C([2H])([2H])[2H])(C([2H])([2H])[2H])=O)C(C(C2=C(O)C=CC(O)=C23)=O)=C1C3=O.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BRAF inhibitor, CAS:918505-61-0, Molecular Weight: 456.4651, C22H18F2N4O3S, Purity:98, SMILES: CC(C)S(=O)(NC1=CC=C(C(C(C2=CNC3=NC=C(C=C32)C4=CC=CN=C4)=O)=C1F)F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GW843682X, CAS:660868-91-7, Molecular Weight: 477.4562, C22H18F3N3O4S, Purity:98, SMILES: O=C(C1=C(OCC2=CC=CC=C2C(F)(F)F)C=C(N3C4=CC(OC)=C(OC)C=C4N=C3)S1)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| E7046, CAS:1369489-71-3, Molecular Weight: 483.388036, C22H18F5N3O4, Purity:98, SMILES: O=C(O)C1=CC=C([C@@H](NC(C2=C(OC3=CC=CC(C(F)(F)F)=C3)N(C)N=C2C(F)F)=O)C)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZM323881, CAS:193001-14-8, Molecular Weight: 375.3956, C22H18FN3O2, Purity:98, SMILES: CC1=C(O)C=C(NC2=C3C=CC(OCC4=CC=CC=C4)=CC3=NC=N2)C(F)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| EW-7197, CAS:1352608-82-2, Molecular Weight: 399.4236, C22H18FN7, Purity:98, SMILES: CC1=CC=CC(C2=C(C3=CN4C(C=C3)=NC=N4)NC(CNC5=CC=CC=C5F)=N2)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CAL-101, CAS:870281-82-6, Molecular Weight: 415.423, C22H18FN7O, Purity:98, SMILES: O=C1N(C2=CC=CC=C2)C([C@@H](NC3=C4N=CNC4=NC=N3)CC)=NC5=C1C(F)=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(Triphenylmethyl)imidazole, CAS:15469-97-3, Molecular Weight: 310.3917, C22H18N2, Purity:95, SMILES: N1(C(C2=CC=CC=C2)(C3=CC=CC=C3)C4=CC=CC=C4)C=CN=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bifonazole, CAS:60628-96-8, Molecular Weight: 310.3917, C22H18N2, Purity:98, SMILES: N1(C(C2=CC=C(C3=CC=CC=C3)C=C2)C4=CC=CC=C4)C=CN=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BM152054, CAS:213411-84-8, Molecular Weight: 470.58432, C22H18N2O4S3, Purity:98, SMILES: O=C(N1)SC(CC2=C3C(C=CS3)=C(OCCC4=C(C)OC(C5=CC=CS5)=N4)C=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IWP-2, CAS:686770-61-6, Molecular Weight: 466.5989, C22H18N4O2S3, Purity:98, SMILES: O=C(NC1=NC2=CC=C(C)C=C2S1)CSC3=NC(CCS4)=C4C(N3C5=CC=CC=C5)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rilpivirine, CAS:500287-72-9, Molecular Weight: 366.4185, C22H18N6, Purity:98, SMILES: CC1=CC(/C=C/C#N)=CC(C)=C1NC2=CC=NC(NC3=CC=C(C=C3)C#N)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (-)-Catechin gallate, CAS:130405-40-2, Molecular Weight: 442.3723, C22H18O10, Purity:98, SMILES: O=C(O[C@H]1[C@H](C2=CC=C(O)C(O)=C2)OC3=CC(O)=CC(O)=C3C1)C4=CC(O)=C(O)C(O)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (-)-Epicatechin gallate, CAS:1257-08-5, Molecular Weight: 442.3723, C22H18O10, Purity:98, SMILES: O=C(O[C@H]1[C@@H](C2=CC=C(O)C(O)=C2)OC3=CC(O)=CC(O)=C3C1)C4=CC(O)=C(O)C(O)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (-)-Epigallocatechin Gallate, CAS:989-51-5, Molecular Weight: 458.3717, C22H18O11, Purity:98, SMILES: O=C(O[C@H]1[C@@H](C2=CC(O)=C(O)C(O)=C2)OC3=CC(O)=CC(O)=C3C1)C4=CC(O)=C(O)C(O)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (-)-Gallocatechin gallate, CAS:4233-96-9, Molecular Weight: 458.3717, C22H18O11, Purity:98, SMILES: O=C(O[C@H]1[C@H](C2=CC(O)=C(O)C(O)=C2)OC3=CC(O)=CC(O)=C3C1)C4=CC(O)=C(O)C(O)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cichoric Acid, CAS:6537-80-0, Molecular Weight: 474.3711, C22H18O12, Purity:98, SMILES: O=C(O)[C@H](OC(/C=C/C1=CC=C(O)C(O)=C1)=O)[C@@H](OC(/C=C/C2=CC=C(O)C(O)=C2)=O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| L-Chicoric Acid, CAS:70831-56-0, Molecular Weight: 474.37112, C22H18O12, Purity:98, SMILES: O=C(O[C@@H](C(O)=O)[C@H](C(O)=O)OC(/C=C/C1=CC=C(O)C(O)=C1)=O)/C=C/C2=CC=C(O)C(O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| P7C3-A20, CAS:1235481-90-9, Molecular Weight: 506.2055, C22H19Br2FN2O, Purity:98, SMILES: FC(CNC1=CC(OC)=CC=C1)CN2C3=CC=C(Br)C=C3C4=CC(Br)=CC=C24, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PP58, CAS:212391-58-7, Molecular Weight: 456.3246, C22H19Cl2N5O2, Purity:98, SMILES: NCCOC1=CC=C(NC(N=C2N3C)=NC=C2C=C(C4=C(Cl)C=CC=C4Cl)C3=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CHIR-99021 (monohydrochloride), CAS:1797989-42-4, Molecular Weight: 501.7989, C22H19Cl3N8, Purity:98, SMILES: N#CC1=CC=C(NCCNC2=NC=C(C3=NC=C(C)N3)C(C4=CC=C(Cl)C=C4Cl)=N2)N=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZM323881 (hydrochloride), CAS:193000-39-4, Molecular Weight: 411.8566, C22H19ClFN3O2, Purity:98, SMILES: CC1=C(O)C=C(NC2=C3C=CC(OCC4=CC=CC=C4)=CC3=NC=N2)C(F)=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tivozanib, CAS:475108-18-0, Molecular Weight: 454.8631, C22H19ClN4O5, Purity:98, SMILES: O=C(NC1=CC=C(C=C1Cl)OC2=CC=NC3=CC(OC)=C(C=C23)OC)NC4=NOC(C)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Varlitinib, CAS:845272-21-1, Molecular Weight: 466.9433, C22H19ClN6O2S, Purity:98, SMILES: C[C@H]1N=C(NC2=CC3=C(NC4=CC=C(OCC5=NC=CS5)C(Cl)=C4)N=CN=C3C=C2)OC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PNU-248686A, CAS:341498-89-3, Molecular Weight: 485.9555, C22H19ClNaO5S2+, Purity:98, SMILES: O=C(O)[C@](CSC1=CC=CC=C1)(O)CS(=O)(C2=CC=C(C3=CC=C(Cl)C=C3)C=C2)=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Atovaquone, CAS:95233-18-4, Molecular Weight: 366.8375, C22H19ClO3, Purity:98, SMILES: O=C1C([C@H]2CC[C@H](C3=CC=C(Cl)C=C3)CC2)=C(O)C(C4=C1C=CC=C4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Losartan D4, CAS:1030937-27-9, Molecular Weight: 426.9353, C22H19D4ClN6O, Purity:98, SMILES: OCC1=C(Cl)N=C(CCCC)N1CC2=C([2H])C([2H])=C(C3=CC=CC=C3C4=NNN=N4)C([2H])=C2[2H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mivebresib, CAS:1445993-26-9, Molecular Weight: 459.4658, C22H19F2N3O4S, Purity:98, SMILES: CCS(=O)(NC1=CC=C(OC2=CC=C(F)C=C2F)C(C3=CN(C)C(C4=C3C=CN4)=O)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CHZ868, CAS:1895895-38-1, Molecular Weight: 423.4154, C22H19F2N5O2, Purity:98, SMILES: CC(NC1=CC(OC2=CC=C(N(C)C(NC3=CC=C(F)C=C3F)=N4)C4=C2C)=CC=N1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AD80, CAS:1384071-99-1, Molecular Weight: 473.4261728, C22H19F4N7O, Purity:98, SMILES: O=C(NC1=CC(C(F)(F)F)=CC=C1F)NC2=CC=C(C3=NN(C(C)C)C4=NC=NC(N)=C43)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chidamide, CAS:743420-02-2, Molecular Weight: 390.4102632, C22H19FN4O2, Purity:98, SMILES: O=C(NC1=CC(F)=CC=C1N)C2=CC=C(CNC(/C=C/C3=CC=CN=C3)=O)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MK-0557, CAS:328232-95-7, Molecular Weight: 406.4097, C22H19FN4O3, Purity:98, SMILES: O=C([C@H]1CC[C@@](C2=C3C=CN=C2)(OC3=O)CC1)NC4=NN(C5=CC=CC=C5F)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CDD3506, CAS:197913-15-8, Molecular Weight: 325.40636, C22H19N3, Purity:98, SMILES: NC1=CN(C(C2=CC=CC=C2)(C3=CC=CC=C3)C4=CC=CC=C4)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML281, CAS:1404437-62-2, Molecular Weight: 389.4702, C22H19N3O2S, Purity:98, SMILES: O=C1NC2=CC=CC=C2N=C1C3=CC(C(C)C)=CC=C3NC(C4=CC=CS4)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Src Inhibitor 1, CAS:179248-59-0, Molecular Weight: 373.40456, C22H19N3O3, Purity:98, SMILES: COC1=CC2=NC=NC(NC3=CC=C(OC4=CC=CC=C4)C=C3)=C2C=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tadalafil, CAS:171596-29-5, Molecular Weight: 389.404, C22H19N3O4, Purity:98, SMILES: O=C([C@@]1([H])CC2=C([C@@H](C3=CC=C(OCO4)C4=C3)N15)NC6=C2C=CC=C6)N(C)CC5=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| KS176, CAS:1253452-78-6, Molecular Weight: 405.4034, C22H19N3O5, Purity:98, SMILES: O=C(C1=C(NC(C2=CC=C([N+]([O-])=O)C=C2)=O)C=CC=C1)NC3=CC=C(CCO)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IKK-3 Inhibitor, CAS:862812-98-4, Molecular Weight: 469.5334, C22H19N3O5S2, Purity:98, SMILES: COC1=CC2=C(C=C1OC)N(C3=CC(OCC4=CC=CC=C4S(=O)(C)=O)=C(C#N)S3)C=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefsulodin (sodium), CAS:52152-93-9, Molecular Weight: 554.528, C22H19N4NaO8S2, Purity:98, SMILES: O=C(N[C@H]1[C@@]2([H])SCC(C[N+]3=CC=C(C(N)=O)C=C3)=C(C([O-])=O)N2C1=O)[C@@H](C4=CC=CC=C4)S(=O)([O-])=O.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY2157299, CAS:700874-72-2, Molecular Weight: 369.4192, C22H19N5O, Purity:98, SMILES: CC1=CC=CC(C2=NN3C(CCC3)=C2C4=CC=NC5=C4C=C(C=C5)C(N)=O)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acumapimod, CAS:836683-15-9, Molecular Weight: 385.4185, C22H19N5O2, Purity:98, SMILES: O=C(NC1CC1)C2=CC=C(C)C(N3N=CC(C(C4=CC=CC(C#N)=C4)=O)=C3N)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IC-87114, CAS:371242-69-2, Molecular Weight: 397.4326, C22H19N7O, Purity:98, SMILES: O=C1N(C(CN2C3=C(C(N)=NC=N3)N=C2)=NC4=CC=CC(C)=C14)C5=C(C)C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diphenylmethylene-glycine benzyl ester, CAS:81477-91-0, Molecular Weight: 329.3918, C22H19NO2, Purity:95, SMILES: O=C(CN=C(c1ccccc1)c1ccccc1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bisacodyl, CAS:603-50-9, Molecular Weight: 361.3906, C22H19NO4, Purity:98, SMILES: CC(OC1=CC=C(C(C2=CC=C(OC(C)=O)C=C2)C3=NC=CC=C3)C=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)-3-(thiophen-3-yl)propanoic acid, CAS:186320-06-9, Molecular Weight: 393.456, C22H19NO4S, Purity:95, SMILES: OC(=O)[C@H](Cc1ccsc1)NC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 4,5-bis(benzyloxy)-2-nitrobenzoate, CAS:, Molecular Weight: 393.3894, C22H19NO6, Purity:95, SMILES: O=C(OC)C1=CC(OCC2=CC=CC=C2)=C(OCC3=CC=CC=C3)C=C1[N+]([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JI-101, CAS:900573-88-8, Molecular Weight: 466.3305, C22H20BrN5O2, Purity:98, SMILES: O=C(NC1=CC(Br)=CC=C1OC)NC2=CC=CC3=C2C=CN3CC4=CC(N)=NC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Pyridineacetamide, 3-chloro-N-[(1R)-1-(3-chlorophenyl)ethyl]-6-[[2,2-difluoro-2-(1-oxido-2-pyridinyl)ethyl]amino]-, 1-oxide, CAS:855998-46-8, Molecular Weight: 497.3220064, C22H20Cl2F2N4O3, Purity:98, SMILES: C[C@H](C1=CC(Cl)=CC=C1)NC(CC2=C(Cl)C=CC(NCC(F)(C3=CC=CC=N3=O)F)=N2=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LUF6000, CAS:890087-21-5, Molecular Weight: 411.327, C22H20Cl2N4, Purity:98, SMILES: ClC1=CC(NC2=NC3=C(C=CC=C3)C4=C2NC(C5CCCCC5)=N4)=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| A-1165442, CAS:1221443-94-2, Molecular Weight: 431.8629, C22H20ClF2N3O2, Purity:98, SMILES: O=C(NC1=CC=CC2=C1C=C(C)N=C2)N[C@H]3C4=CC=C(Cl)C=C4OC(CF)(CF)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Indoramin D5, CAS:57165-41-0, Molecular Weight: 352.4842, C22H20D5N3O, Purity:98, SMILES: O=C(C1=C([2H])C([2H])=C([2H])C([2H])=C1[2H])NC2CCN(CCC3=CNC4=CC=CC=C43)CC2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lemborexant, CAS:1369764-02-2, Molecular Weight: 410.4166, C22H20F2N4O2, Purity:98, SMILES: O=C([C@H]1[C@@](C2=CC=CC(F)=C2)(COC3=CN=C(C)N=C3C)C1)NC4=NC=C(F)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-573228, CAS:869288-64-2, Molecular Weight: 491.4861, C22H20F3N5O3S, Purity:98, SMILES: O=C1NC2=C(C=C(NC3=NC=C(C(F)(F)F)C(NCC4=CC=CC(S(=O)(C)=O)=C4)=N3)C=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RO4929097, CAS:847925-91-1, Molecular Weight: 469.4045, C22H20F5N3O3, Purity:98, SMILES: O=C(C(C)(C(NCC(F)(C(F)(F)F)F)=O)C)N[C@H]1C2=CC=CC=C2C3=CC=CC=C3NC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IM-12, CAS:1129669-05-1, Molecular Weight: 377.4115, C22H20FN3O2, Purity:98, SMILES: O=C(C(NCCC1=CC=C(F)C=C1)=C2C3=C(C)NC4=C3C=CC=C4)N(C)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-Isoindole-1,3(2H)-dione, 2-[2-[4-(6-fluoro-1,2-benzisoxazol-3-yl)-1-piperidinyl]ethyl]-, CAS:131999-28-5, Molecular Weight: 393.4109032, C22H20FN3O3, Purity:98, SMILES: O=C1N(CCN2CCC(C3=NOC4=C3C=CC(F)=C4)CC2)C(C5=C1C=CC=C5)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GNE-495, CAS:1449277-10-4, Molecular Weight: 405.4249, C22H20FN5O2, Purity:98, SMILES: O=C(C1=C2C=CC(C3=CC=CC(F)=C3)=NC2=C(N)N=C1)NC4CN(C(C5CC5)=O)C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML365, CAS:947914-18-3, Molecular Weight: 360.4058, C22H20N2O3, Purity:98, SMILES: O=C(C1=C(OC)C=CC=C1)NC2=CC=CC(NC(C3=CC=CC(C)=C3)=O)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BM-131246, CAS:103787-97-9, Molecular Weight: 408.4702, C22H20N2O4S, Purity:98, SMILES: O=C(N1)SC(CC2=CC=C(OCCC3=C(C)OC(C4=CC=CC=C4)=N3)C=C2)C1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-4,11-diethyl-4,9-dihydroxy-1H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14(4H,12H)-dione, CAS:86639-52-3, Molecular Weight: 392.4046, C22H20N2O5, Purity:95, SMILES: CCc1c2Cn3c(cc4c(COC(=O)[C@]4(O)CC)c3=O)-c2nc2ccc(O)cc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SN-38, CAS:86639-52-3, Molecular Weight: 392.4046, C22H20N2O5, Purity:98, SMILES: O=C1[C@](O)(CC)C2=C(CO1)C(N3CC4=C(CC)C5=CC(O)=CC=C5N=C4C3=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| HMN-214, CAS:173529-46-9, Molecular Weight: 424.4696, C22H20N2O5S, Purity:98, SMILES: CC(N(C1=C(C=CC=C1)/C=C/C2=CC=N(C=C2)=O)S(C3=CC=C(C=C3)OC)(=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| DBeQ, CAS:177355-84-9, Molecular Weight: 340.421, C22H20N4, Purity:98, SMILES: C1(NCC2=CC=CC=C2)=NC(NCC3=CC=CC=C3)=C4C=CC=CC4=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| QNZ, CAS:545380-34-5, Molecular Weight: 356.4204, C22H20N4O, Purity:98, SMILES: NC1=CC2=C(NCCC3=CC=C(OC4=CC=CC=C4)C=C3)N=CN=C2C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| hPGDS-IN-1, CAS:1234708-04-3, Molecular Weight: 416.4326, C22H20N6O3, Purity:98, SMILES: OC(C)(C)C1=NC(C2=CC(CNC(C(C=N3)=CN=C3C4=CC=CC=N4)=O)=CC=C2)=NO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-(?)-Glycidyl trityl ether , CAS:129940-50-7, Molecular Weight: 316.393, C22H20O2, Purity:95, SMILES: C(OC(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1)[C@@H]1CO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-((Trityloxy)methyl)oxirane, CAS:129940-50-7, Molecular Weight: 316.393, C22H20O2, Purity:97, SMILES: C(OC(c1ccccc1)(c1ccccc1)c1ccccc1)[C@@H]1CO1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2,4-Bis(BenzyloxyPhenylEthanone, CAS:22877-01-6, Molecular Weight: 332.3924, C22H20O3, Purity:95, SMILES: CC(=O)C1=CC=C(OCC2=CC=CC=C2)C=C1OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-(2,6-Bis(BenzyloxyPhenylEthanone, CAS:3886-19-9, Molecular Weight: 332.3924, C22H20O3, Purity:95, SMILES: CC(=O)C1=C(OCC2=CC=CC=C2)C=CC=C1OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2',4'-Bis(benzyloxy)acetophenone, CAS:22877-01-6, Molecular Weight: 332.3924, C22H20O3, Purity:90, SMILES: CC(=O)c1ccc(cc1OCc1ccccc1)OCc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzenepropanol, 5-bromo-g-phenyl-2-(phenylmethoxy)-, ()-, CAS:156755-25-8, Molecular Weight: 397.305, C22H21BrO2, Purity:97, SMILES: OCCC(c1cc(Br)ccc1OCc1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AM251, CAS:183232-66-8, Molecular Weight: 555.2388, C22H21Cl2IN4O, Purity:98, SMILES: O=C(C1=NN(C2=CC=C(Cl)C=C2Cl)C(C3=CC=C(I)C=C3)=C1C)NN4CCCCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-8380, CAS:1144035-53-9, Molecular Weight: 478.3252, C22H21Cl2N3O5, Purity:98, SMILES: O=C(N1CCN(CC1)CCC(C2=CC(O3)=C(C=C2)NC3=O)=O)OCC4=CC(Cl)=CC(Cl)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| L-778123 (hydrochloride), CAS:253863-00-2, Molecular Weight: 442.341, C22H21Cl2N5O, Purity:98, SMILES: N#CC1=CC=C(CN2C(CN3CC(N(C4=CC=CC(Cl)=C4)CC3)=O)=CN=C2)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rimonabant, CAS:168273-06-1, Molecular Weight: 463.7874, C22H21Cl3N4O, Purity:98, SMILES: ClC1=CC=C(C=C1)C2=C(C(C(NN3CCCCC3)=O)=NN2C4=CC=C(C=C4Cl)Cl)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CHIR-99021 (trihydrochloride), CAS:1782235-14-6, Molecular Weight: 574.7208, C22H21Cl5N8, Purity:98, SMILES: N#CC1=CC=C(NCCNC2=NC=C(C3=NC=C(C)N3)C(C4=CC=C(Cl)C=C4Cl)=N2)N=C1.[H]Cl.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MK-5108, CAS:1010085-13-8, Molecular Weight: 461.9368432, C22H21ClFN3O3S, Purity:98, SMILES: FC(C(Cl)=CC=C1)=C1O[C@H](CC2)CC[C@@]2(C(O)=O)CC3=CC=CC(NC4=NC=CS4)=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CID 2011756, CAS:638156-11-3, Molecular Weight: 396.8667, C22H21ClN2O3, Purity:98, SMILES: O=C(C1=CC=C(C2=CC=CC(Cl)=C2)O1)NC3=CC=C(CN4CCOCC4)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vercirnon, CAS:698394-73-9, Molecular Weight: 444.9312, C22H21ClN2O4S, Purity:98, SMILES: O=S(C1=CC=C(C(C)(C)C)C=C1)(NC2=CC=C(Cl)C=C2C(C3=CC=[N+]([O-])C=C3)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SJ-172550, CAS:431979-47-4, Molecular Weight: 428.8655, C22H21ClN2O5, Purity:98, SMILES: O=C(/C1=C/C2=CC(Cl)=C(OCC(OC)=O)C(OCC)=C2)N(N=C1C)C3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BMS-687453, CAS:1000998-59-3, Molecular Weight: 444.8649, C22H21ClN2O6, Purity:98, SMILES: ClC(C=C1)=CC=C1C2=NC(COC3=CC=CC(CN(C(OC)=O)CC(O)=O)=C3)=C(C)O2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BMS-191095, CAS:166095-21-2, Molecular Weight: 408.88074, C22H21ClN4O2, Purity:98, SMILES: CC(O1)(C)[C@H](O)[C@@H](N(CC2=NC=CN2)C3=CC=C(Cl)C=C3)C4=C1C=CC(C#N)=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-((3-(5-chloro-2-methoxyphenyl)ureido)methyl)phenoxy)-N-methylpicolinamide, CAS:1349244-89-8, Molecular Weight: 440.88, C22H21ClN4O4, Purity:95, SMILES: O=C(NC)C1=CC(OC2=CC=C(CNC(NC3=C(OC)C=CC(Cl)=C3)=O)C=C2)=CC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ER21355, CAS:150452-18-9, Molecular Weight: 440.87954, C22H21ClN4O4, Purity:98, SMILES: O=C(C1CCN(C2=NC(NCC3=CC=C(OCO4)C4=C3)=C5C=C(Cl)C=CC5=N2)CC1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rosuvastatin (D6 Sodium), CAS:, Molecular Weight: 509.5564, C22H21D6FN3NaO6S, Purity:98, SMILES: O=C([O-])C[C@H](O)C[C@H](O)/C=C/C1=C(C(C([2H])([2H])[2H])C([2H])([2H])[2H])N=C(N(C)S(=O)(C)=O)N=C1C2=CC=C(F)C=C2.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rosuvastatin (D6 Calcium), CAS:, Molecular Weight: 506.61, C22H21D6FN3O6S . 1/2 Ca, Purity:98, SMILES: O=C([O-])C[C@H](O)C[C@H](O)/C=C/C1=C(C(C([2H])([2H])[2H])C([2H])([2H])[2H])N=C(N(C)S(=O)(C)=O)N=C1C2=CC=C(F)C=C2.[0.5Ca2+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| LJH685, CAS:1627710-50-2, Molecular Weight: 381.4185, C22H21F2N3O, Purity:98, SMILES: OC1=C(F)C=C(C2=C(C3=CC=C(N4CCN(C)CC4)C=C3)C=CN=C2)C=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sch412348, CAS:377727-26-9, Molecular Weight: 465.4586464, C22H21F2N9O, Purity:98, SMILES: NC1=NC(N(CCN2CCN(C3=CC=C(F)C=C3F)CC2)N=C4)=C4C5=NC(C6=CC=CO6)=NN15, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RET Kinase inhibitor 1, CAS:1627856-64-7, Molecular Weight: 467.4135, C22H21F4N3O4, Purity:98, SMILES: O=C(NC1=NOC(C(C)(C)C(F)(F)F)=C1)CC2=CC=C(C(C(OCC)=C3)=CNC3=O)C=C2F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lusaperidone, CAS:214548-46-6, Molecular Weight: 359.42104, C22H21N3O2, Purity:98, SMILES: O=C1C(CCN2CCC(OC3=CC=CC=C34)=C4C2)=C(C)N=C5N1C=CC=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| YM-90709, CAS:163769-88-8, Molecular Weight: 359.4211, C22H21N3O2, Purity:98, SMILES: CC(CC1=CC(OC)=C(OC)C=C12)(C)N3C2=CC4=NC5=CC=CC=C5N=C43, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AFN-1252, CAS:620175-39-5, Molecular Weight: 375.4204, C22H21N3O3, Purity:98, SMILES: O=C(N(C)CC1=C(C)C2=CC=CC=C2O1)/C=C/C(C=C3CC4)=CNC3=NC4=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ANA-12, CAS:219766-25-3, Molecular Weight: 407.4854, C22H21N3O3S, Purity:98, SMILES: O=C(C1=CC2=CC=CC=C2S1)NC3=CC=CC=C3C(NC4C(NCCCC4)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ML141, CAS:71203-35-5, Molecular Weight: 407.4854, C22H21N3O3S, Purity:98, SMILES: O=S(C1=CC=C(N2N=C(C3=CC=CC=C3)CC2C4=CC=C(OC)C=C4)C=C1)(N)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Icotinib, CAS:610798-31-7, Molecular Weight: 391.4198, C22H21N3O4, Purity:98, SMILES: C#CC1=CC(NC2=C(C=C(OCCOCCOCCO3)C3=C4)C4=NC=N2)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Genz-644282, CAS:529488-28-6, Molecular Weight: 407.4193, C22H21N3O5, Purity:98, SMILES: O=C1N(CCNC)C2=C(C=NC(C2=C3)=CC4=C3OCO4)C5=CC(OC)=C(OC)C=C15, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PCI 29732, CAS:330786-25-9, Molecular Weight: 371.435, C22H21N5O, Purity:98, SMILES: NC1=NC=NC2=C1C(C3=CC=C(OC4=CC=CC=C4)C=C3)=NN2C5CCCC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| H-Cys(Trt)-OH, CAS:328542, Molecular Weight: 363.473, C22H21NO2S, Purity:95, SMILES: N[C@@H](CSC(c1ccccc1)(c1ccccc1)c1ccccc1)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GW9508, CAS:885101-89-3, Molecular Weight: 347.407, C22H21NO3, Purity:98, SMILES: O=C(O)CCC1=CC=C(NCC2=CC=CC(OC3=CC=CC=C3)=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 2-amino-4,5-bis(benzyloxy)benzoate, CAS:, Molecular Weight: 363.4064, C22H21NO4, Purity:95, SMILES: O=C(OC)C1=CC(OCC2=CC=CC=C2)=C(OCC3=CC=CC=C3)C=C1N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Asp(OAll)-OH, CAS:146982-24-3, Molecular Weight: 395.4052, C22H21NO6, Purity:97, SMILES: OC(=O)[C@H](CC(=O)OCC=C)NC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 2-(triphenylphosphoranyl, CAS:1099-45-2, Molecular Weight: 348.3747, C22H21O2P, Purity:95, SMILES: CCOC(=O)C=P(c1ccccc1)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (Cyclopropylmethyl)triphenylphosphonium bromide, CAS:14799-82-7, Molecular Weight: 397.288, C22H22BrP, Purity:95, SMILES: C1CC1C[P+](c1ccccc1)(c1ccccc1)c1ccccc1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Zofenopril (calcium), CAS:81938-43-4, Molecular Weight: 448.58, C22H22Ca0.5NO4S2, Purity:98, SMILES: O=C(N(C[C@@H](SC1=CC=CC=C1)C2)[C@@H]2C([O-])=O)[C@H](C)CSC(C3=CC=CC=C3)=O.[0.5Ca2+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-8380 (hydrochloride), CAS:, Molecular Weight: 514.7862, C22H22Cl3N3O5, Purity:98, SMILES: O=C(N1CCN(CC1)CCC(C2=CC(O3)=C(C=C2)NC3=O)=O)OCC4=CC(Cl)=CC(Cl)=C4.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rimonabant (Hydrochloride), CAS:158681-13-1, Molecular Weight: 500.2483, C22H22Cl4N4O, Purity:98, SMILES: ClC1=CC=C(C2=C(C)C(C(NN3CCCCC3)=O)=NN2C4=CC=C(Cl)C=C4Cl)C=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AGN 195183, CAS:367273-07-2, Molecular Weight: 437.8642, C22H22ClF2NO4, Purity:98, SMILES: O=C(O)C1=C(F)C=C(NC(C2=C(O)C(Cl)=C3C(C)(C)CCC(C)(C)C3=C2)=O)C=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Losartan (potassium), CAS:124750-99-8, Molecular Weight: 461.001, C22H22ClKN6O, Purity:98, SMILES: OCC1=C(Cl)N=C(CCCC)N1CC2=CC=C(C3=CC=CC=C3C4=NNN=N4)C=C2.[K+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Icotinib (Hydrochloride), CAS:1204313-51-8, Molecular Weight: 427.8808, C22H22ClN3O4, Purity:98, SMILES: C#CC1=CC(NC2=C(C=C(OCCOCCOCCO3)C3=C4)C4=NC=N2)=CC=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AKP-11, CAS:1220973-37-4, Molecular Weight: 443.88018, C22H22ClN3O5, Purity:98, SMILES: OCC(C1=CC2=CC(C3=NOC(C4=CC=C(OCCC)C(Cl)=C4)=N3)=CC=C2O1)(N)CO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK 525762A, CAS:1260907-17-2, Molecular Weight: 423.8954, C22H22ClN5O2, Purity:98, SMILES: ClC1=CC=C(C2=N[C@@H](CC(NCC)=O)C3=NN=C(C)N3C4=CC=C(OC)C=C24)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK 525768A, CAS:1260530-25-3, Molecular Weight: 423.8954, C22H22ClN5O2, Purity:98, SMILES: O=C(NCC)C[C@@H]1C2=NN=C(C)N2C3=CC=C(OC)C=C3C(C4=CC=C(Cl)C=C4)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethanone, 1-[4-(4-chloro-3-methoxyphenyl)-1-piperazinyl]-2-[3-(1H-imidazol-2-yl)-1H-pyrazolo[3,4-b]pyridin-1-yl]-, CAS:1010073-75-2, Molecular Weight: 451.90878, C22H22ClN7O2, Purity:98, SMILES: COC1=CC(N2CCN(C(CN3N=C(C4=NC=CN4)C5=CC=CN=C53)=O)CC2)=CC=C1Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cinacalcet, CAS:226256-56-0, Molecular Weight: 357.412, C22H22F3N, Purity:98, SMILES: FC(F)(C1=CC(CCCN[C@@H](C2=C3C=CC=CC3=CC=C2)C)=CC=C1)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK2636771, CAS:1372540-25-4, Molecular Weight: 433.4235896, C22H22F3N3O3, Purity:98, SMILES: CC1=NC2=C(C(O)=O)C=C(C=C2N1CC3=CC=CC(C(F)(F)F)=C3C)N4CCOCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| I-BRD9, CAS:1714146-59-4, Molecular Weight: 497.5536, C22H22F3N3O3S2, Purity:98, SMILES: N=C(C(S1)=CC2=C1C(C3=CC=CC(C(F)(F)F)=C3)=CN(CC)C2=O)NC(CC4)CCS4(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WQ3810, CAS:888032-58-4, Molecular Weight: 461.4369896, C22H22F3N5O3, Purity:98, SMILES: O=C(C1=CN(C2=NC(N)=C(F)C=C2F)C3=C(C=C(F)C(N4CC(NC(C)C)C4)=C3C)C1=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Droperidol, CAS:548-73-2, Molecular Weight: 379.4274, C22H22FN3O2, Purity:98, SMILES: O=C1NC2=CC=CC=C2N1C3=CCN(CCCC(C4=CC=C(F)C=C4)=O)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD-2461, CAS:1174043-16-3, Molecular Weight: 395.4268, C22H22FN3O3, Purity:98, SMILES: O=C1NN=C(CC2=CC=C(F)C(C(N3CCC(OC)CC3)=O)=C2)C4=C1C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ketanserin, CAS:74050-98-9, Molecular Weight: 395.4268, C22H22FN3O3, Purity:98, SMILES: O=C(C1=CC=CC=C1N2)N(CCN3CCC(C(C4=CC=C(F)C=C4)=O)CC3)C2=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Nav1.7-IN-2, CAS:1332295-35-8, Molecular Weight: 407.4408, C22H22FN5O2, Purity:98, SMILES: #828bz978ax78iSBXiN7XiN78ax7Sj9QIz97IspQSyN78a17N797Iz978auhIz97
NaShIzShXi+s8b97SI==
, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AVL-292, CAS:1202757-89-8, Molecular Weight: 423.4402, C22H22FN5O3, Purity:98, SMILES: COCCOC1=CC=C(NC2=NC=C(F)C(NC3=CC=CC(NC(C=C)=O)=C3)=N2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK-J1 (lithium salt), CAS:, Molecular Weight: 395.3834, C22H22LiN5O2, Purity:98, SMILES: [Li]OC(CCNC1=NC(C2=NC=CC=C2)=NC(N(CC3)CCC4=C3C=CC=C4)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ABT-239, CAS:460746-46-7, Molecular Weight: 330.4229, C22H22N2O, Purity:98, SMILES: C[C@H]1N(CCC2=CC3=C(C=CC(C4=CC=C(C#N)C=C4)=C3)O2)CCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PLpro inhibitor, CAS:1093070-14-4, Molecular Weight: 346.4223, C22H22N2O2, Purity:98, SMILES: O=C(C1=CC(NC(C)=O)=CC=C1C)N[C@H](C)C2=C(C=CC=C3)C3=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ambrisentan, CAS:177036-94-1, Molecular Weight: 378.4211, C22H22N2O4, Purity:98, SMILES: O=C([C@H](C(OC)(C1=CC=CC=C1)C2=CC=CC=C2)OC3=NC(C)=CC(C)=N3)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ambrisentan, CAS:177036-94-1, Molecular Weight: 378.4211, C22H22N2O4, Purity:98, SMILES: COC([C@H](Oc1nc(C)cc(C)n1)C(O)=O)(c1ccccc1)c1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Varespladib methyl, CAS:172733-08-3, Molecular Weight: 394.4205, C22H22N2O5, Purity:98, SMILES: O=C(OC)COC1=CC=CC2=C1C(C(C(N)=O)=O)=C(CC)N2CC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| A-674563, CAS:552325-73-2, Molecular Weight: 358.4363, C22H22N4O, Purity:98, SMILES: N[C@@H](CC1=CC=CC=C1)COC2=CC(C3=CC4=C(C=C3)NN=C4C)=CN=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BMS-378806, CAS:357263-13-9, Molecular Weight: 406.4345, C22H22N4O4, Purity:98, SMILES: COC1=C2C(NC=C2C(C(N3CCN(C[C@H]3C)C(C4=CC=CC=C4)=O)=O)=O)=NC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ethyl 6-(4-aminophenyl)-1-(4-methoxyphenyl)-7-oxo-4,5,6,7-tetrahydro-1H-pyrazolo[3,4-c]pyridine-3-carboxylate, CAS:503615-07-4, Molecular Weight: 406.4345, C22H22N4O4, Purity:99, SMILES: CCOC(=O)c1nn(c2c1CCN(C2=O)c1ccc(cc1)N)c1ccc(cc1)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| S49076, CAS:1265965-22-7, Molecular Weight: 438.4995, C22H22N4O4S, Purity:98, SMILES: O=C(N1CC2=CC3=C(NC(/C3=C\C4=CC(CN5CCOCC5)=CN4)=O)C=C2)SCC1=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-3-(4-phenoxyphenyl)-1-(piperidin-3-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine, CAS:1022150-12-4, Molecular Weight: 386.4497, C22H22N6O, Purity:98, SMILES: Nc1ncnc2n(nc(-c3ccc(Oc4ccccc4)cc3)c12)[C@@H]1CCCNC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Btk inhibitor 1, CAS:1412418-47-3, Molecular Weight: 386.4497, C22H22N6O, Purity:98, SMILES: NC1=C2C(N(C3CNCCC3)N=C2C4=CC=C(OC5=CC=CC=C5)C=C4)=NC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Btk inhibitor 1 (R enantiomer), CAS:1022150-12-4, Molecular Weight: 386.4497, C22H22N6O, Purity:98, SMILES: NC1=C2C(N([C@H]3CNCCC3)N=C2C4=CC=C(OC5=CC=CC=C5)C=C4)=NC=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CPI-637, CAS:1884712-47-3, Molecular Weight: 386.4497, C22H22N6O, Purity:98, SMILES: O=C1NC2=CC=CC(C3=CC4=C(N(C)N=C4C5=CN(C)N=C5)C=C3)=C2N[C@H](C)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FGFR-IN-1, CAS:1448169-71-8, Molecular Weight: 418.4485, C22H22N6O3, Purity:98, SMILES: O=C(C=C)N(C1)CC[C@@H]1N(N=C2C#CC3=CC(OC)=CC(OC)=C3)C4=C2C(N)=NC=N4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ceftazidime, CAS:72558-82-8, Molecular Weight: 546.576, C22H22N6O7S2, Purity:98, SMILES: O=C1[C@@H](NC(/C(C2=CSC(N)=N2)=N\OC(C)(C(O)=O)C)=O)[C@@]3([H])SCC(C[N+]4=CC=CC=C4)=C(C([O-])=O)N13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bisantrene, CAS:78186-34-2, Molecular Weight: 398.46368, C22H22N8, Purity:98, SMILES: C12=CC=CC=C1C(/C=N/NC3=NCCN3)=C4C(C=CC=C4)=C2/C=N/NC5=NCCN5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PI4KIII beta inhibitor 3, CAS:1245319-54-3, Molecular Weight: 446.5281, C22H22N8OS, Purity:98, SMILES: O=C(N1CCN(C2=C3C(SC(C4=CC=CN=C4)=N3)=NC(N)=N2)CC1)NC5=CC=C(C)C=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Calycosin-7-O-β-D-glucoside, CAS:20633-67-4, Molecular Weight: 446.4041, C22H22O10, Purity:98, SMILES: O=C1C2=CC=C(O[C@@H]([C@@H]([C@@H](O)[C@@H]3O)O)O[C@@H]3CO)C=C2OC=C1C4=CC(O)=C(OC)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glycitin, CAS:40246-10-4, Molecular Weight: 446.4041, C22H22O10, Purity:98, SMILES: O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](OC2=CC(OC=C(C3=CC=C(O)C=C3)C4=O)=C4C=C2OC)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Homoplantaginin, CAS:17680-84-1, Molecular Weight: 462.4035, C22H22O11, Purity:98, SMILES: OC1=C(C2=O)C(OC(C3=CC=C(O)C=C3)=C2)=CC(O[C@@H]([C@@H]([C@@H](O)[C@@H]4O)O)O[C@@H]4CO)=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AXL1717, CAS:477-47-4, Molecular Weight: 414.4053, C22H22O8, Purity:98, SMILES: O=C1OC[C@]2([H])[C@@H](O)C3=C(C=C4OCOC4=C3)[C@@H](C5=CC(OC)=C(OC)C(OC)=C5)[C@@]21[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Podophyllotoxin, CAS:518-28-5, Molecular Weight: 414.4053, C22H22O8, Purity:98, SMILES: O=C1OC[C@]2([H])[C@@H](O)C3=C(C=C4OCOC4=C3)[C@@H](C5=CC(OC)=C(OC)C(OC)=C5)[C@]21[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ononin, CAS:486-62-4, Molecular Weight: 430.4047, C22H22O9, Purity:98, SMILES: O[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)[C@@H]1OC2=CC=C(C(C(C3=CC=C(OC)C=C3)=CO4)=O)C4=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| K-Ras G12C-IN-1, CAS:1629265-17-3, Molecular Weight: 448.3423, C22H23Cl2N3O3, Purity:98, SMILES: ClC(C=C(OC)C(NCC(N1CCN(C(C=C)=O)CC1)=O)=C2)=C2C3=CC=CC=C3Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cinacalcet (hydrochloride), CAS:364782-34-3, Molecular Weight: 393.8729, C22H23ClF3N, Purity:98, SMILES: FC(F)(C1=CC(CCCN[C@@H](C2=C3C=CC=CC3=CC=C2)C)=CC=C1)F.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GNF179, CAS:1261114-01-5, Molecular Weight: 427.9023, C22H23ClFN5O, Purity:98, SMILES: CC1(C)C2=NC(C3=CC=C(F)C=C3)=C(NC4=CC=C(Cl)C=C4)N2CCN1C(CN)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD3759, CAS:1626387-80-1, Molecular Weight: 459.9011, C22H23ClFN5O3, Purity:98, SMILES: ClC1=CC=CC(NC2=NC=NC3=CC(OC)=C(OC(N4[C@H](C)CN(C)CC4)=O)C=C23)=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Loratadine, CAS:79794-75-5, Molecular Weight: 382.8832, C22H23ClN2O2, Purity:98, SMILES: O=C(N1CC/C(CC1)=C2C3=CC=C(Cl)C=C3CCC4=CC=CN=C4\2)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Loratadine, CAS:79794-75-5, Molecular Weight: 382.883, C22H23ClN2O2, Purity:98, SMILES: CCOC(=O)N1CCC(CC1)=C1c2ccc(Cl)cc2CCc2cccnc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methacycline (hydrochloride), CAS:3963-95-9, Molecular Weight: 478.8796, C22H23ClN2O8, Purity:98, SMILES: O[C@@](C(O)=C(C(C1=C2C=CC=C1O)=O)[C@](C2=C)([H])[C@@H]3O)(C(C(C(N)=O)=C4O)=O)[C@]3([H])[C@@H]4N(C)C.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| A-674563 (hydrochloride), CAS:, Molecular Weight: 394.8972, C22H23ClN4O, Purity:98, SMILES: N[C@@H](CC1=CC=CC=C1)COC2=CC(C3=CC4=C(C=C3)NN=C4C)=CN=C2.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Btk inhibitor 1 (hydrochloride), CAS:, Molecular Weight: 422.9106, C22H23ClN6O, Purity:98, SMILES: NC1=C2C(N(C3CNCCC3)N=C2C4=CC=C(OC5=CC=CC=C5)C=C4)=NC=N1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Btk inhibitor 1 (R enantiomer hydrochloride), CAS:1553977-42-6, Molecular Weight: 422.9106, C22H23ClN6O, Purity:98, SMILES: NC1=C2C(N([C@H]3CNCCC3)N=C2C4=CC=C(OC5=CC=CC=C5)C=C4)=NC=N1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Losartan, CAS:114798-26-4, Molecular Weight: 422.9106, C22H23ClN6O, Purity:98, SMILES: OCC1=C(Cl)N=C(CCCC)N1CC2=CC=C(C3=CC=CC=C3C4=NNN=N4)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir D6, CAS:, Molecular Weight: 535.4895, C22H23D6FN3O9P, Purity:98, SMILES: O=C1N([C@H]2[C@]([C@H](O)[C@@H](CO[P@](OC3=CC=CC=C3)(N[C@@H](C)C(OC(C([2H])([2H])[2H])C([2H])([2H])[2H])=O)=O)O2)(C)F)C=CC(N1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JNJ-42153605, CAS:1254977-87-1, Molecular Weight: 400.44, C22H23F3N4, Purity:98, SMILES: FC(C1=C(N2CCC(C3=CC=CC=C3)CC2)C=CN4C1=NN=C4CC5CC5)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY3039478, CAS:1421438-81-4, Molecular Weight: 464.4376, C22H23F3N4O4, Purity:98, SMILES: O=C(N[C@@H](C)C(N[C@H]1C2=CC=CC=C2C3=CC=CN=C3N(CCO)C1=O)=O)CCC(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LXS196, CAS:1874276-76-2, Molecular Weight: 472.4662296, C22H23F3N8O, Purity:98, SMILES: NC1=C(C(NC2=C(N3CCC(C)(N)CC3)C=CC=N2)=O)N=C(C4=NC=CC=C4C(F)(F)F)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| RS-601, CAS:207987-59-5, Molecular Weight: 511.4777392, C22H23F6NO4S, Purity:98, SMILES: O=C(O)CCCC1=CC=C(C(NS(=O)(C2=CC=C(F)C=C2)=O)CCCC(F)(F)C(F)(F)F)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CYR-101, CAS:359625-79-9, Molecular Weight: 366.4286, C22H23FN2O2, Purity:98, SMILES: O=C1N(CC2CCN(CC(C3=CC=C(F)C=C3)=O)CC2)CC4=C1C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Escitalopram (oxalate), CAS:219861-08-2, Molecular Weight: 414.4268232, C22H23FN2O5, Purity:98, SMILES: FC1=CC=C([C@@]2(CCCN(C)C)C(C=CC(C#N)=C3)=C3CO2)C=C1.O=C(O)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nesbuvir, CAS:691852-58-1, Molecular Weight: 446.4918, C22H23FN2O5S, Purity:98, SMILES: O=C(C1=C(C2=CC=C(F)C=C2)OC3=CC(N(CCO)S(=O)(C)=O)=C(C4CC4)C=C13)NC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Radezolid, CAS:869884-78-6, Molecular Weight: 438.4548, C22H23FN6O3, Purity:98, SMILES: CC(NC[C@H]1CN(C2=CC=C(C3=CC=C(CNCC4=CN=NN4)C=C3)C(F)=C2)C(O1)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| R406 (free base), CAS:841290-80-0, Molecular Weight: 470.4536, C22H23FN6O5, Purity:98, SMILES: COC1=CC(NC2=NC(NC3=NC(N4)=C(C=C3)OC(C)(C)C4=O)=C(C=N2)F)=CC(OC)=C1OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Erlotinib, CAS:183321-74-6, Molecular Weight: 393.4357, C22H23N3O4, Purity:98, SMILES: C#CC1=CC=CC(NC2=NC=NC3=C2C=C(C(OCCOC)=C3)OCCOC)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methyl 3-(4-((BenzyloxyCarbonylPiperazin-1-YlIndolizine-6-Carboxylate, CAS:0, Molecular Weight: 393.4357, C22H23N3O4, Purity:95, SMILES: COC(=O)C1=CN2C(=CC=C2N2CCN(CC2)C(=O)OCC2=CC=CC=C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rosiglitazone (maleate), CAS:155141-29-0, Molecular Weight: 473.49892, C22H23N3O7S, Purity:98, SMILES: O=C(O)/C=C\C(O)=O.CN(CCOC1=CC=C(CC2C(NC(S2)=O)=O)C=C1)C3=CC=CC=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Motesanib, CAS:453562-69-1, Molecular Weight: 373.4509, C22H23N5O, Purity:98, SMILES: O=C(C1=CC=CN=C1NCC2=CC=NC=C2)NC3=CC(NCC4(C)C)=C4C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK-J1, CAS:1373422-53-7, Molecular Weight: 389.4503, C22H23N5O2, Purity:98, SMILES: OC(CCNC1=NC(C2=NC=CC=C2)=NC(N(CC3)CCC4=C3C=CC=C4)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK-J2, CAS:1394854-52-4, Molecular Weight: 389.4503, C22H23N5O2, Purity:98, SMILES: O=C(O)CCNC1=NC(C2=CC=CN=C2)=NC(N3CCC(C=CC=C4)=C4CC3)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Solcitinib, CAS:1206163-45-2, Molecular Weight: 389.4503, C22H23N5O2, Purity:98, SMILES: O=C(C1CC1)NC2=NN3C(C4=CC=C(C(N5CC(C)(C)C5)=O)C=C4)=CC=CC3=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SW044248, CAS:522650-83-5, Molecular Weight: 421.5153, C22H23N5O2S, Purity:98, SMILES: CCC(SC1=NN=C2C(N(CC)C3=C2C=CC=C3)=N1)C(NC4=CC=CC=C4OC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| WEHI-345, CAS:1354825-58-3, Molecular Weight: 401.4643, C22H23N7O, Purity:98, SMILES: O=C(C1=CC=NC=C1)NCC(C)(N2N=C(C3=CC=C(C)C=C3)C4=C(N)N=CN=C42)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 3-(TritylaminoPropan-1-Ol, CAS:89448-83-9, Molecular Weight: 317.4241, C22H23NO, Purity:95, SMILES: OCCCNC(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S)-2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)hept-6-enoic acid, CAS:856412-22-1, Molecular Weight: 365.4223, C22H23NO4, Purity:95, SMILES: OC(=O)[C@H](CCCC=C)NC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AVE-8134, CAS:304025-09-0, Molecular Weight: 381.42172, C22H23NO5, Purity:98, SMILES: O=C(O)C1=C(COCCCOCC2=COC(C3=CC=CC=C3)=N2)C=CC=C1C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Noscapine, CAS:128-62-1, Molecular Weight: 413.4205, C22H23NO7, Purity:98, SMILES: O=C1O[C@H]([C@@H]2N(C)CCC3=C2C(OC)=C(OCO4)C4=C3)C5=C1C(OC)=C(OC)C=C5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vandetanib, CAS:443913-73-3, Molecular Weight: 475.354, C22H24BrFN4O2, Purity:98, SMILES: FC1=CC(Br)=CC=C1NC2=NC=NC3=CC(OCC4CCN(CC4)C)=C(C=C23)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ISRIB (trans-isomer), CAS:1597403-47-8, Molecular Weight: 451.343, C22H24Cl2N2O4, Purity:98, SMILES: O=C(N[C@@H]1CC[C@@H](NC(COC2=CC=C(Cl)C=C2)=O)CC1)COC3=CC=C(Cl)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chlortetracycline (hydrochloride), CAS:64-72-2, Molecular Weight: 515.3406, C22H24Cl2N2O8, Purity:98, SMILES: O=C(C(C1=O)=C(O)[C@@H](N(C)C)[C@]2([H])C[C@]3([H])[C@](C)(O)C4=C(C(C3=C(O)[C@@]21O)=O)C(O)=CC=C4Cl)N.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gefitinib, CAS:184475-35-2, Molecular Weight: 446.9024, C22H24ClFN4O3, Purity:98, SMILES: ClC1=C(C=CC(NC2=NC=NC3=C2C=C(C(OC)=C3)OCCCN4CCOCC4)=C1)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gefitinib, CAS:184475-35-2, Molecular Weight: 446.902, C22H24ClFN4O3, Purity:98, SMILES: COc1cc2ncnc(Nc3ccc(F)c(Cl)c3)c2cc1OCCCN1CCOCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Azelastine, CAS:58581-89-8, Molecular Weight: 381.8985, C22H24ClN3O, Purity:98, SMILES: O=C1N(C2CCN(C)CCC2)N=C(CC3=CC=C(Cl)C=C3)C4=C1C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Erlotinib (Hydrochloride), CAS:183319-69-9, Molecular Weight: 429.8967, C22H24ClN3O4, Purity:98, SMILES: COCCOC1=CC2=NC=NC(NC3=CC=CC(C#C)=C3)=C2C=C1OCCOC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Loxapine (succinate), CAS:27833-64-3, Molecular Weight: 445.8961, C22H24ClN3O5, Purity:98, SMILES: O=C(O)CCC(O)=O.CN1CCN(C2=NC3=CC=CC=C3OC4=CC=C(Cl)C=C24)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Loxapine succinate salt, CAS:27833-64-3, Molecular Weight: 445.896, C22H24ClN3O5, Purity:98, SMILES: OC(=O)CCC(O)=O.CN1CCN(CC1)C1=Nc2ccccc2Oc2ccc(Cl)cc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Domperidone, CAS:57808-66-9, Molecular Weight: 425.9113, C22H24ClN5O2, Purity:98, SMILES: O=C1NC2=CC(Cl)=CC=C2N1C3CCN(CCCN4C5=CC=CC=C5NC4=O)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CTX-0294885, CAS:1439934-41-4, Molecular Weight: 437.9253, C22H24ClN7O, Purity:98, SMILES: O=C(NC)C1=CC=CC=C1NC2=NC(NC3=CC=C(N4CCNCC4)C=C3)=NC=C2Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dehydrocorydaline (chloride), CAS:10605-03-5, Molecular Weight: 401.88326, C22H24ClNO4, Purity:98, SMILES: CC1=C(C=CC(OC)=C2OC)C2=C[N+]3=C1C4=CC(OC)=C(OC)C=C4CC3.[Cl-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rosuvastatin (D3 Sodium), CAS:1279031-70-7, Molecular Weight: 506.5379, C22H24D3FN3NaO6S, Purity:98, SMILES: O=C([O-])C[C@H](O)C[C@H](O)/C=C/C1=C(C(C)C)N=C(N(C([2H])([2H])[2H])S(=O)(C)=O)N=C1C2=CC=C(F)C=C2.[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Brivanib (alaninate), CAS:649735-63-7, Molecular Weight: 441.4555, C22H24FN5O4, Purity:98, SMILES: O=C(O[C@@H](COC1=CN2C(C(OC3=C(C4=C(NC(C)=C4)C=C3)F)=NC=N2)=C1C)C)[C@@H](N)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pipequaline, CAS:77472-98-1, Molecular Weight: 316.4394, C22H24N2, Purity:98, SMILES: C1(C2=CC=CC=C2)=NC3=CC=CC=C3C(CCC4CCNCC4)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1,2-Bis(2-AminophenoxyEthane-N,N,N',N'-Tetraacetic Acid, CAS:85233-19-8, Molecular Weight: 476.4334, C22H24N2O10, Purity:95, SMILES: OC(=O)CN(CC(O)=O)C1=C(OCCOC2=C(C=CC=C2)N(CC(O)=O)CC(O)=O)C=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BAPTA, CAS:85233-19-8, Molecular Weight: 476.4333, C22H24N2O10, Purity:98, SMILES: O=C(O)CN(C1=CC=CC=C1OCCOC2=CC=CC=C2N(CC(O)=O)CC(O)=O)CC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Acrivastine, CAS:87848-99-5, Molecular Weight: 348.4382, C22H24N2O2, Purity:98, SMILES: O=C(O)/C=C/C1=NC(/C(C2=CC=C(C)C=C2)=C/CN3CCCC3)=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| UC-112, CAS:383392-66-3, Molecular Weight: 348.4382, C22H24N2O2, Purity:98, SMILES: OC1=C2N=CC=CC2=C(COCC3=CC=CC=C3)C=C1CN4CCCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Apremilast, CAS:608141-41-9, Molecular Weight: 460.5002, C22H24N2O7S, Purity:98, SMILES: CC(NC1=CC=CC(C(N2[C@@H](C3=CC=C(OC)C(OCC)=C3)CS(=O)(C)=O)=O)=C1C2=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oxytetracycline, CAS:79-57-2, Molecular Weight: 460.434, C22H24N2O9, Purity:98, SMILES: O=C(C(C1=O)=C(O)[C@@H](N(C)C)[C@]2([H])[C@@H](O)[C@]3([H])[C@](C)(O)C4=C(C(C3=C(O)[C@@]21O)=O)C(O)=CC=C4)N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| METHYL 4-((1-CYCLOBUTYL-4-OXO-4,5,6,7,8,9-HEXAHYDRO-3H-PYRAZOLO[3,4-C]QUINOLIN-3-YL)METHYL)PICOLINATE, CAS:1464091-45-9, Molecular Weight: 392.451, C22H24N4O3, Purity:95, SMILES: COC(=O)c1cc(Cn2nc(C3CCC3)c3c4CCCCc4[nH]c(=O)c23)ccn1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD 6482, CAS:1173900-33-8, Molecular Weight: 408.4503, C22H24N4O4, Purity:98, SMILES: O=C1N2C(C([C@H](NC3=CC=CC=C3C(O)=O)C)=CC(C)=C2)=NC(N4CCOCC4)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SR-3677, CAS:1072959-67-1, Molecular Weight: 408.4503, C22H24N4O4, Purity:98, SMILES: CN(C)CCOC1=C(NC(C2OC(C=CC=C3)=C3OC2)=O)C=CC(C4=CNN=C4)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ZD-1611, CAS:186497-38-1, Molecular Weight: 456.5148, C22H24N4O5S, Purity:98, SMILES: O=C(O)C(C)(C)CC1=CC=C(C2=NC=CC=C2S(=O)(NC3=NC=C(C)N=C3OC)=O)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CC-401, CAS:395104-30-0, Molecular Weight: 388.4655, C22H24N6O, Purity:98, SMILES: C1(C2=CC=CC(OCCN3CCCCC3)=C2)=NNC4=C1C=C(C=C4)C5=NC=NN5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cefpirome (sulfate), CAS:98753-19-6, Molecular Weight: 612.6558, C22H24N6O9S3, Purity:98, SMILES: O=C1[C@@H](NC(/C(C2=CSC(N)=N2)=N\OC)=O)[C@@]3([H])SCC(C[N+]4=CC=CC5=C4CCC5)=C(C(O)=O)N13.O=S(O)([O-])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MBX-2982, CAS:1037792-44-1, Molecular Weight: 448.5439, C22H24N8OS, Purity:98, SMILES: CCC1=CN=C(N2CCC(C3=NC(COC4=CC=C(N5N=NN=C5)C=C4)=CS3)CC2)N=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Elafibranor, CAS:923978-27-2, Molecular Weight: 384.4886, C22H24O4S, Purity:98, SMILES: CC(C)(OC1=C(C)C=C(/C=C/C(C2=CC=C(SC)C=C2)=O)C=C1C)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Schisandrin C, CAS:61301-33-5, Molecular Weight: 384.4224, C22H24O6, Purity:98, SMILES: C[C@H]([C@H](C)C1)CC2=C(C3=C1C=C4OCOC4=C3OC)C(OC)=C5OCOC5=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vandetanib (hydrochloride), CAS:524722-52-9, Molecular Weight: 511.8149, C22H25BrClFN4O2, Purity:98, SMILES: FC1=CC(Br)=CC=C1NC2=NC=NC3=CC(OCC4CCN(CC4)C)=C(C=C23)OC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BGB-102, CAS:807640-87-5, Molecular Weight: 457.3635, C22H25BrN4O2, Purity:98, SMILES: CN1CCCCCOC(C(OC)=C2)=CC3=C2N=CN/C3=N\C4=CC(Br)=CC=C4C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Gefitinib (hydrochloride), CAS:184475-55-6, Molecular Weight: 483.3633, C22H25Cl2FN4O3, Purity:98, SMILES: ClC1=C(C=CC(NC2=NC=NC3=C2C=C(C(OC)=C3)OCCCN4CCOCC4)=C1)F.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Azelastine (hydrochloride), CAS:79307-93-0, Molecular Weight: 418.3594, C22H25Cl2N3O, Purity:98, SMILES: O=C1N(C2CCN(C)CCC2)N=C(CC3=CC=C(Cl)C=C3)C4=C1C=CC=C4.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CTX-0294885 (hydrochloride), CAS:, Molecular Weight: 474.3862, C22H25Cl2N7O, Purity:98, SMILES: [H]Cl.O=C(NC)C1=CC=CC=C1NC2=NC(NC3=CC=C(N4CCNCC4)C=C3)=NC=C2Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Doxycycline (hyclate), CAS:24390-14-5, Molecular Weight: 480.8955, C22H25ClN2O8, Purity:98, SMILES: O=C(C(C1=O)=C(O)[C@@H](N(C)C)[C@]2([H])[C@@H](O)[C@]3([H])[C@@H](C)C4=C(C(C3=C(O)[C@@]21O)=O)C(O)=CC=C4)N.Cl.[0.5H2O].[0.5C2H6O], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Doxycycline (hydrochloride), CAS:10592-13-9, Molecular Weight: 480.8955, C22H25ClN2O8, Purity:98, SMILES: O=C(C(C1=O)=C(O)[C@@H](N(C)C)[C@]2([H])[C@@H](O)[C@]3([H])[C@@H](C)C4=C(C(C3=C(O)[C@@]21O)=O)C(O)=CC=C4)N.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tetracycline (hydrochloride), CAS:64-75-5, Molecular Weight: 480.8955, C22H25ClN2O8, Purity:98, SMILES: O[C@@]1(C(C(C(N)=O)=C2O)=O)[C@@]([C@@H]2N(C)C)([H])C[C@@]([C@](O)(C3=CC=C4)C)([H])C(C(C3=C4O)=O)=C1O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CC-401 (hydrochloride), CAS:1438391-30-0, Molecular Weight: 424.9265, C22H25ClN6O, Purity:98, SMILES: C1(C2=CC=CC(OCCN3CCCCC3)=C2)=NNC4=C1C=C(C=C4)C5=NC=NN5.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CZC-54252, CAS:1191911-27-9, Molecular Weight: 504.9897, C22H25ClN6O4S, Purity:98, SMILES: CS(=O)(NC1=CC=CC=C1NC2=NC(NC3=CC=C(N4CCOCC4)C=C3OC)=NC=C2Cl)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-04971729, CAS:1210344-57-2, Molecular Weight: 436.8827, C22H25ClO7, Purity:98, SMILES: ClC1=CC=C([C@@]23O[C@](CO)(CO3)[C@@H](O)[C@H](O)[C@H]2O)C=C1CC4=CC=C(OCC)C=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nebivolol, CAS:118457-14-0, Molecular Weight: 405.435, C22H25F2NO4, Purity:98, SMILES: FC1=CC=C2C(CC[C@]([C@@H](O)CNC[C@H](O)[C@@]3([H])CCC(C=C(F)C=C4)=C4O3)([H])O2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| TP-3654, CAS:1361951-15-6, Molecular Weight: 418.4553096, C22H25F3N4O, Purity:98, SMILES: OC(C)(C)[C@H]1CC[C@H](NC2=NN3C(C=C2)=NC=C3C4=CC=CC(C(F)(F)F)=C4)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Toceranib, CAS:356068-94-5, Molecular Weight: 396.4579, C22H25FN4O2, Purity:98, SMILES: O=C(NCCN1CCCC1)C2=C(NC(/C=C3C(NC4=C\3C=C(C=C4)F)=O)=C2C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CZC-25146, CAS:1191911-26-8, Molecular Weight: 488.5351, C22H25FN6O4S, Purity:98, SMILES: CS(=O)(NC1=CC=CC=C1NC2=NC(NC3=CC=C(N4CCOCC4)C=C3OC)=NC=C2F)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| methyl 3-(4,6-diamino-5-((methoxycarbonyl)(methyl)amino)pyrimidin-2-yl)-1-(2-fluorobenzyl)-5,6-dihydro-1H-pyrazolo[3,4-b]pyridine-7(4H)-carboxylate, CAS:, Molecular Weight: 484.4835, C22H25FN8O4, Purity:95, SMILES: O=C(N1CCCC2=C1N(CC3=CC=CC=C3F)N=C2C4=NC(N)=C(N(C(OC)=O)C)C(N)=N4)OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ro18-5362, CAS:101387-97-7, Molecular Weight: 395.5178, C22H25N3O2S, Purity:98, SMILES: O=C1C(C)(C)C2=C(C=C3NC(SCC4=NC=CC(OC)=C4C)=NC3=C2)C1(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dacinostat, CAS:404951-53-7, Molecular Weight: 379.4522, C22H25N3O3, Purity:98, SMILES: O=C(NO)/C=C/C1=CC=C(CN(CCO)CCC2=CNC3=C2C=CC=C3)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fumitremorgin C, CAS:118974-02-0, Molecular Weight: 379.4522, C22H25N3O3, Purity:98, SMILES: O=C([C@]1([H])CC2=C([C@H](/C=C(C)\C)N13)NC4=C2C=CC(OC)=C4)N5[C@](CCC5)([H])C3=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bay 65-1942 (free base), CAS:600734-02-9, Molecular Weight: 395.4516, C22H25N3O4, Purity:98, SMILES: O=C1OCC2=C([C@H]3CNCCC3)C=C(C4=C(O)C=CC=C4OCC5CC5)N=C2N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bay 65-1942 (R form), CAS:758683-21-5, Molecular Weight: 395.4516, C22H25N3O4, Purity:98, SMILES: OC1=CC=CC(OCC2CC2)=C1C3=NC(NC(OC4)=O)=C4C([C@H]5CCCNC5)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vesnarinone, CAS:81840-15-5, Molecular Weight: 395.4516, C22H25N3O4, Purity:98, SMILES: O=C1NC2=C(C=C(N3CCN(C(C4=CC=C(OC)C(OC)=C4)=O)CC3)C=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Moricizine, CAS:31883-05-3, Molecular Weight: 427.5166, C22H25N3O4S, Purity:98, SMILES: O=C(OCC)NC(C=C1N2C(CCN3CCOCC3)=O)=CC=C1SC4=C2C=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PI4KIIIbeta-IN-10, CAS:1881233-39-1, Molecular Weight: 475.581, C22H25N3O5S2, Purity:98, SMILES: COC1=CC=C(C2=C(C)N=C(NC(C(C)(C)C)=O)S2)C=C1S(NC3=CC=C(O)C=C3)(=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rizatriptan (benzoate), CAS:145202-66-0, Molecular Weight: 391.4662, C22H25N5O2, Purity:98, SMILES: CN(C)CCC1=CNC2=C1C=C(CN3N=CN=C3)C=C2.O=C(O)C4=CC=CC=C4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AM-2394, CAS:1442684-77-6, Molecular Weight: 423.465, C22H25N5O4, Purity:98, SMILES: O=C(NC)NC1=CC(OC2=CC(C)=CN=C2)=C(C3=CC=C(OCC(C)(O)C)N=C3)C=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AM580, CAS:102121-60-8, Molecular Weight: 351.4388, C22H25NO3, Purity:98, SMILES: CC(CC1)(C)C2=C(C=CC(C(NC3=CC=C(C(O)=O)C=C3)=O)=C2)C1(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tamibarotene, CAS:94497-51-5, Molecular Weight: 351.4388, C22H25NO3, Purity:98, SMILES: O=C(C1=CC=C(C=C1)C(NC2=CC=C3C(C)(CCC(C)(C3=C2)C)C)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-2-((((9H-Fluoren-9-YlMethoxyCarbonyl(MethylAmino-3,3-Dimethylbutanoic Acid, CAS:1172579-62-2, Molecular Weight: 367.4382, C22H25NO4, Purity:95, SMILES: CN([C@H](C(O)=O)C(C)(C)C)C(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-(S)-2-(aminomethyl)-4-methylpentanoic acid, CAS:193887-45-5, Molecular Weight: 367.4382, C22H25NO4, Purity:95, SMILES: CC(C)C[C@@H](CNC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Beta-T-Butyl-L-Alanine, CAS:139551-74-9, Molecular Weight: 367.4382, C22H25NO4, Purity:95, SMILES: CC(C)(C)C[C@H](NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-D-beta-homoleucine, CAS:212688-54-5, Molecular Weight: 367.4382, C22H25NO4, Purity:95, SMILES: CC(C)C[C@H](CC(O)=O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-HoLeu-OH, CAS:180414-94-2, Molecular Weight: 367.4382, C22H25NO4, Purity:99, SMILES: CC(C)CC[C@H](NC(=O)OCC1c2ccccc2-c2ccccc12)C(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-L-Beta-Homoisoleucine, CAS:1217808-36-0, Molecular Weight: 367.4382, C22H25NO4, Purity:95, SMILES: CC[C@H](C)[C@H](CC(O)=O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-L-beta-homoleucine, CAS:193887-44-4, Molecular Weight: 367.4382, C22H25NO4, Purity:95, SMILES: CC(C)C[C@@H](CC(O)=O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sacubitrilat, CAS:149709-44-4, Molecular Weight: 383.4376, C22H25NO5, Purity:98, SMILES: [H]N(C(CCC(O)=O)=O)[C@H](CC(C=C1)=CC=C1C2=CC=CC=C2)C[C@H](C(O)=O)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Colchicine, CAS:64-86-8, Molecular Weight: 399.437, C22H25NO6, Purity:98, SMILES: CC(N[C@H](C1=C2)CCC3=CC(OC)=C(OC)C(OC)=C3C1=CC=C(OC)C2=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Arbidol (hydrochloride), CAS:131707-23-8, Molecular Weight: 513.8754, C22H26BrClN2O3S, Purity:98, SMILES: O=C(C1=C(CSC2=CC=CC=C2)N(C)C3=C1C(CN(C)C)=C(O)C(Br)=C3)OCC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Clidinium (bromide), CAS:3485-62-9, Molecular Weight: 432.3507, C22H26BrNO3, Purity:98, SMILES: C[N+]1(CC2)CC(OC(C(C3=CC=CC=C3)(O)C4=CC=CC=C4)=O)C2CC1.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Nebivolol (hydrochloride), CAS:152520-56-4, Molecular Weight: 441.8959, C22H26ClF2NO4, Purity:98, SMILES: FC1=CC=C2C(CC[C@]([C@@H](O)CNC[C@H](O)[C@@]3([H])CCC(C=C(F)C=C4)=C4O3)([H])O2)=C1.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CZC-25146 (hydrochloride), CAS:1330003-04-7, Molecular Weight: 524.996, C22H26ClFN6O4S, Purity:98, SMILES: CS(=O)(NC1=CC=CC=C1NC2=NC(NC3=CC=C(N4CCOCC4)C=C3OC)=NC=C2F)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Bay 65-1942 (hydrochloride), CAS:600734-06-3, Molecular Weight: 431.9125, C22H26ClN3O4, Purity:98, SMILES: O=C1OCC2=C([C@H]3CNCCC3)C=C(C4=C(O)C=CC=C4OCC5CC5)N=C2N1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| IKK-IN-1, CAS:406211-06-1, Molecular Weight: 431.91254, C22H26ClN3O4, Purity:98, SMILES: O=C1NC2=C(CO1)C(C3CCNCC3)=CC(C(C(O)=CC=C4)=C4OCC5CC5)=N2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dasatinib, CAS:302962-49-8, Molecular Weight: 488.0056, C22H26ClN7O2S, Purity:98, SMILES: O=C(C1=CN=C(S1)NC2=NC(C)=NC(N3CCN(CC3)CCO)=C2)NC4=C(C=CC=C4Cl)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dasatinib, CAS:302962-49-8, Molecular Weight: 488.006, C22H26ClN7O2S, Purity:98, SMILES: Cc1nc(Nc2ncc(s2)C(=O)Nc2c(C)cccc2Cl)cc(n1)N1CCN(CCO)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SKF89976A (hydrochloride), CAS:85375-15-1, Molecular Weight: 371.9003, C22H26ClNO2, Purity:98, SMILES: O=C(C1CN(CC/C=C(C2=CC=CC=C2)/C3=CC=CC=C3)CCC1)O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Losmapimod, CAS:585543-15-3, Molecular Weight: 383.4591, C22H26FN3O2, Purity:98, SMILES: CC1=C(C2=NC=C(C(NCC(C)(C)C)=O)C=C2)C=C(C(NC3CC3)=O)C=C1F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trelagliptin (succinate), CAS:1029877-94-8, Molecular Weight: 475.4702, C22H26FN5O6, Purity:98, SMILES: O=C(C=C(N1C[C@H](N)CCC1)N2CC3=C(C#N)C=CC(F)=C3)N(C)C2=O.O=C(O)CCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Solvent Blue 35, CAS:17354-14-2, Molecular Weight: 350.454, C22H26N2O2, Purity:98, SMILES: O=C1C2=C(C=CC=C2)C(C3=C(NCCCC)C=CC(NCCCC)=C13)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Vinpocetine, CAS:42971-09-5, Molecular Weight: 350.454, C22H26N2O2, Purity:98, SMILES: CCOC(C1=C[C@]2(CC)CCCN3CCC(C4=C(C=CC=C4)N51)=C5[C@]23[H])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Corynoxeine, CAS:630-94-4, Molecular Weight: 382.4529, C22H26N2O4, Purity:98, SMILES: O=C(NC1=C2C=CC=C1)[C@]32[C@@](C[C@H](/C(C(OC)=O)=C\OC)[C@@H](C=C)C4)([H])N4CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isocorynoxeine, CAS:51014-29-0, Molecular Weight: 382.4529, C22H26N2O4, Purity:98, SMILES: O=C(NC1=C2C=CC=C1)[C@@]32[C@@](C[C@H](/C(C(OC)=O)=C\OC)[C@@H](C=C)C4)([H])N4CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK-5959, CAS:901245-65-6, Molecular Weight: 394.4668, C22H26N4O3, Purity:98, SMILES: O=C(NC1=C(N2CCCCC2)C=C(N3C)C(N(C)C3=O)=C1)C4=CC=CC=C4OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PI-1840, CAS:1401223-22-0, Molecular Weight: 394.4668, C22H26N4O3, Purity:98, SMILES: O=C(N(C(C)C)CC1=NC(C2=CC=CN=C2)=NO1)COC3=CC=C(CCC)C=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| T863, CAS:701232-20-4, Molecular Weight: 394.4668, C22H26N4O3, Purity:98, SMILES: O=C(O)C[C@H]1CC[C@H](C2=CC=C(C3=NC4=C(N)N=CN=C4OC3(C)C)C=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Seratrodast, CAS:112665-43-7, Molecular Weight: 354.4395, C22H26O4, Purity:98, SMILES: CC(C1=O)=C(C(C(C)=C1C)=O)C(C2=CC=CC=C2)CCCCCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tofogliflozin, CAS:903565-83-3, Molecular Weight: 386.4382, C22H26O6, Purity:98, SMILES: O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@]21OCC3=CC=C(CC4=CC=C(CC)C=C4)C=C23, HPLC, NMR, LCMS is ok, stock more than 10g. |
| L-165041, CAS:79558-09-1, Molecular Weight: 402.4377, C22H26O7, Purity:98, SMILES: O=C(O)COC(C=C1)=CC=C1OCCCOC2=CC=C(C(C)=O)C(O)=C2CCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rosuvastatin (Calcium), CAS:147098-20-2, Molecular Weight: 500.57, C22H27Ca0.5FN3O6S, Purity:98, SMILES: O=C([O-])C[C@H](O)C[C@H](O)/C=C/C1=C(C(C)C)N=C(N(C)S(=O)(C)=O)N=C1C2=CC=C(F)C=C2.[0.5Ca2+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dasatinib (hydrochloride), CAS:854001-07-3, Molecular Weight: 524.4665, C22H27Cl2N7O2S, Purity:98, SMILES: O=C(C1=CN=C(S1)NC2=NC(C)=NC(N3CCN(CC3)CCO)=C2)NC4=C(C=CC=C4Cl)C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LGX818, CAS:1269440-17-6, Molecular Weight: 540.0107, C22H27ClFN7O4S, Purity:98, SMILES: O=C(OC)N[C@@H](C)CNC1=NC=CC(C2=CN(C(C)C)N=C2C3=CC(Cl)=CC(NS(=O)(C)=O)=C3F)=N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SKF-96365 (hydrochloride), CAS:130495-35-1, Molecular Weight: 402.9144, C22H27ClN2O3, Purity:98, SMILES: COC1=CC=C(CCCOC(C2=CC=C(OC)C=C2)CN3C=CN=C3)C=C1.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fmoc-Lys-OMe.HCl, CAS:847658-45-1, Molecular Weight: 418.914, C22H27ClN2O4, Purity:97, SMILES: Cl.COC(=O)[C@H](CCCCN)NC(=O)OCC1c2ccccc2-c2ccccc12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diltiazem (hydrochloride), CAS:33286-22-5, Molecular Weight: 450.9788, C22H27ClN2O4S, Purity:98, SMILES: CN(C)CCN1C2=CC=CC=C2S[C@@H](C3=CC=C(OC)C=C3)[C@@H](OC(C)=O)C1=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BMS-582949 (hydrochloride), CAS:912806-16-7, Molecular Weight: 442.9418, C22H27ClN6O2, Purity:98, SMILES: O=C(NCCC)C1=CN(N=CN=C2NC3=CC(C(NC4CC4)=O)=CC=C3C)C2=C1C.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sunitinib, CAS:557795-19-4, Molecular Weight: 398.4738, C22H27FN4O2, Purity:98, SMILES: O=C(NCCN(CC)CC)C1=C(NC(/C=C2C(NC3=C\2C=C(C=C3)F)=O)=C1C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GNE-272, CAS:1936428-93-1, Molecular Weight: 426.4872, C22H27FN6O2, Purity:98, SMILES: CC(N1CCC2C(C(NC3=C(F)C=C(C4=CN(C)N=C4)C=C3)=NN2[C@@H]5COCC5)C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mangafodipir (trisodium), CAS:140678-14-4, Molecular Weight: 757.3231, C22H27MnN4Na3O14P2, Purity:98, SMILES: O=C1[O-][Mn+2]([N]2(C3)CC4=C5COP(O)(O)=O)([O-]C6=C(N=C7)C)([O-]C4=C(N=C5)C)([O-]C3=O)[N](CC6=C7COP([O-])(O)=O)(CC2)C1.[Na+].[Na+].[Na+], HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1H-1,4-Diazepine, 1H-indazole-3-carboxamide deriv., CAS:129294-09-3, Molecular Weight: 377.48268, C22H27N5O, Purity:98, SMILES: O=C(C1=NNC2=C1C=CC=C2)NC3CN(CC4=CC=CC(C)=C4)CCN(C)C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LMI070, CAS:1562338-42-4, Molecular Weight: 393.4821, C22H27N5O2, Purity:98, SMILES: OC1=CC(C2=CNN=C2)=CC=C1C3=CC=C(OC4CC(C)(C)NC(C)(C)C4)N=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PDE-9 inhibitor, CAS:1082743-70-1, Molecular Weight: 393.4821, C22H27N5O2, Purity:98, SMILES: O=C1NC([C@H]2[C@@H](CN(C2)CC3=CC=CC=C3)C)=NC4=C1C=NN4C5CCOCC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GSK6853, CAS:1910124-24-1, Molecular Weight: 409.4815, C22H27N5O3, Purity:98, SMILES: C[C@@H]1CNCCN1C2=C(NC(C3=CC=CC=C3OC)=O)C=C(C(N4C)=C2)N(C)C4=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PF-04691502, CAS:1013101-36-4, Molecular Weight: 425.4809, C22H27N5O4, Purity:98, SMILES: OCCO[C@@H]1CC[C@@H](N2C(N=C(N)N=C3C)=C3C=C(C4=CC=C(OC)N=C4)C2=O)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY3214996, CAS:1951483-29-6, Molecular Weight: 453.56048, C22H27N7O2S, Purity:98, SMILES: O=C(C(C=C(C1=NC(NC2=CC=NN2C)=NC=C1)S3)=C3C4(C)C)N4CCN5CCOCC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Amineptine, CAS:57574-09-1, Molecular Weight: 337.4553, C22H27NO2, Purity:98, SMILES: O=C(O)CCCCCCNC1C2=CC=CC=C2CCC3=CC=CC=C13, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Danazol, CAS:17230-88-5, Molecular Weight: 337.4553, C22H27NO2, Purity:98, SMILES: C#C[C@]1(O)CC[C@@]2([H])[C@]3([H])CCC4=CC5=C(C=NO5)C[C@]4(C)[C@@]3([H])CC[C@@]21C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (9H-Fluoren-9-YlMethyl (6-Hydroxy-5-(HydroxymethylHexylCarbamate, CAS:147190-31-6, Molecular Weight: 369.4541, C22H27NO4, Purity:95, SMILES: OCC(CO)CCCCNC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Corydaline, CAS:518-69-4, Molecular Weight: 369.4541, C22H27NO4, Purity:98, SMILES: C[C@@H](C1=CC=C2OC)[C@]3([H])C4=CC(OC)=C(OC)C=C4CCN3CC1=C2OC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 1-ethyl-3-(2-hydroxy-2,2-diphenylacetoxy)-1-methylpiperidin-1-ium bromide, CAS:125-51-9, Molecular Weight: 434.367, C22H28BrNO3, Purity:95, SMILES: OC(C1=CC=CC=C1)(C2=CC=CC=C2)C(OC3C[N+](CC)(C)CCC3)=O.[Br-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Fluphenazine (dihydrochloride), CAS:146-56-5, Molecular Weight: 510.4434, C22H28Cl2F3N3OS, Purity:98, SMILES: OCCN1CCN(CCCN2C3=C(C=CC=C3)SC4=CC=C(C(F)(F)F)C=C24)CC1.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Diperodon (hydrochloride), CAS:537-12-2, Molecular Weight: 433.9284, C22H28ClN3O4, Purity:98, SMILES: O=C(OCC(OC(NC1=CC=CC=C1)=O)CN2CCCCC2)NC3=CC=CC=C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| UK51656, CAS:88150-59-8, Molecular Weight: 465.92722, C22H28ClN3O6, Purity:98, SMILES: O=C(C(C(C(C=CC=C1)=C1Cl)C(C(OC)=O)=C(C)N2)=C2COCCNCC(N)=O)OCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| M-110, CAS:1395048-49-3, Molecular Weight: 445.9424, C22H28ClN5O3, Purity:98, SMILES: O=C(N/N=C(C1=CC=C(Cl)C=C1O)\CC)C2=CC(NCCCN3CCOCC3)=NC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lobeline (hydrochloride), CAS:134-63-4, Molecular Weight: 373.9162, C22H28ClNO2, Purity:98, SMILES: CN1[C@@H](CC(C2=CC=CC=C2)=O)CCC[C@H]1C[C@H](O)C3=CC=CC=C3.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Choline Fenofibrate, CAS:856676-23-8, Molecular Weight: 421.9144, C22H28ClNO5, Purity:98, SMILES: O=C(C1=CC=C(OC(C)(C([O-])=O)C)C=C1)C2=CC=C(Cl)C=C2.C[N+](C)(CCO)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| LY2365109 (hydrochloride), CAS:1779796-27-8, Molecular Weight: 421.9144, C22H28ClNO5, Purity:98, SMILES: O=C(O)CN(CCOC1=CC=C(C2=CC=C(OCO3)C3=C2)C=C1C(C)(C)C)C.Cl[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Flumethasone, CAS:2135-17-3, Molecular Weight: 410.4515, C22H28F2O5, Purity:98, SMILES: C[C@@]12[C@](C(CO)=O)(O)[C@H](C)C[C@@]1([H])[C@]3([H])C[C@H](F)C4=CC(C=C[C@]4(C)[C@@]3(F)[C@@H](O)C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rosuvastatin, CAS:287714-41-4, Molecular Weight: 481.5376, C22H28FN3O6S, Purity:98, SMILES: O=C(O)C[C@H](O)C[C@H](O)/C=C/C1=C(C(C)C)N=C(N(C)S(=O)(C)=O)N=C1C2=CC=C(F)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Toceranib (phosphate), CAS:874819-74-6, Molecular Weight: 494.4531, C22H28FN4O6P, Purity:98, SMILES: O=C(NCCN1CCCC1)C2=C(NC(/C=C3C(NC4=C\3C=C(C=C4)F)=O)=C2C)C.O=P(O)(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| R4263, CAS:437-38-7, Molecular Weight: 336.47052, C22H28N2O, Purity:98, SMILES: CCC(N(C1=CC=CC=C1)C2CCN(CCC3=CC=CC=C3)CC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl ((1-Benzhydrylazetidin-3-YlMethylCarbamate, CAS:91189-19-4, Molecular Weight: 352.4699, C22H28N2O2, Purity:95, SMILES: CC(C)(C)OC(=O)NCC1CN(C1)C(C1=CC=CC=C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Modecainide, CAS:81329-71-7, Molecular Weight: 368.46932, C22H28N2O3, Purity:98, SMILES: O=C(NC1=CC=CC=C1CCC2N(C)CCCC2)C3=CC=C(O)C(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MCI826, CAS:140646-80-6, Molecular Weight: 400.53432, C22H28N2O3S, Purity:98, SMILES: O=C(O)C(CC)(CC)CC(NC1=CC=CC(/C=C/C2=NC(C(C)C)=CS2)=C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Corynoxine, CAS:6877-32-3, Molecular Weight: 384.4687, C22H28N2O4, Purity:98, SMILES: O=C(NC1=C2C=CC=C1)[C@@]32[C@@](C[C@H](/C(C(OC)=O)=C\OC)[C@H](CC)C4)([H])N4CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Corynoxine B, CAS:17391-18-3, Molecular Weight: 384.4687, C22H28N2O4, Purity:98, SMILES: O=C(NC1=C2C=CC=C1)[C@]32[C@@](C[C@H](/C(C(OC)=O)=C\OC)[C@H](CC)C4)([H])N4CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Isorhynchophylline, CAS:6859-01-4, Molecular Weight: 384.4687, C22H28N2O4, Purity:98, SMILES: O=C(NC1=C2C=CC=C1)[C@@]32[C@@](C[C@H](/C(C(OC)=O)=C\OC)[C@@H](CC)C4)([H])N4CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Rhynchophylline, CAS:76-66-4, Molecular Weight: 384.4687, C22H28N2O4, Purity:98, SMILES: O=C(NC1=C2C=CC=C1)[C@]32[C@@](C[C@H](/C(C(OC)=O)=C\OC)[C@@H](CC)C4)([H])N4CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| EPZ015866, CAS:1616391-87-7, Molecular Weight: 380.4833, C22H28N4O2, Purity:98, SMILES: O=C(C1=CC(NC2CCC2)=NC=C1)NC[C@H](O)CN3CC4=C(C=CC=C4)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Etonitazene, CAS:911-65-9, Molecular Weight: 396.48272, C22H28N4O3, Purity:98, SMILES: O=[N+](C1=CC=C2C(N=C(CC3=CC=C(OCC)C=C3)N2CCN(CC)CC)=C1)[O-], HPLC, NMR, LCMS is ok, stock more than 10g. |
| (S-Tert-Butyl 5-Methyl-4-((R-1-Methyl-2-Oxo-1,2,3,5-Tetrahydrobenzo[5,6][1,4]Oxazino[3,4-C][1,2,4]Triazin-9-Yl-5,6-Dihydropyridine-1(2H-Carboxylate, CAS:1613722-45-4, Molecular Weight: 412.4821, C22H28N4O4, Purity:95, SMILES: C[C@@H]1CN(CC=C1C1=CC2=C(OCC3=NNC(=O)[C@@H](C)N23)C=C1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mitoxantrone, CAS:65271-80-9, Molecular Weight: 444.4809, C22H28N4O6, Purity:98, SMILES: O=C1C2=C(C(NCCNCCO)=CC=C2NCCNCCO)C(C3=C(O)C=CC(O)=C13)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Delavirdine, CAS:136817-59-9, Molecular Weight: 456.5611, C22H28N6O3S, Purity:98, SMILES: O=S(NC1=CC=C(NC(C(N2CCN(C3=C(NC(C)C)C=CC=N3)CC2)=O)=C4)C4=C1)(C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tofacitinib (citrate), CAS:540737-29-9, Molecular Weight: 504.4931, C22H28N6O8, Purity:98, SMILES: O=C(CC#N)N1C[C@H](N(C2=C3C(NC=C3)=NC=N2)C)[C@H](C)CC1.O=C(CC(C(O)=O)(O)CC(O)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 5-O-Methylvisammioside, CAS:84272-85-5, Molecular Weight: 452.4517, C22H28O10, Purity:98, SMILES: O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](OC(C)([C@H]2OC3=C(C(OC)=C(C(C=C(C)O4)=O)C4=C3)C2)C)[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prim-O-glucosylcimifugin, CAS:80681-45-4, Molecular Weight: 468.4511, C22H28O11, Purity:98, SMILES: COC1=C(C[C@@H](C(C)(O)C)O2)C2=CC(OC(CO[C@@H]([C@@H]([C@@H](O)[C@@H]3O)O)O[C@@H]3CO)=C4)=C1C4=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Etonogestrel, CAS:54048-10-1, Molecular Weight: 324.4565, C22H28O2, Purity:98, SMILES: CC[C@]([C@]1(O)C#C)(C2)[C@](CC1)([H])[C@@](CCC3=CC4=O)([H])[C@]([C@@]3([H])CC4)([H])C2=C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CPI-613, CAS:95809-78-2, Molecular Weight: 388.5865, C22H28O2S2, Purity:98, SMILES: O=C(O)CCCCC(SCC1=CC=CC=C1)CCSCC2=CC=CC=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MG 149, CAS:1243583-85-8, Molecular Weight: 340.4559, C22H28O3, Purity:98, SMILES: O=C(O)C1=C(O)C=CC=C1CCC2=CC=C(CCCCCCC)C=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Norethindrone acetate, CAS:51-98-9, Molecular Weight: 340.4559, C22H28O3, Purity:98, SMILES: C#C[C@]1(OC(C)=O)CC[C@@]2([H])[C@]3([H])CCC4=CC(CC[C@]4([H])[C@@]3([H])CC[C@]12C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dexamethasone 9,11-epoxide, CAS:24916-90-3, Molecular Weight: 372.4547, C22H28O5, Purity:98, SMILES: C[C@@]12[C@](C(CO)=O)(O)[C@H](C)C[C@@]1([H])[C@]3([H])CCC4=CC(C=C[C@]4(C)[C@]3(O5)[C@]5([H])C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Meprednisone, CAS:1247-42-3, Molecular Weight: 372.4547, C22H28O5, Purity:98, SMILES: C[C@@]1(C2)[C@](C(CO)=O)(O)[C@@H](C)C[C@@]1([H])[C@]3([H])CCC4=CC(C=C[C@]4(C)[C@@]3([H])C2=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tofogliflozin (hydrate), CAS:1201913-82-7, Molecular Weight: 404.4535, C22H28O7, Purity:98, SMILES: O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@]21OCC3=C2C=C(CC4=CC=C(CC)C=C4)C=C3.O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity K, CAS:1496552-51-2, Molecular Weight: 545.9071, C22H29ClN3O9P, Purity:98, SMILES: O=[P@@](N[C@@H](C)C(OC(C)C)=O)(OC[C@@H]1[C@@H](O)[C@](Cl)(C)[C@H](N2C(NC(C=C2)=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ARS-853, CAS:1629268-00-3, Molecular Weight: 432.9437, C22H29ClN4O3, Purity:98, SMILES: ClC1=C(C2(C)CC2)C=C(NCC(N3CCN(C4CN(C(C=C)=O)C4)CC3)=O)C(O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Beclometasone, CAS:4419-39-0, Molecular Weight: 408.9156, C22H29ClO5, Purity:98, SMILES: C[C@@]12[C@](C(CO)=O)(O)[C@@H](C)C[C@@]1([H])[C@]3([H])CCC4=CC(C=C[C@]4(C)[C@@]3(Cl)[C@@H](O)C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (+)-Cloprostenol, CAS:54276-21-0, Molecular Weight: 424.91506, C22H29ClO6, Purity:98, SMILES: OC(CCC/C=C\C[C@@H]1[C@H]([C@H](O)C[C@@H]1O)/C=C/[C@@H](O)COC2=CC(Cl)=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (3S,8R,9S,10R,13S,14S-10,13-Dimethyl-17-(Trifluoromethylsulfonyloxy-2,3,4,7,8,9,10,11,12,13,14,15-Dodecahydro-1H-Cyclopenta[A]Phenanthren-3-Yl Acetate, CAS:115375-60-5, Molecular Weight: 462.523, C22H29F3O5S, Purity:95, SMILES: CC(=O)O[C@H]1CC[C@]2(C)[C@H]3CC[C@@]4(C)[C@@H](CC=C4OS(=O)(=O)C(F)(F)F)[C@@H]3CC=C2C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity L, CAS:, Molecular Weight: 545.4519, C22H29FN3O10P, Purity:98, SMILES: O=[P@@](N[C@@H](C)C(OC(C)C)=O)(OC[C@@H]1[C@@H](O)[C@](F)(C)[C@H](N2C=CC(N(O)C2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Enantiomer of Sofosbuvir, CAS:, Molecular Weight: 529.4525, C22H29FN3O9P, Purity:98, SMILES: O=[P@](N[C@H](C)C(OC(C)C)=O)(OC[C@H]1[C@H](O)[C@@](F)(C)[C@@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PSI-7976, CAS:1190308-01-0, Molecular Weight: 529.4525, C22H29FN3O9P, Purity:98, SMILES: O=[P@](N[C@@H](C)C(OC(C)C)=O)(OC[C@@H]1[C@@H](O)[C@](F)(C)[C@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| PSI-7977, CAS:1190307-88-0, Molecular Weight: 529.4525, C22H29FN3O9P, Purity:98, SMILES: O=C1N([C@H]2[C@]([C@H](O)[C@@H](CO[P@](OC3=CC=CC=C3)(N[C@@H](C)C(OC(C)C)=O)=O)O2)(C)F)C=CC(N1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity A, CAS:1496552-16-9, Molecular Weight: 529.4525, C22H29FN3O9P, Purity:98, SMILES: O=[P@](N[C@H](C)C(OC(C)C)=O)(OC[C@@H]1[C@@H](O)[C@](F)(C)[C@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity B, CAS:, Molecular Weight: 529.4525, C22H29FN3O9P, Purity:98, SMILES: O=[P@@](N[C@@H](C)C(OC(C)C)=O)(OC[C@@H]1[C@@H](O)[C@](F)(C)[C@@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity C, CAS:1496552-28-3, Molecular Weight: 529.4525, C22H29FN3O9P, Purity:98, SMILES: O=[P@@](N[C@H](C)C(OC(C)C)=O)(OC[C@@H]1[C@@H](O)[C@](F)(C)[C@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity D, CAS:, Molecular Weight: 529.4525, C22H29FN3O9P, Purity:98, SMILES: O=[P@@](N[C@@H](C)C(OC(C)C)=O)(OC[C@H]1[C@H](O)[C@@](F)(C)[C@@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity E, CAS:, Molecular Weight: 529.4525, C22H29FN3O9P, Purity:98, SMILES: O=[P@@](N[C@@H](C)C(OC(C)C)=O)(OC[C@@H]1[C@H](O)[C@@](F)(C)[C@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity G, CAS:1337482-15-1, Molecular Weight: 529.4525, C22H29FN3O9P, Purity:98, SMILES: O=[P@@](N[C@@H](C)C(OC(C)C)=O)(O[C@H]1[C@](F)(C)[C@H](N2C(NC(C=C2)=O)=O)O[C@@H]1CO)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pyrrolo[3,2-c]azepin-4(1H)-one, 5-[3-[4-(4-fluorophenyl)-1-piperazinyl]propyl]-5,6,7,8-tetrahydro-8-hydroxy-1-methyl-, CAS:191592-09-3, Molecular Weight: 400.4896632, C22H29FN4O2, Purity:98, SMILES: O=C1N(CCCN2CCN(C3=CC=C(F)C=C3)CC2)CCC(O)C4=C1C=CN4C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Desoximetasone, CAS:382-67-2, Molecular Weight: 376.4617, C22H29FO4, Purity:98, SMILES: F[C@@]1([C@]2(C=C3)C)[C@](CCC2=CC3=O)([H])[C@@](C[C@@H](C)[C@@H]4C(CO)=O)([H])[C@]4(C)C[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Timobesone, CAS:87116-72-1, Molecular Weight: 408.5266632, C22H29FO4S, Purity:98, SMILES: F[C@@]1([C@]2(C=C3)C)[C@](CCC2=CC3=O)([H])[C@@](C[C@H](C)[C@]4(O)C(SC)=O)([H])[C@]4(C)C[C@@H]1O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Betamethasone, CAS:378-44-9, Molecular Weight: 392.4611, C22H29FO5, Purity:98, SMILES: C[C@@]12[C@](C[C@H](C)[C@]2(O)C(CO)=O)([H])[C@]3([H])CCC4=CC(C=C[C@]4(C)[C@@]3(F)[C@@H](O)C1)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dexamethasone, CAS:50-02-2, Molecular Weight: 392.4611, C22H29FO5, Purity:98, SMILES: O=C1C=C[C@@]2(C)C(CC[C@]3([H])[C@]2(F)[C@@H](O)C[C@@]4(C)[C@@]3([H])C[C@@H](C)[C@@]4(C(CO)=O)O)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 7,10-Dibenzyl-2,7,10-Triazaspiro[4.6]Undecane, CAS:1330765-96-2, Molecular Weight: 335.4858, C22H29N3, Purity:95, SMILES: C(N1CCN(CC2=CC=CC=C2)CC2(CCNC2)C1)C1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FTI-277, CAS:170006-73-2, Molecular Weight: 447.614, C22H29N3O3S2, Purity:98, SMILES: CSCC[C@@H](C(OC)=O)NC(C1=CC=C(NC[C@@H](N)CS)C=C1C2=CC=CC=C2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| K134, CAS:189362-06-9, Molecular Weight: 399.48336, C22H29N3O4, Purity:98, SMILES: O=C(NCCCOC1=CC2=C(NC(C=C2)=O)C=C1)N(C3CC3)[C@H]4[C@H](O)CCCC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Lafutidine, CAS:118288-08-7, Molecular Weight: 431.5484, C22H29N3O4S, Purity:98, SMILES: O=C(NC/C=C\COC1=NC=CC(CN2CCCCC2)=C1)CS(CC3=CC=CO3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CZ415, CAS:1429639-50-8, Molecular Weight: 459.5618, C22H29N5O4S, Purity:98, SMILES: O=C(NCC)NC(C=C1)=CC=C1C2=NC3=C(CS(C3(C)C)(=O)=O)C(N4[C@@H](C)COCC4)=N2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Motesanib (Diphosphate), CAS:857876-30-3, Molecular Weight: 569.4413, C22H29N5O9P2, Purity:98, SMILES: O=C(C1=CC=CN=C1NCC2=CC=NC=C2)NC3=CC(NCC4(C)C)=C4C=C3.O=P(O)(O)O.O=P(O)(O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| MPI-0479605, CAS:1246529-32-7, Molecular Weight: 407.512, C22H29N7O, Purity:98, SMILES: CC(C=C(N1CCOCC1)C=C2)=C2NC3=NC4=C(N=CN4)C(NC5CCCCC5)=N3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Puromycin, CAS:53-79-2, Molecular Weight: 471.5096, C22H29N7O5, Purity:98, SMILES: OC[C@@H]1[C@@H](NC([C@@H](N)CC2=CC=C(OC)C=C2)=O)[C@H]([C@H](N3C=NC4=C3N=CN=C4N(C)C)O1)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Noracymethadol, CAS:1477-39-0, Molecular Weight: 339.47116, C22H29NO2, Purity:98, SMILES: CC(OC(CC)C(C1=CC=CC=C1)(C2=CC=CC=C2)CC(C)NC)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ro 25-6981, CAS:169274-78-6, Molecular Weight: 339.4712, C22H29NO2, Purity:98, SMILES: OC1=CC=C([C@H](O)[C@@H](C)CN2CCC(CC3=CC=CC=C3)CC2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl (1,3-Bis(BenzyloxyPropan-2-YlCarbamate, CAS:167486-39-7, Molecular Weight: 371.47, C22H29NO4, Purity:95, SMILES: CC(C)(C)OC(=O)NC(COCC1=CC=CC=C1)COCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benztropine (mesylate), CAS:132-17-2, Molecular Weight: 403.535, C22H29NO4S, Purity:98, SMILES: CN1[C@H]2CC(OC(C3=CC=CC=C3)C4=CC=CC=C4)C[C@@H]1CC2.CS(=O)(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trimebutine, CAS:39133-31-8, Molecular Weight: 387.4694, C22H29NO5, Purity:98, SMILES: O=C(OCC(C1=CC=CC=C1)(N(C)C)CC)C2=CC(OC)=C(OC)C(OC)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chlorhexidine, CAS:55-56-1, Molecular Weight: 505.4466, C22H30Cl2N10, Purity:98, SMILES: N=C(NC1=CC=C(Cl)C=C1)NC(NCCCCCCNC(NC(NC2=CC=C(Cl)C=C2)=N)=N)=N, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Banoxantrone (dihydrochloride), CAS:252979-56-9, Molecular Weight: 517.4028, C22H30Cl2N4O6, Purity:98, SMILES: O=C1C2=C(C(O)=CC=C2O)C(C3=C(NCC[N+](C)(C)[O-])C=CC(NCC[N+](C)(C)[O-])=C13)=O.Cl.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Mitoxantrone (dihydrochloride), CAS:70476-82-3, Molecular Weight: 517.4028, C22H30Cl2N4O6, Purity:98, SMILES: O=C1C2=C(C(NCCNCCO)=CC=C2NCCNCCO)C(C3=C(O)C=CC(O)=C13)=O.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Betamethasone (hydrochloride), CAS:956901-32-9, Molecular Weight: 428.922, C22H30ClFO5, Purity:98, SMILES: C[C@@]12[C@](C[C@H](C)[C@]2(O)C(CO)=O)([H])[C@]3([H])CCC4=CC(C=C[C@]4(C)[C@@]3(F)[C@@H](O)C1)=O.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FTI-277 (hydrochloride), CAS:180977-34-8, Molecular Weight: 484.0749, C22H30ClN3O3S2, Purity:98, SMILES: CSCC[C@@H](C(OC)=O)NC(C1=CC=C(NC[C@@H](N)CS)C=C1C2=CC=CC=C2)=O.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Dextropropoxyphene (isomer hydrochloride), CAS:75044-79-0, Molecular Weight: 375.9321, C22H30ClNO2, Purity:98, SMILES: C[C@@H](CN(C)C)[C@](OC(CC)=O)(C1=CC=CC=C1)CC2=CC=CC=C2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Z-VAD-FMK, CAS:187389-52-2, Molecular Weight: 467.4879, C22H30FN3O7, Purity:98, SMILES: O=C(CF)[C@H](CC(OC)=O)NC([C@H](C)NC([C@H](C(C)C)NC(OCC1=CC=CC=C1)=O)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity J, CAS:1334513-10-8, Molecular Weight: 528.4678, C22H30FN4O8P, Purity:98, SMILES: O[C@H]1[C@](F)(C)[C@H](N2C=CC(N)=NC2=O)O[C@@H]1CO[P@](OC3=CC=CC=C3)(N[C@@H](C)C(OC(C)C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glycine, N,N-dimethyl-, 2-[4-[4-[5-[(acetylamino)methyl]-2-oxo-3-oxazolidinyl]-2-fluorophenyl]-1-piperazinyl]-2-oxoethyl ester, (S)-, CAS:170104-58-2, Molecular Weight: 479.5019032, C22H30FN5O6, Purity:98, SMILES: O=C(OCC(N1CCN(C2=CC=C(N3C(O[C@@H](CNC(C)=O)C3)=O)C=C2F)CC1)=O)CN(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glucagon receptor antagonists-2, CAS:202917-18-8, Molecular Weight: 359.4775032, C22H30FNO2, Purity:98, SMILES: OC1=CC(F)=CC=C1C2=C(C(C(C)C)=NC(C(C)C)=C2CCC)[C@H](O)C.[relative stereochemistry].[R], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glucagon receptor antagonists-3, CAS:202917-17-7, Molecular Weight: 359.4775032, C22H30FNO2, Purity:98, SMILES: CC(C)C1=NC(C(C)C)=C(CCC)C(C2=CC=C(F)C=C2O)=C1[C@H](O)C.[relative stereochemistry], HPLC, NMR, LCMS is ok, stock more than 10g. |
| RU-SKI 43, CAS:1043797-53-0, Molecular Weight: 386.5508, C22H30N2O2S, Purity:98, SMILES: O=C(CNCC(C)CC)N1CCC2=C(C=CS2)C1COC3=CC=CC(C)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| FRG8701, CAS:108498-50-6, Molecular Weight: 418.5496, C22H30N2O4S, Purity:98, SMILES: O=C(NCCCOC1=CC=CC(CN2CCCCC2)=C1)CS(CC3=CC=CO3)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sofosbuvir impurity M, CAS:2095551-10-1, Molecular Weight: 527.4615, C22H30N3O10P, Purity:98, SMILES: O=[P@@](N[C@@H](C)C(OC(C)C)=O)(OC[C@@H]1[C@@H](O)[C@@](O)(C)[C@H](N2C=CC(NC2=O)=O)O1)OC3=CC=CC=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-(4-methylpiperazin-1-yl-3'-(morpholinomethyl-[1,1'-biphenyl]-3-amine, CAS:0, Molecular Weight: 366.4998, C22H30N4O, Purity:95, SMILES: CN1CCN(CC1)C1=C(N)C=C(C=C1)C1=CC=CC(CN2CCOCC2)=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| SK1-IN-1, CAS:1218816-71-7, Molecular Weight: 398.4986, C22H30N4O3, Purity:98, SMILES: O=C([C@H]1NCC[C@@H]1O)N[C@H](C2=CC=C(C3=NOC(CCC4CCCC4)=N3)C=C2)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| CAY10603, CAS:1045792-66-2, Molecular Weight: 446.4968, C22H30N4O6, Purity:98, SMILES: O=C(OC(C)(C)C)NC1=CC=C(C2=CC(C(NCCCCCCC(NO)=O)=O)=NO2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| GS-9620, CAS:1228585-88-3, Molecular Weight: 410.5126, C22H30N6O2, Purity:98, SMILES: O=C1NC2=C(N)N=C(OCCCC)N=C2N(CC3=CC=CC(CN4CCCC4)=C3)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Debio 0932, CAS:1061318-81-7, Molecular Weight: 442.5776, C22H30N6O2S, Purity:98, SMILES: NC1=NC=CC2=C1N=C(SC3=C(N(C)C)C=C(OCO4)C4=C3)N2CCNCC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Sildenafil, CAS:139755-83-2, Molecular Weight: 474.5764, C22H30N6O4S, Purity:98, SMILES: O=C1C(N(C)N=C2CCC)=C2N=C(C3=CC(S(=O)(N4CCN(C)CC4)=O)=CC=C3OCC)N1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Teneligliptin, CAS:760937-92-6, Molecular Weight: 426.5782, C22H30N6OS, Purity:98, SMILES: O=C([C@H]1NC[C@@H](N2CCN(C3=CC(C)=NN3C4=CC=CC=C4)CC2)C1)N5CSCC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Desogestrel, CAS:54024-22-5, Molecular Weight: 310.473, C22H30O, Purity:98, SMILES: [H][C@@]12C(CC[C@]([C@@](CC[C@@]3(O)C#C)([H])[C@]3(CC)C4)([H])[C@]2([H])C4=C)=CCCC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| ERA63, CAS:343248-86-2, Molecular Weight: 310.473, C22H30O, Purity:98, SMILES: C#C[C@]1(O)CC[C@@]2([H])[C@]3([H])[C@H](C)CC4=C(CCC(C4)=C)[C@@]3([H])CC[C@]12C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Salirasib, CAS:162520-00-5, Molecular Weight: 358.5374, C22H30O2S, Purity:98, SMILES: O=C(O)C1=CC=CC=C1SC/C=C(C)/CC/C=C(C)/CC/C=C(C)/C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (8R,9S,13S,14S,17S)-3,17-bis(methoxymethoxy)-13-methyl-9,11,12,13,14,15,16,17-octahydro-8H-cyclopenta[a]phenanthrene, CAS:, Molecular Weight: 358.4712, C22H30O4, Purity:95, SMILES: [H][C@@]12CC[C@H](OCOC)[C@@]1(C)CC[C@]1([H])c3ccc(OCOC)cc3C=C[C@@]21[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Glaucocalyxin B, CAS:80508-81-2, Molecular Weight: 374.4706, C22H30O5, Purity:98, SMILES: CC1(C)C(CC[C@@]2(C)[C@@]3([H])[C@@]4(C(C([C@H](CC3)[C@H]4OC(C)=O)=C)=O)[C@H](O)C[C@]12[H])=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methylprednisolone, CAS:83-43-2, Molecular Weight: 374.4706, C22H30O5, Purity:98, SMILES: O=C1C=C[C@]2(C)[C@@]3([H])[C@@H](O)C[C@]4(C)[C@@](O)(C(CO)=O)CC[C@@]4([H])[C@]3([H])C[C@H](C)C2=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Puromycin (Dihydrochloride), CAS:58-58-2, Molecular Weight: 544.43144, C22H31Cl2N7O5, Purity:98, SMILES: OC[C@@H]1[C@@H](NC([C@@H](N)CC2=CC=C(OC)C=C2)=O)[C@H]([C@H](N3C=NC4=C3N=CN=C4N(C)C)O1)O.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 6H05 (trifluoroacetate), CAS:, Molecular Weight: 590.1425, C22H31ClF3N3O4S3, Purity:98, SMILES: O=C(C1CCN(C(CSC2=CC=C(Cl)C=C2)=O)CC1)NCCSSCCN(C)C.O=C(O)C(F)(F)F, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Pirmenol (hydrochloride), CAS:61477-94-9, Molecular Weight: 374.9473, C22H31ClN2O, Purity:98, SMILES: OC(C1=CC=CC=C1)(CCCN2[C@@H](C)CCC[C@H]2C)C3=CC=CC=N3.Cl[H], HPLC, NMR, LCMS is ok, stock more than 10g. |
| RU-SKI 43 (hydrochloride), CAS:, Molecular Weight: 423.0117, C22H31ClN2O2S, Purity:98, SMILES: [H]Cl.O=C(CNCC(C)CC)N1CCC2=C(C=CS2)C1COC3=CC=CC(C)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Protein degrader 1 (hydrochloride), CAS:1448189-80-7, Molecular Weight: 467.02454, C22H31ClN4O3S, Purity:98, SMILES: O=C([C@H](C[C@@H](O)C1)N1C([C@@H](N)C(C)(C)C)=O)NCC2=CC=C(C(SC=N3)=C3C)C=C2.Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Piboserod, CAS:152811-62-6, Molecular Weight: 369.5004, C22H31N3O2, Purity:98, SMILES: O=C(C1=C(OCCC2)N2C3=C1C=CC=C3)NCC4CCN(CCCC)CC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Trans-Tert-Butyl 5'-Benzyl-3'-Oxohexahydro-2'H-Spiro[Piperidine-4,1'-Pyrrolo[3,4-C]Pyrrole]-1-Carboxylate, CAS:0, Molecular Weight: 385.4998, C22H31N3O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC1)NC(=O)[C@@H]1CN(CC3=CC=CC=C3)C[C@@H]21, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 8-Benzyl 11-Tert-Butyl 2-Oxo-1,8,11-Triazaspiro[5.6]Dodecane-8,11-Dicarboxylate, CAS:1251008-96-4, Molecular Weight: 417.4986, C22H31N3O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCN(CC2(CCCC(=O)N2)C1)C(=O)OCC1=CC=CC=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cilazapril, CAS:88768-40-5, Molecular Weight: 417.4986, C22H31N3O5, Purity:98, SMILES: O=C([C@@H]1CCCN2N1C([C@@H](N[C@@H](CCC3=CC=CC=C3)C(OCC)=O)CCC2)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Cinepazide, CAS:23887-46-9, Molecular Weight: 417.49864, C22H31N3O5, Purity:98, SMILES: O=C(N1CCN(CC(N2CCCC2)=O)CC1)/C=C/C3=CC(OC)=C(OC)C(OC)=C3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Utibapril, CAS:109683-61-6, Molecular Weight: 449.56364, C22H31N3O5S, Purity:98, SMILES: O=C([C@@H]1SC(C(C)(C)C)=NN1C([C@@H](N[C@H](C(OCC)=O)CCC2=CC=CC=C2)C)=O)O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tebipenem pivoxil, CAS:161715-24-8, Molecular Weight: 497.6281, C22H31N3O6S2, Purity:98, SMILES: O=C(C(N1C2=O)=C(SC3CN(C4=NCCS4)C3)[C@H](C)[C@]1([H])[C@@]2([H])[C@H](O)C)OCOC(C(C)(C)C)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| XL228, CAS:898280-07-4, Molecular Weight: 437.5412, C22H31N9O, Purity:98, SMILES: CN1CCN(C2=CC(NC3=NNC(C4CC4)=C3)=NC(NCC5=CC(C(C)C)=NO5)=N2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| AZD-8835, CAS:1620576-64-8, Molecular Weight: 469.54, C22H31N9O3, Purity:98, SMILES: O=C(N1CCC(C2=NN(CC)C(C3=NC(C4=NN=C(C(C)(C)C)O4)=C(N)N=C3)=N2)CC1)CCO, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tolterodine, CAS:124937-51-5, Molecular Weight: 325.4876, C22H31NO, Purity:98, SMILES: CC(C)N(C(C)C)CC[C@H](C1=CC=CC=C1)C2=C(O)C=CC(C)=C2, HPLC, NMR, LCMS is ok, stock more than 10g. |
| (R)-5-Hydroxymethyl Tolterodine, CAS:207679-81-0, Molecular Weight: 341.487, C22H31NO2, Purity:98, SMILES: OC1=C(C=C(CO)C=C1)[C@@H](C2=CC=CC=C2)CCN(C(C)C)C(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oxybutynin, CAS:5633-20-5, Molecular Weight: 357.4865, C22H31NO3, Purity:98, SMILES: O=C(C(O)(C1=CC=CC=C1)C2CCCCC2)OCC#CCN(CC)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-(1'-(Tert-Butoxycarbonyl-5,6-Dimethoxy-2,3-Dihydrospiro[Indene-1,4'-Piperidine]-3-YlAcetic Acid, CAS:1160247-56-2, Molecular Weight: 405.4846, C22H31NO6, Purity:95, SMILES: COC1=C(OC)C=C2C(=C1)C(CC(O)=O)CC21CCN(CC1)C(=O)OC(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Teneligliptin (hydrobromide), CAS:906093-29-6, Molecular Weight: 628.855, C22H32.5N6OSBr2.5, Purity:98, SMILES: O=C(N1CSCC1)[C@H]2NC[C@@H](N3CCN(C4=CC(C)=NN4C5=CC=CC=C5)CC3)C2.[2.5 HBr], HPLC, NMR, LCMS is ok, stock more than 10g. |
| Chlorhexidine (dihydrochloride), CAS:3697-42-5, Molecular Weight: 578.3685, C22H32Cl4N10, Purity:98, SMILES: N=C(NC1=CC=C(Cl)C=C1)NC(NCCCCCCNC(NC(NC2=CC=C(Cl)C=C2)=N)=N)=N.[H]Cl.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Piboserod (hydrochloride), CAS:178273-87-5, Molecular Weight: 405.9614, C22H32ClN3O2, Purity:98, SMILES: [H]Cl.O=C(C1=C(OCCC2)N2C3=C1C=CC=C3)NCC4CCN(CCCC)CC4, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Prucalopride (succinate), CAS:179474-85-2, Molecular Weight: 485.9584, C22H32ClN3O7, Purity:98, SMILES: O=C(O)CCC(O)=O.O=C(C1=C(OCC2)C2=C(N)C(Cl)=C1)NC3CCN(CCCOC)CC3, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Oxybutynin (chloride), CAS:1508-65-2, Molecular Weight: 393.9474, C22H32ClNO3, Purity:98, SMILES: O=C(C(O)(C1=CC=CC=C1)C2CCCCC2)OCC#CCN(CC)CC.[H]Cl, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Tert-Butyl 4-((1-Benzyl-1,2,3,6-Tetrahydropyridin-4-YlOxyPiperidine-1-Carboxylate, CAS:0, Molecular Weight: 372.5011, C22H32N2O3, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC(CC1)OC1=CCN(CC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Ethyl 4-benzyl-7-boc-4,7-diazabicyclo[4,3,0]nonane-1-carboxylate, CAS:, Molecular Weight: 388.5005, C22H32N2O4, Purity:95, SMILES: CCOC(=O)C12CCN(CC2N(CC1)C(=O)OC(C)(C)C)Cc1ccccc1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 2-Benzyl 8-Tert-Butyl 3-(Hydroxymethyl-2,8-Diazaspiro[4.5]Decane-2,8-Dicarboxylate, CAS:1445951-71-2, Molecular Weight: 404.4999, C22H32N2O5, Purity:95, SMILES: CC(C)(C)OC(=O)N1CCC2(CC(CO)N(C2)C(=O)OCC2=CC=CC=C2)CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| P2647, CAS:63-12-7, Molecular Weight: 404.49988, C22H32N2O5, Purity:98, SMILES: O=C(C1CN2CCC3=CC(OC)=C(OC)C=C3C2CC1OC(C)=O)N(CC)CC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Estropipate, CAS:7280-37-7, Molecular Weight: 436.5649, C22H32N2O5S, Purity:98, SMILES: C[C@]1([C@](CC2)([H])[C@]3([H])CCC4=C(C=CC(OS(=O)(O)=O)=C4)[C@@]3([H])CC1)C2=O.N5CCNCC5, HPLC, NMR, LCMS is ok, stock more than 10g. |
| tert-butyl 7-benzyl-1,7-diazaspiro[4.5]decane-1-carboxylate oxalate, CAS:1415560-12-1, Molecular Weight: 420.4993, C22H32N2O6, Purity:95, SMILES: OC(=O)C(O)=O.CC(C)(C)OC(=O)N1CCCC11CCCN(Cc2ccccc2)C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Benzonitrile, 4-[[3-[7-(3,3-dimethyl-2-oxobutyl)-9-oxa-3,7-diazabicyclo[3.3.1]non-3-yl]propyl]amino]-, CAS:335619-12-0, Molecular Weight: 384.51508, C22H32N4O2, Purity:98, SMILES: N#CC1=CC=C(NCCCN2CC(O3)CN(CC(C(C)(C)C)=O)CC3C2)C=C1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| BS-181, CAS:1092443-52-1, Molecular Weight: 380.5297, C22H32N6, Purity:98, SMILES: CC(C1=C(N=C(C=C2NCC3=CC=CC=C3)NCCCCCCN)N2N=C1)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| R121919, CAS:195055-03-9, Molecular Weight: 380.5297, C22H32N6, Purity:98, SMILES: CCCN(C1=CC(C)=NC2=C(C3=CN=C(N(C)C)C=C3C)C(C)=NN21)CCC, HPLC, NMR, LCMS is ok, stock more than 10g. |
| JWH-133, CAS:259869-55-1, Molecular Weight: 312.4889, C22H32O, Purity:98, SMILES: CC(C1)=CC[C@]2([H])[C@]1([H])C3=CC=C(C(C)(C)CCC)C=C3OC2(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Docosahexaenoic Acid, CAS:6217-54-5, Molecular Weight: 328.48828, C22H32O2, Purity:98, SMILES: CC/C=C\C/C=C\C/C=C\C/C=C\C/C=C\C/C=C\CCC(O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| 4-((Tert-ButyldiphenylsilylOxy-2,2-Dimethylbutan-1-Ol, CAS:439693-30-8, Molecular Weight: 356.5738, C22H32O2Si, Purity:95, SMILES: CC(C)(CO)CCO[Si](C1=CC=CC=C1)(C1=CC=CC=C1)C(C)(C)C, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Medroxyprogesterone, CAS:520-85-4, Molecular Weight: 344.4877, C22H32O3, Purity:98, SMILES: C[C@@]1([C@@]2(O)C(C)=O)[C@](CC2)([H])[C@@](C[C@H](C)C3=CC4=O)([H])[C@]([C@]3(CC4)C)([H])CC1, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Medrysone, CAS:2668-66-8, Molecular Weight: 344.4877, C22H32O3, Purity:98, SMILES: CC([C@H]1CC[C@@]2([H])[C@]3([H])C[C@H](C)C4=CC(CC[C@]4(C)[C@@]3([H])[C@@H](O)C[C@]12C)=O)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
| Methenolone (acetate), CAS:434-05-9, Molecular Weight: 344.4877, C22H32O3, Purity:98, SMILES: C[C@@]12[C@@H](OC(C)=O)CC[C@@]1([H])[C@]3([H])CC[C@@]4([H])CC(C=C(C)[C@]4(C)[C@@]3([H])CC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g. |
Testosterone (propionate), CAS:57-85-2, Molecular Weight: 344.4877, C22H32O3, Purity:98, SMILES: C[C@@]12[C@@H](OC(CC)=O)CC[C@@]1([H])[C@]3([H])CCC4=CC(CC[C@]4(C)[C@@]3([H])CC2)=O, HPLC, NMR, LCMS is ok, stock more than 10g.
EOS Med Chem, Medchem is Big
執大象，天下往，往而無害，安平泰
2018. 4.18 Janpan CPHI, Attend
2018. 5.15 Israel Biomed, Attend
2018. 6. 20 China CPHI, W4E82
2018. 8. 28 Korea CPHI, Attend
2018. 10. 9 Spain World CPHI, Attend
郵箱: info@eosmedchem.com ; eosmedchem@gmail.com
辦公室: 0086-531-69905422-806(直通)
攜帶番號 & WhatsApp & Wechat: +8618653174435
住所: Diaozhen Chemical Industrial Park, Jinan City, China
Skype: willgutian
QQ: 2393923585
|
