☺Stock list--40219

GMP, ISO custom synthesis Medicinal Chemistry; FDA new API and Intermediates, HPLC 99%+, NMR, LCMS, MSDS, COA, MOA all we provided.

Teva, Novartis, Pfizer, Hikma, Glenmark, Gilead all Site Audit approved us.

www.eosmedchem.com

Preladenant, Alternative-names: SCH-420814, CAS# 377727-87-2, Formula: C25H29N9O3, MWT: 503.5563, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

VU 0364439, Alternative-names: , CAS# 1246086-78-1, Formula: C18H13Cl2N3O3S, MWT: 422.2851, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

(Z)-SMI-4a, Alternative-names: , CAS# 438190-29-5, Formula: C11H6F3NO2S, MWT: 273.231, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

YS-49, Alternative-names: , CAS# 132836-42-1, Formula: C20H20BrNO2, MWT: 386.2823, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

WZ811, Alternative-names: , CAS# 55778-02-4, Formula: C18H18N4, MWT: 290.3623, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

TTP 22, Alternative-names: , CAS# 329907-28-0, Formula: C16H14N2O2S2, MWT: 330.4246, Solubility: DMSO: ≥ 51 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: Casein Kinase;Casein Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

EVP-6124 (hydrochloride), Alternative-names: Encenicline hydrochloride, CAS# 550999-74-1, Formula: C16H18Cl2N2OS, MWT: 357.2979, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

NSC 42834, Alternative-names: Z3, CAS# 195371-52-9, Formula: C23H24N2O, MWT: 344.4495, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

KU14R, Alternative-names: , CAS# 189224-48-4, Formula: C13H14N2O, MWT: 214.2631, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Insulin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

D-64131, Alternative-names: , CAS# 74588-78-6, Formula: C16H13NO2, MWT: 251.2799, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

DY131, Alternative-names: GSK 9089, CAS# 95167-41-2, Formula: C18H21N3O2, MWT: 311.3782, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Pifithrin-α (hydrobromide), Alternative-names: Pifithrin hydrobromide;PFTα hydrobromide, CAS# 63208-82-2, Formula: C16H19BrN2OS, MWT: 367.3039, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Zardaverine, Alternative-names: , CAS# 101975-10-4, Formula: C12H10F2N2O3, MWT: 268.2162, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Salubrinal, Alternative-names: , CAS# 405060-95-9, Formula: C21H17Cl3N4OS, MWT: 479.8099, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Metabolic Enzyme/Protease, Target: Autophagy;Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

AM966, Alternative-names: , CAS# 1228690-19-4, Formula: C27H23ClN2O5, MWT: 490.9349, Solubility: DMSO: ≥ 105 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Scriptaid, Alternative-names: Scriptide;GCK1026, CAS# 287383-59-9, Formula: C18H18N2O4, MWT: 326.3465, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;Epigenetics;Cell Cycle/DNA Damage, Target: Autophagy;HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PF-670462, Alternative-names: , CAS# 950912-80-8, Formula: C19H22Cl2FN5, MWT: 410.3159, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: Casein Kinase;Casein Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Ezetimibe, Alternative-names: , CAS# 163222-33-1, Formula: C24H21F2NO3, MWT: 409.4252, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Launched, Pathway: Autophagy;NF-κB, Target: Autophagy;Keap1-Nrf2, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

ARRY-520 (R enantiomer), Alternative-names: , CAS# 885060-08-2, Formula: C20H22F2N4O2S, MWT: 420.4761, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: Kinesin;Kinesin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Varespladib, Alternative-names: LY315920, CAS# 172732-68-2, Formula: C21H20N2O5, MWT: 380.3939, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Vicriviroc (maleate), Alternative-names: Sch-417690;SCH-D, CAS# 599179-03-0, Formula: C32H42F3N5O6, MWT: 649.701, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Bazedoxifene (acetate), Alternative-names: TSE 424;WAY-TES 424, CAS# 198481-33-3, Formula: C32H38N2O5, MWT: 530.6545, Solubility: DMSO: ≥ 5.2 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Dabigatran (ethyl ester), Alternative-names: , CAS# 429658-95-7, Formula: C27H29N7O3, MWT: 499.5643, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Cobimetinib (R-enantiomer), Alternative-names: GDC-0973 R-enantiomer;XL-518 R-enantiomer, CAS# 934660-94-3, Formula: C21H21F3IN3O2, MWT: 531.31, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: MEK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Atorvastatin (hemicalcium salt), Alternative-names: Atorvastatin hemicalcium, CAS# 134523-03-8, Formula: C33H34Ca0.5FN2O5, MWT: 577.6708632, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Autophagy;Metabolic Enzyme/Protease, Target: Autophagy;HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Esomeprazole (Magnesium trihydrate), Alternative-names: (S)-Omeprazole magnesium trihydrate, CAS# 217087-09-7, Formula: C34H42MgN6O9S2, MWT: 767.1671, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Autophagy, Target: Proton Pump;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Esomeprazole (sodium), Alternative-names: (S)-Omeprazole sodium, CAS# 161796-78-7, Formula: C17H18N3NaO3S, MWT: 367.3979, Solubility: 10 mM in H<sub>2</sub>O, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AZD7687, Alternative-names: , CAS# 1166827-44-6, Formula: C21H25N3O3, MWT: 367.4415, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: DGAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

BMS-927711, Alternative-names: Rimegepant, CAS# 1289023-67-1, Formula: C28H28F2N6O3, MWT: 534.5571, Solubility: DMSO: 10 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Neuronal Signaling, Target: CGRP Receptor;CGRP Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

(S)-Timolol (Maleate), Alternative-names: Timolol Maleate, CAS# 26921-17-5, Formula: C17H28N4O7S, MWT: 432.4918, Solubility: DMSO: ≥ 4.4 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Tazarotene, Alternative-names: , CAS# 118292-40-3, Formula: C21H21NO2S, MWT: 351.4619, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

GW791343 (trihydrochloride), Alternative-names: , CAS# 309712-55-8, Formula: C20H27Cl3F2N4O, MWT: 483.8104, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: P2X Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Teriflunomide, Alternative-names: A 77-1726, CAS# 163451-81-8, Formula: C12H9F3N2O2, MWT: 270.2073, Solubility: DMSO: 26 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AG1024, Alternative-names: Tyrphostin AG 1024, CAS# 65678-07-1, Formula: C14H13BrN2O, MWT: 305.1698, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Autophagy, Target: IGF-1R;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Tyrphostin A9, Alternative-names: AG 17; Tyrphostin 9; Malonoben, CAS# 10537-47-0, Formula: C18H22N2O, MWT: 282.3801, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

MK-2048, Alternative-names: , CAS# 869901-69-9, Formula: C21H21ClFN5O4, MWT: 461.8739, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HIV Integrase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Darapladib, Alternative-names: SB-480848, CAS# 356057-34-6, Formula: C36H38F4N4O2S, MWT: 666.7711328, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Anamorelin, Alternative-names: RC-1291;ONO-7643, CAS# 249921-19-5, Formula: C31H42N6O3, MWT: 546.7036, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: GHSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Anamorelin (hydrochloride), Alternative-names: RC-1291 hydrochloride;ONO-7643 hydrochloride;RC1291 hydrochloride;ONO7643 hydrochloride;RC 1291 hydrochloride;ONO 7643 hydrochloride, CAS# 861998-00-7, Formula: C31H43ClN6O3, MWT: 583.1645, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: GHSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

DCC-2036, Alternative-names: Rebastinib, CAS# 1020172-07-9, Formula: C30H28FN7O3, MWT: 553.5869, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: Src;Bcr-Abl;FLT3, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Bortezomib, Alternative-names: PS-341, CAS# 179324-69-7, Formula: C19H25BN4O4, MWT: 384.2372, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Autophagy, Target: Proteasome;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

HC-030031, Alternative-names: , CAS# 349085-38-7, Formula: C18H21N5O3, MWT: 355.3911, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Trelagliptin, Alternative-names: SYR-472, CAS# 865759-25-7, Formula: C18H20FN5O2, MWT: 357.3821, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Trelagliptin (succinate), Alternative-names: SYR-472 succinate, CAS# 1029877-94-8, Formula: C22H26FN5O6, MWT: 475.4702, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Cobimetinib (racemate), Alternative-names: GDC-0973 racemate;XL518, CAS# 934662-91-6, Formula: C21H21F3IN3O2, MWT: 531.31, Solubility: DMSO: ≥ 40 mg/mL, Clinical_Information: Launched, Pathway: MAPK/ERK Pathway, Target: MEK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SR3335, Alternative-names: ML 176, CAS# 293753-05-6, Formula: C13H9F6NO3S2, MWT: 405.3358792, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: ROR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

SR1078, Alternative-names: , CAS# 1246525-60-9, Formula: C17H10F9NO2, MWT: 431.2524288, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: ROR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

R428, Alternative-names: BGB324;Bemcentinib, CAS# 1037624-75-1, Formula: C30H34N8, MWT: 506.6446, Solubility: DMSO: 10.25 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: TAM Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Etoricoxib, Alternative-names: MK-663;MK-0663, CAS# 202409-33-4, Formula: C18H15ClN2O2S, MWT: 358.8419, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

UK-5099, Alternative-names: PF-1005023, CAS# 56396-35-1, Formula: C18H12N2O2, MWT: 288.3001, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Monocarboxylate Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Campathecin, Alternative-names: (S)-(+)-Camptothecin;CPT, CAS# 7689-03-4, Formula: C20H16N2O4, MWT: 348.3521, Solubility: DMSO: 20.66 mg/mL (Need warming), Clinical_Information: Phase 4, Pathway: Cell Cycle/DNA Damage;Antibody-drug Conjugate/ADC Related, Target: Topoisomerase;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Resveratrol, Alternative-names: trans-Resveratrol, CAS# 501-36-0, Formula: C14H12O3, MWT: 228.2433, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Autophagy;NF-κB, Target: Autophagy;IKK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Narciclasine, Alternative-names: Lycoricidinol, CAS# 29477-83-6, Formula: C14H13NO7, MWT: 307.2555, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

10-Deacetylbaccatin III, Alternative-names: , CAS# 32981-86-5, Formula: C29H36O10, MWT: 544.59014, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Asenapine (hydrochloride), Alternative-names: , CAS# 1412458-61-7, Formula: C17H17Cl2NO, MWT: 322.229, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Benfotiamine, Alternative-names: S-Benzoylthiamine O-monophosphate, CAS# 22457-89-2, Formula: C19H23N4O6PS, MWT: 466.4479, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

FK866, Alternative-names: Daporinad;APO866, CAS# 658084-64-1, Formula: C24H29N3O2, MWT: 391.506, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease;Autophagy, Target: Nampt;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Pyridone 6, Alternative-names: CMP 6;JAK Inhibitor, CAS# 457081-03-7, Formula: C18H16FN3O, MWT: 309.3376, Solubility: DMSO: ≥ 31.25 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AN-2728, Alternative-names: Crisaborole, CAS# 906673-24-3, Formula: C14H10BNO3, MWT: 251.0451, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 4, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

AN-2690, Alternative-names: Tavaborole, CAS# 174671-46-6, Formula: C7H6BFO2, MWT: 151.9307, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

BMS-663068, Alternative-names: Fostemsavir, CAS# 864953-29-7, Formula: C25H26N7O8P, MWT: 583.4898, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

BMS-663068 (Tris), Alternative-names: Fostemsavir Tris;Fostemsavir tromethamine, CAS# 864953-39-9, Formula: C29H37N8O11P, MWT: 704.6248, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Idarubicin (hydrochloride), Alternative-names: 4-Demethoxydaunorubicin hydrochloride, CAS# 57852-57-0, Formula: C26H28ClNO9, MWT: 533.9548, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Topoisomerase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

TC-DAPK 6, Alternative-names: DAPK inhibitor, CAS# 315694-89-4, Formula: C17H12N2O2, MWT: 276.2894, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: DAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Moxifloxacin (Hydrochloride), Alternative-names: , CAS# 186826-86-8, Formula: C21H25ClFN3O4, MWT: 437.8923, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Metoclopramide, Alternative-names: , CAS# 364-62-5, Formula: C14H22ClN3O2, MWT: 299.7964, Solubility: DMSO: ≥ 41 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Maropitant, Alternative-names: , CAS# 147116-67-4, Formula: C32H40N2O, MWT: 468.6728, Solubility: DMSO: < 10 mM, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Levomefolate (calcium), Alternative-names: , CAS# 151533-22-1, Formula: C20H23CaN7O6, MWT: 497.5179, Solubility: H<sub>2</sub>O: 4.4 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Antifolate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Levomefolic acid, Alternative-names: 5-MTHF, CAS# 31690-09-2, Formula: C20H25N7O6, MWT: 459.4558, Solubility: H<sub>2</sub>O: 5 mg/mL (Need ultrasonic); DMSO: 0.526 mg/mL , Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Antifolate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

SEA0400, Alternative-names: , CAS# 223104-29-8, Formula: C21H19F2NO3, MWT: 371.3773, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Na+/Ca2+ Exchanger, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

LX-4211, Alternative-names: Sotagliflozin;LP-802034, CAS# 1018899-04-1, Formula: C21H25ClO5S, MWT: 424.9382, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: SGLT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

KN-92, Alternative-names: , CAS# 176708-42-2, Formula: C24H25ClN2O3S, MWT: 456.9849, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: CaMK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Ziprasidone, Alternative-names: CP-88059, CAS# 146939-27-7, Formula: C21H21ClN4OS, MWT: 412.9356, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PF-543 (Citrate), Alternative-names: , CAS# 1415562-83-2, Formula: C33H39NO11S, MWT: 657.7278, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: SPHK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

SB-408124 (Hydrochloride), Alternative-names: , CAS# 1431697-90-3, Formula: C19H19ClF2N4O, MWT: 392.8302, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Orexin Receptor (OX Receptor), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Valspodar, Alternative-names: PSC 833, CAS# 121584-18-7, Formula: C63H111N11O12, MWT: 1214.622, Solubility: DMSO: 12 mg/mL, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: P-glycoprotein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Glibenclamide, Alternative-names: Glyburide, CAS# 10238-21-8, Formula: C23H28ClN3O5S, MWT: 494.0035, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Autophagy;Membrane Transporter/Ion Channel, Target: Autophagy;Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Anamorelin (Fumarate), Alternative-names: ONO-7643 Fumarate;RC1291 Fumarate, CAS# 339539-92-3, Formula: C35H46N6O7, MWT: 662.7758, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: GHSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

NKP608, Alternative-names: , CAS# 177707-12-9, Formula: C31H24ClF6N3O2, MWT: 619.9846, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

VX-661, Alternative-names: Tezacaftor, CAS# 1152311-62-0, Formula: C26H27F3N2O6, MWT: 520.4975896, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: CFTR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

TBB, Alternative-names: NSC 231634;TBB (enzyme inhibitor), CAS# 17374-26-4, Formula: C6HBr4N3, MWT: 434.7083, Solubility: DMSO: ≥ 430 mg/mL , Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: Casein Kinase;Casein Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

D4476, Alternative-names: Casein Kinase I Inhibitor, CAS# 301836-43-1, Formula: C23H18N4O3, MWT: 398.414, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: Autophagy;Casein Kinase;Casein Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

MLN0905, Alternative-names: PLK1 Inhibitor, CAS# 1228960-69-7, Formula: C24H25F3N6S, MWT: 486.5557, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Polo-like Kinase (PLK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

NB-598 (Maleate), Alternative-names: , CAS# 155294-62-5, Formula: C31H35NO5S2, MWT: 565.7433, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

TCS-PIM-1-4a, Alternative-names: SMI-4a, CAS# 327033-36-3, Formula: C11H6F3NO2S, MWT: 273.231, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Thalidomide, Alternative-names: , CAS# 50-35-1, Formula: C13H10N2O4, MWT: 258.2295, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Atomoxetine (hydrochloride), Alternative-names: Tomoxetine hydrochloride; LY 139603; (R)-Tomoxetine hydrochloride, CAS# 82248-59-7, Formula: C17H22ClNO, MWT: 291.8157, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ampalex, Alternative-names: CX516;BDP 12;Ampakine CX516, CAS# 154235-83-3, Formula: C14H15N3O, MWT: 241.2884, Solubility: DMSO: ≥ 41 mg/mL, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

SB-742457, Alternative-names: GSK-742457;RVT-101;Intepirdine, CAS# 607742-69-8, Formula: C19H19N3O2S, MWT: 353.438, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Rosiglitazone, Alternative-names: BRL49653, CAS# 122320-73-4, Formula: C18H19N3O3S, MWT: 357.4268, Solubility: DMSO: ≥ 180 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Membrane Transporter/Ion Channel;Autophagy;NF-κB, Target: PPAR;TRP Channel;Autophagy;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

(±)-Huperzine A, Alternative-names: , CAS# 120786-18-7, Formula: C15H18N2O, MWT: 242.3162, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: AChE, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

LY450108, Alternative-names: , CAS# 376594-67-1, Formula: C19H22F2N2O3S, MWT: 396.4514, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

kb NB 142-70, Alternative-names: , CAS# 1233533-04-4, Formula: C11H9NO2S2, MWT: 251.3247, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: PKD, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

S0859, Alternative-names: , CAS# 1019331-10-2, Formula: C29H24ClN3O3S, MWT: 530.0372, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Na+/HCO3- Cotransporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

CID-2858522, Alternative-names: , CAS# 758679-97-9, Formula: C28H39N3O3, MWT: 465.6276, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

FG-4592, Alternative-names: Roxadustat, CAS# 808118-40-3, Formula: C19H16N2O5, MWT: 352.3407, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

KN-93, Alternative-names: , CAS# 139298-40-1, Formula: C26H29ClN2O4S, MWT: 501.0374, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: CaMK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Genipin, Alternative-names: (+)-Genipin, CAS# 6902-77-8, Formula: C11H14O5, MWT: 226.2259, Solubility: DMSO: ≥ 210 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

9-Dihydro-13-acetylbaccatin III, Alternative-names: 9-DHAB III;13-Acetyl-9-dihydrobaccatin III, CAS# 142203-65-4, Formula: C33H42O12, MWT: 630.6794, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Teneligliptin (hydrobromide), Alternative-names: Teneligliptin, CAS# 906093-29-6, Formula: C22H32.5N6OSBr2.5, MWT: 628.855, Solubility: H<sub>2</sub>O: ≥ 200 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg

B-Raf inhibitor, Alternative-names: , CAS# 1315330-11-0, Formula: C29H31F3N6O2, MWT: 552.5906, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: Raf, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GAP-134, Alternative-names: Danegaptide;ZP 1609, CAS# 943134-39-2, Formula: C14H17N3O4, MWT: 291.3025, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Cytoskeleton, Target: Gap Junction Protein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GAP-134 (Hydrochloride), Alternative-names: Danegaptide Hydrochloride;ZP 1609 Hydrochloride, CAS# 943133-81-1, Formula: C14H18ClN3O4, MWT: 327.7634, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Cytoskeleton, Target: Gap Junction Protein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

GW9662, Alternative-names: , CAS# 22978-25-2, Formula: C13H9ClN2O3, MWT: 276.6752, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Etifoxine (hydrochloride), Alternative-names: HOE 36-801, CAS# 56776-32-0, Formula: C17H18Cl2N2O, MWT: 337.2436, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Etifoxine, Alternative-names: HOE 36-801, CAS# 21715-46-8, Formula: C17H17ClN2O, MWT: 300.7827, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Loxapine, Alternative-names: , CAS# 1977-10-2, Formula: C18H18ClN3O, MWT: 327.808, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Pamabrom, Alternative-names: , CAS# 606-04-2, Formula: C11H18BrN5O3, MWT: 348.1963, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

(3S,4R)-Tofacitinib, Alternative-names: , CAS# 1092578-48-7, Formula: C16H20N6O, MWT: 312.3696, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

(3S,4S)-Tofacitinib, Alternative-names: , CAS# 1092578-47-6, Formula: C16H20N6O, MWT: 312.3696, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

(3R,4S)-Tofacitinib, Alternative-names: , CAS# 1092578-46-5, Formula: C16H20N6O, MWT: 312.3696, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Zalcitabine, Alternative-names: ddC; Dideoxycytidine; 2',3'-Dideoxycytidine, CAS# 7481-89-2, Formula: C9H13N3O3, MWT: 211.2178, Solubility: DMSO: 16.67 mg/mL, Clinical_Information: Phase 4, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AMD-070 (hydrochloride), Alternative-names: , CAS# 880549-30-4, Formula: C21H28ClN5, MWT: 385.93352, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Elacridar, Alternative-names: GF120918;GW0918;GG918;GW120918, CAS# 143664-11-3, Formula: C34H33N3O5, MWT: 563.6429, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Membrane Transporter/Ion Channel, Target: P-glycoprotein;BCRP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Elacridar (hydrochloride), Alternative-names: GF120918A, CAS# 143851-98-3, Formula: C34H34ClN3O5, MWT: 600.1039, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: P-glycoprotein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Olanzapine, Alternative-names: LY170053, CAS# 132539-06-1, Formula: C17H20N4S, MWT: 312.4325, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Autophagy;Neuronal Signaling;GPCR/G Protein, Target: Autophagy;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

CEP-32496, Alternative-names: RXDX-105;Agerafenib, CAS# 1188910-76-0, Formula: C24H22F3N5O5, MWT: 517.4572, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: MAPK/ERK Pathway, Target: Raf, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CEP-32496 (hydrochloride), Alternative-names: RXDX-105 hydrochloride;Agerafenib hydrochloride, CAS# 1227678-26-3, Formula: C24H23ClF3N5O5, MWT: 553.9182, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: MAPK/ERK Pathway, Target: Raf, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SCH900776, Alternative-names: MK-8776, CAS# 891494-63-6, Formula: C15H18BrN7, MWT: 376.2543, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage, Target: Checkpoint Kinase (Chk), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AM095, Alternative-names: , CAS# 1345614-59-6, Formula: C27H23N2NaO5, MWT: 478.4717, Solubility: DMSO: ≥ 170 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SCH900776 (S-isomer), Alternative-names: MK-8776 S-isomer, CAS# 891494-64-7, Formula: C15H18BrN7, MWT: 376.2543, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Checkpoint Kinase (Chk), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

LY 3000328, Alternative-names: , CAS# 1373215-15-6, Formula: C25H29FN4O5, MWT: 484.52, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: Cathepsin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Carboplatin, Alternative-names: cis-Diammine(1,1-cyclobutanedicarboxylato)platinum, CAS# 41575-94-4, Formula: C6H12N2O4Pt, MWT: 371.25448, Solubility: H<sub>2</sub>O: 6.6 mg/mL (Need warming); DMSO: < 6.8 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: DNA Alkylator/Crosslinker;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Cisplatin, Alternative-names: CDDP;cis-Diaminodichloroplatinum, CAS# 15663-27-1, Formula: Cl2H6N2Pt, MWT: 300.051, Solubility: DMSO: ≥ 31 mg/mL (DMSO can inactivate Cisplatin's activity; please see the reference [5])., Clinical_Information: Launched, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Terbinafine hydrochloride, Alternative-names: , CAS# 78628-80-5, Formula: C21H26ClN, MWT: 327.8908, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Butenafine (Hydrochloride), Alternative-names: , CAS# 101827-46-7, Formula: C23H28ClN, MWT: 353.9281, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Strontium Ranelate, Alternative-names: Distrontium renelate;S12911, CAS# 135459-87-9, Formula: C12H6N2O8SSr2, MWT: 513.4896, Solubility: DMSO: < 1 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: CaSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Mitiglinide (Calcium), Alternative-names: KAD-1229;S21403, CAS# 145525-41-3, Formula: C19H24NO3Ca0.5, MWT: 334.44, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Racecadotril, Alternative-names: Acetorphan, CAS# 81110-73-8, Formula: C21H23NO4S, MWT: 385.4766, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Neprilysin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Tegafur, Alternative-names: , CAS# 17902-23-7, Formula: C8H9FN2O3, MWT: 200.1671, Solubility: DMSO: ≥ 48 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

AM095 (free acid), Alternative-names: , CAS# 1228690-36-5, Formula: C27H24N2O5, MWT: 456.4899, Solubility: DMSO: 67.3 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ranolazine (dihydrochloride), Alternative-names: RS 43285, CAS# 95635-56-6, Formula: C24H35Cl2N3O4, MWT: 500.4584, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Autophagy;Membrane Transporter/Ion Channel, Target: Calcium Channel;Autophagy;Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Nisoldipine, Alternative-names: BAY-k 5552, CAS# 63675-72-9, Formula: C20H24N2O6, MWT: 388.41436, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Manidipine (dihydrochloride), Alternative-names: CV-4093, CAS# 89226-75-5, Formula: C35H40Cl2N4O6, MWT: 683.6213, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Cilnidipine, Alternative-names: FRC-8653, CAS# 132203-70-4, Formula: C27H28N2O7, MWT: 492.5204, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Aleglitazar, Alternative-names: R1439;RO0728804, CAS# 475479-34-6, Formula: C24H23NO5S, MWT: 437.50812, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Purmorphamine, Alternative-names: , CAS# 483367-10-8, Formula: C31H32N6O2, MWT: 520.6248, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Autophagy, Target: Smo;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CCT241533 (hydrochloride), Alternative-names: , CAS# 1431697-96-9, Formula: C23H28ClFN4O4, MWT: 478.9442, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Checkpoint Kinase (Chk), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Irinotecan, Alternative-names: (+)-Irinotecan; CPT-11, CAS# 97682-44-5, Formula: C33H38N4O6, MWT: 586.678, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Topoisomerase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Irinotecan (hydrochloride trihydrate), Alternative-names: , CAS# 136572-09-3, Formula: C33H45ClN4O9, MWT: 677.1848, Solubility: DMSO; H<sub>2</sub>O: 1.52 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Topoisomerase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Kanamycin (sulfate), Alternative-names: Kanamycin A monosulfate, CAS# 25389-94-0, Formula: C18H38N4O15S, MWT: 582.57712, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Colchicine, Alternative-names: , CAS# 64-86-8, Formula: C22H25NO6, MWT: 399.437, Solubility: DMSO: ≥ 48 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Autophagy, Target: Microtubule/Tubulin;Microtubule/Tubulin;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Cephalomannine, Alternative-names: , CAS# 71610-00-9, Formula: C45H53NO14, MWT: 831.9006, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Docetaxel, Alternative-names: , CAS# 114977-28-5, Formula: C43H53NO14, MWT: 807.87922, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Paclitaxel, Alternative-names: , CAS# 33069-62-4, Formula: C47H51NO14, MWT: 853.90614, Solubility: DMSO: ≥ 31 mg/mL; H<sub>2</sub>O: < 0.1 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Tropisetron, Alternative-names: SDZ-ICS 930, CAS# 89565-68-4, Formula: C17H20N2O2, MWT: 284.3529, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

OTSSP167, Alternative-names: MELK inhibitor, CAS# 1431697-89-0, Formula: C25H28Cl2N4O2, MWT: 487.4214, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: MELK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

JC-1, Alternative-names: CBIC2, CAS# 3520-43-2, Formula: C25H27Cl4IN4, MWT: 652.2252, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

gamma-secretase modulator 3, Alternative-names: , CAS# 1431697-84-5, Formula: C24H23FN4OS, MWT: 434.529, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Neuronal Signaling, Target: γ-secretase;γ-secretase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

YM-155 (hydrochloride), Alternative-names: , CAS# 355406-09-6, Formula: C20H19ClN4O3, MWT: 398.8429, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis;Autophagy, Target: Survivin;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Cortexolone 17 alpha-propionate, Alternative-names: Cortexolone 17α-propionate;CB-03-01, CAS# 19608-29-8, Formula: C24H34O5, MWT: 402.5238, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CB30865, Alternative-names: ZM 242421, CAS# 206275-15-2, Formula: C26H22BrN5O2, MWT: 516.3892, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Nampt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

(-)-Huperzine A, Alternative-names: Huperzine A, CAS# 102518-79-6, Formula: C15H18N2O, MWT: 242.3162, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: AChE, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

7-xylosyltaxol, Alternative-names: 7-Xylosylpaclitaxel;Taxol-7-xyloside, CAS# 90332-66-4, Formula: C52H59NO18, MWT: 986.0208, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

ABT-199, Alternative-names: GDC-0199;Venetoclax, CAS# 1257044-40-8, Formula: C45H50ClN7O7S, MWT: 868.4392, Solubility: DMSO: ≥ 51 mg/mL, Clinical_Information: Launched, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Crizotinib (hydrochloride), Alternative-names: PF-02341066 hydrochloride, CAS# 1415560-69-8, Formula: C21H23Cl3FN5O, MWT: 486.7976, Solubility: DMSO: ≥ 4.6 mg/mL, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;Autophagy;Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR;Autophagy;ALK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Ulipristal (acetate), Alternative-names: CDB-2914, CAS# 126784-99-4, Formula: C30H37NO4, MWT: 475.6191, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Progesterone Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

LUF6000, Alternative-names: , CAS# 890087-21-5, Formula: C22H20Cl2N4, MWT: 411.327, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

3-O-(2-Aminoethyl)-25-hydroxyvitamin D3, Alternative-names: 25-Hydroxy Vitamin D3 3,3’-Aminopropyl Ether, CAS# 163018-26-6, Formula: C30H51NO2, MWT: 457.73144, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MC 1046, Alternative-names: Impurity A of Calcipotriol, CAS# 126860-83-1, Formula: C27H38O3, MWT: 410.5888, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Impurity F of Calcipotriol, Alternative-names: , CAS# 112875-61-3, Formula: C39H68O3Si2, MWT: 641.12642, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

24R-Calcipotriol, Alternative-names: PRI 2202;Impurity D of Calcipotriol, CAS# 112827-99-3, Formula: C27H40O3, MWT: 412.6047, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MC 976, Alternative-names: , CAS# 129831-99-8, Formula: C27H42O3, MWT: 414.6206, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Deferasirox (Fe3+ chelate), Alternative-names: Exjade Fe3+ chelate, CAS# 554435-83-5, Formula: C21H12FeN3O4, MWT: 426.1827, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AT7519 (trifluoroacetate), Alternative-names: , CAS# 1431697-85-6, Formula: C18H18Cl2F3N5O4, MWT: 496.2678, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Darifenacin, Alternative-names: UK-88525, CAS# 133099-04-4, Formula: C28H30N2O2, MWT: 426.55, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Cinaciguat, Alternative-names: BAY 58-2667, CAS# 329773-35-5, Formula: C36H39NO5, MWT: 565.6985, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Guanylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

DL-threo-2-methylisocitrate, Alternative-names: , CAS# 71183-66-9, Formula: C7H10O7, MWT: 206.1501, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Quetiapine, Alternative-names: , CAS# 111974-69-7, Formula: C21H25N3O2S, MWT: 383.5071, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Alarelin (Acetate), Alternative-names: Alarelin, CAS# 79561-22-1, Formula: C60H86N16O16, MWT: 1287.422, Solubility: DMSO: ≥ 58 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Tolcapone, Alternative-names: Ro 40-7592, CAS# 134308-13-7, Formula: C14H11NO5, MWT: 273.24084, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;Metabolic Enzyme/Protease, Target: COMT;COMT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Exendin-4, Alternative-names: Exenatide;His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, CAS# 141758-74-9, Formula: C184H282N50O60S, MWT: 4186.57188, Solubility: DMSO: ≥ 32 mg/mL; H<sub>2</sub>O: 1.23 mg/mL (Need ultrasonic and warming), Clinical_Information: Phase 4, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

LDE225 (Diphosphate), Alternative-names: NVP-LDE 225 Diphosphate;Erismodegib Diphosphate, CAS# 1218778-77-8, Formula: C26H32F3N3O11P2, MWT: 681.4885, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 3, Pathway: Stem Cell/Wnt, Target: Smo, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Impurity B of Calcitriol, Alternative-names: 1β,25-Dihydroxyvitamin-D3;1-Epicalcitriol, CAS# 66791-71-7, Formula: C27H44O3, MWT: 416.63646, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Impurity C of Calcitriol, Alternative-names: , CAS# 86307-44-0, Formula: C35H49N3O5, MWT: 591.78066, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Impurity C of Alfacalcidol, Alternative-names: , CAS# 82266-85-1, Formula: C35H49N3O4, MWT: 575.7813, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Cholecalciferol, Alternative-names: Vitamin D3;Colecalciferol, CAS# 67-97-0, Formula: C27H44O, MWT: 384.63766, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Saquinavir, Alternative-names: Ro 31-8959, CAS# 127779-20-8, Formula: C38H50N6O5, MWT: 670.8408, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HIV Protease;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Setiptiline, Alternative-names: Org-8282, CAS# 57262-94-9, Formula: C19H19N, MWT: 261.3609, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

GSK256066 (2,2,2-trifluoroacetic acid), Alternative-names: GSK 256066, CAS# 1415560-64-3, Formula: C29H27F3N4O7S, MWT: 632.6075, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

MAC13243, Alternative-names: , CAS# 1071638-38-4, Formula: C20H25Cl2N3O2S, MWT: 442.4024, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

AXL1717, Alternative-names: Picropodophyllotoxin;Picropodophyllin;PPP, CAS# 477-47-4, Formula: C22H22O8, MWT: 414.4053, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK, Target: IGF-1R, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Podophyllotoxin, Alternative-names: Podofilox;PPT, CAS# 518-28-5, Formula: C22H22O8, MWT: 414.4053, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

INNO-206, Alternative-names: Aldoxorubicin;DOXO-EMCH, CAS# 1361644-26-9, Formula: C37H42N4O13, MWT: 750.74838, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;Antibody-drug Conjugate/ADC Related, Target: Topoisomerase;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

NG 52, Alternative-names: Compound 52, CAS# 212779-48-1, Formula: C16H19ClN6O, MWT: 346.8147, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

SQ109, Alternative-names: NSC 722041, CAS# 502487-67-4, Formula: C22H38N2, MWT: 330.5505, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Mibefradil (dihydrochloride), Alternative-names: Ro 40-5967, CAS# 116666-63-8, Formula: C29H40Cl2FN3O3, MWT: 568.5506, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Olprinone, Alternative-names: Loprinone, CAS# 106730-54-5, Formula: C14H10N4O, MWT: 250.2554, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Lersivirine, Alternative-names: UK-453061, CAS# 473921-12-9, Formula: C17H18N4O2, MWT: 310.35042, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

LY2801653, Alternative-names: Merestinib, CAS# 1206799-15-6, Formula: C30H22F2N6O3, MWT: 552.5309, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

(S)-Tedizolid, Alternative-names: (S)-TR 700;(S)-DA 7157, CAS# 1431699-67-0, Formula: C17H15FN6O3, MWT: 370.3378, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Carvedilol, Alternative-names: BM 14190, CAS# 72956-09-3, Formula: C24H26N2O4, MWT: 406.4742, Solubility: DMSO: ≥ 205 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Dexpramipexole (dihydrochloride), Alternative-names: (R)-Pramipexole dihydrochloride;KNS 760704;SND 919CL2X, CAS# 104632-27-1, Formula: C10H19Cl2N3S, MWT: 284.249, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Dexpramipexole, Alternative-names: (R)-Pramipexole;R-(+)-Pramipexole;KNS-760704, CAS# 104632-28-2, Formula: C10H17N3S, MWT: 211.3271, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AT7867 (dihydrochloride), Alternative-names: , CAS# 1431697-86-7, Formula: C20H22Cl3N3, MWT: 410.7678, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Protein Tyrosine Kinase/RTK;PI3K/Akt/mTOR;MAPK/ERK Pathway, Target: PKA;PKA;Akt;Ribosomal S6 Kinase (RSK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Ziprasidone (hydrochloride monohydrate), Alternative-names: CP 88059, CAS# 138982-67-9, Formula: C21H24Cl2N4O2S, MWT: 467.4119, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Desmopressin, Alternative-names: DDAVP, CAS# 16679-58-6, Formula: C46H64N14O12S2, MWT: 1069.217, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Vasopressin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Olprinone (Hydrochloride), Alternative-names: Loprinone (Hydrochloride), CAS# 119615-63-3, Formula: C14H11ClN4O, MWT: 286.7163, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

CP-809101, Alternative-names: , CAS# 479683-64-2, Formula: C15H17ClN4O, MWT: 304.7747, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

VS-5584, Alternative-names: SB2343, CAS# 1246560-33-7, Formula: C17H22N8O, MWT: 354.4096, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: PI3K/Akt/mTOR;PI3K/Akt/mTOR, Target: PI3K;mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

ALW-II-41-27, Alternative-names: Eph receptor tyrosine kinase inhibitor, CAS# 1186206-79-0, Formula: C32H32F3N5O2S, MWT: 607.6889896, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Ephrin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

N-Desethyl Sunitinib, Alternative-names: SU-11662, CAS# 356068-97-8, Formula: C20H23FN4O2, MWT: 370.4206, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Regorafenib (monohydrate), Alternative-names: BAY 73-4506 monohydrate, CAS# 1019206-88-2, Formula: C21H17ClF4N4O4, MWT: 500.8307, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;MAPK/ERK Pathway;Protein Tyrosine Kinase/RTK;Autophagy, Target: VEGFR;Raf;PDGFR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PF-5274857, Alternative-names: , CAS# 1373615-35-0, Formula: C20H25ClN4O3S, MWT: 436.9555, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Smo, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

PHA-767491, Alternative-names: CAY10572, CAS# 845714-00-3, Formula: C12H11N3O, MWT: 213.2352, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AST-1306 (TsOH), Alternative-names: AST-1306 (p-Toluenesulfonic acid);AST1306 (p-Toluenesulfonic acid);AST 1306 (p-Toluenesulfonic acid), CAS# 1050500-29-2, Formula: C31H26ClFN4O5S, MWT: 621.0784, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Tipranavir, Alternative-names: , CAS# 174484-41-4, Formula: C31H33F3N2O5S, MWT: 602.6643, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HIV Protease;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Cilengitide, Alternative-names: EMD 121974, CAS# 188968-51-6, Formula: C27H40N8O7, MWT: 588.6559, Solubility: DMSO: ≥ 44 mg/mL; H<sub>2</sub>O: ≥ 32 mg/mL, Clinical_Information: Phase 3, Pathway: Cytoskeleton;Autophagy, Target: Integrin;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Nilotinib (monohydrochloride monohydrate), Alternative-names: AMN107, CAS# 923288-90-8, Formula: C28H25ClF3N7O2, MWT: 583.992, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;Autophagy, Target: Bcr-Abl;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

ABT-046, Alternative-names: DGAT-1 inhibitor, CAS# 1031336-60-3, Formula: C20H22N4O2, MWT: 350.4143, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: DGAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

EPZ005687, Alternative-names: , CAS# 1396772-26-1, Formula: C32H37N5O3, MWT: 539.6679, Solubility: DMSO: 9.4 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Epigenetics, Target: Histone Methyltransferase;Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Betulinic acid, Alternative-names: Lupatic acid;Betulic acid, CAS# 472-15-1, Formula: C30H48O3, MWT: 456.70032, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Apoptosis;Cell Cycle/DNA Damage;Autophagy, Target: Apoptosis;Topoisomerase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Galanthamine, Alternative-names: Galantamine, CAS# 357-70-0, Formula: C17H21NO3, MWT: 287.3535, Solubility: DMSO: ≥ 59 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: AChE, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Mibefradil, Alternative-names: Ro 40-5967, CAS# 116644-53-2, Formula: C29H38FN3O3, MWT: 495.6287, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

CAL-130, Alternative-names: , CAS# 1431697-74-3, Formula: C23H22N8O, MWT: 426.4738, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CAL-130 (Racemate), Alternative-names: , CAS# 474012-90-3, Formula: C23H22N8O, MWT: 426.4738, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

CP-809101 (hydrochloride), Alternative-names: , CAS# 1215721-40-6, Formula: C15H18Cl2N4O, MWT: 341.2356, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

LCQ-908, Alternative-names: Pradigastat, CAS# 956136-95-1, Formula: C25H24F3N3O2, MWT: 455.4722, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: DGAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

BMN-673 (8R,9S), Alternative-names: Talazoparib (8R,9S);(8R,9S)-LT-673, CAS# 1207456-00-5, Formula: C19H14F2N6O, MWT: 380.3509, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

VCH-916, Alternative-names: , CAS# 1200133-34-1, Formula: C26H36KNO4S, MWT: 497.7316, Solubility: DMSO: ≥ 39 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

SU5416, Alternative-names: Semaxinib, CAS# 204005-46-9, Formula: C15H14N2O, MWT: 238.28446, Solubility: DMSO: 22.5 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Fluvastatin, Alternative-names: , CAS# 93957-54-1, Formula: C24H26FNO4, MWT: 411.4659, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Voriconazole, Alternative-names: UK-109496, CAS# 137234-62-9, Formula: C16H14F3N5O, MWT: 349.3105, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Capadenoson, Alternative-names: BAY 68-4986, CAS# 544417-40-5, Formula: C25H18ClN5O2S2, MWT: 520.0257, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

LY2835219, Alternative-names: ABEMACICLIB;CDK4/6 dual inhibitor, CAS# 1231930-82-7, Formula: C28H36F2N8O3S, MWT: 602.699, Solubility: H<sub>2</sub>O: ≥ 250 mg/mL, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

LY2835219 (free base), Alternative-names: Abemaciclib;CDK4/6 dual inhibitor, CAS# 1231929-97-7, Formula: C27H32F2N8, MWT: 506.5934, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Toceranib (phosphate), Alternative-names: PHA 291639;SU11654, CAS# 874819-74-6, Formula: C22H28FN4O6P, MWT: 494.4531, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: VEGFR;PDGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

HhAntag, Alternative-names: , CAS# 496794-70-8, Formula: C24H23ClN4O3, MWT: 450.9174, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Gli, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Mevastatin, Alternative-names: Compactin;ML236B, CAS# 73573-88-3, Formula: C23H34O5, MWT: 390.5131, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;Metabolic Enzyme/Protease, Target: Autophagy;HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Nystatin, Alternative-names: , CAS# 1400-61-9, Formula: C47H75NO17, MWT: 926.0949, Solubility: DMSO: 24 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Iloperidone, Alternative-names: HP 873, CAS# 133454-47-4, Formula: C24H27FN2O4, MWT: 426.4806, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Limonin, Alternative-names: Limonoic acid 3,19:16,17 dilactone, CAS# 1180-71-8, Formula: C26H30O8, MWT: 470.5116, Solubility: DMSO: ≥ 45 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

BMS-345541 (free base), Alternative-names: , CAS# 445430-58-0, Formula: C14H17N5, MWT: 255.3183, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: IKK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Doxorubicin (hydrochloride), Alternative-names: Adriamycin;Hydroxydaunorubicin hydrochloride, CAS# 25316-40-9, Formula: C27H30ClNO11, MWT: 579.9802, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Antibody-drug Conjugate/ADC Related;Autophagy, Target: Topoisomerase;ADC Cytotoxin;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

NNC 55-0396, Alternative-names: NNC 55-0396 dihydrochloride, CAS# 357400-13-6, Formula: C30H40Cl2FN3O2, MWT: 564.5619, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

OTSSP167 (hydrochloride), Alternative-names: MELK inhibitor, CAS# 1431698-10-0, Formula: C25H29Cl3N4O2, MWT: 523.8824, Solubility: DMSO: ≥ 5.6 mg/mL; H<sub>2</sub>O: 2 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: MELK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

VcMMAE, Alternative-names: , CAS# 646502-53-6, Formula: C68H105N11O15, MWT: 1316.626, Solubility: DMSO: ≥ 54 mg/mL, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

BI-D1870, Alternative-names: , CAS# 501437-28-1, Formula: C19H23F2N5O2, MWT: 391.415, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;MAPK/ERK Pathway, Target: Autophagy;Ribosomal S6 Kinase (RSK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

(24R)-MC 976, Alternative-names: , CAS# 112828-09-8, Formula: C27H42O3, MWT: 414.6206, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

(24S)-MC 976, Alternative-names: , CAS# 112849-14-6, Formula: C27H42O3, MWT: 414.6206, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Vitamin D Related, Target: VD/VDR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Zidovudine, Alternative-names: Azidothymidine;AZT;ZDV, CAS# 30516-87-1, Formula: C10H13N5O4, MWT: 267.2413, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

RG108, Alternative-names: N-Phthalyl-L-tryptophan, CAS# 48208-26-0, Formula: C19H14N2O4, MWT: 334.32546, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: DNA Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

MTEP (hydrochloride), Alternative-names: 3-((2-Methyl-1,3-thiazol-4-yl)ethyn-yl)pyridine hydrochloride;MTEP, CAS# 1186195-60-7, Formula: C11H9ClN2S, MWT: 236.7206, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

A-317491, Alternative-names: , CAS# 475205-49-3, Formula: C33H27NO8, MWT: 565.5694, Solubility: DMSO: ≥ 47 mg/mL; H<sub>2</sub>O: < 0.1 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Autophagy, Target: P2X Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CDK9-IN-2, Alternative-names: , CAS# 1263369-28-3, Formula: C23H25ClFN5, MWT: 425.9295, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

L-Stepholidine, Alternative-names: Stepholidine;(-)-Stepholidine;L-SPD, CAS# 16562-13-3, Formula: C19H21NO4, MWT: 327.3743, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Guanfacine (hydrochloride), Alternative-names: Guanfacine, CAS# 29110-48-3, Formula: C9H10Cl3N3O, MWT: 282.5542, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

GSK 525768A, Alternative-names: , CAS# 1260530-25-3, Formula: C22H22ClN5O2, MWT: 423.8954, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Minocycline (hydrochloride), Alternative-names: , CAS# 13614-98-7, Formula: C23H28ClN3O7, MWT: 493.9373, Solubility: H<sub>2</sub>O: 2.45 mg/mL; DMSO: 0.49 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

(-)-Epigallocatechin Gallate, Alternative-names: EGCG;Epigallocatechol Gallate, CAS# 989-51-5, Formula: C22H18O11, MWT: 458.3717, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 4, Pathway: Cell Cycle/DNA Damage;Autophagy;Epigenetics, Target: Telomerase;Autophagy;DNA Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

HDAC-IN-1, Alternative-names: , CAS# 1239610-44-6, Formula: C17H15FN2O3, MWT: 314.311, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Tariquidar (methanesulfonate, hydrate), Alternative-names: XR9576, CAS# 625375-83-9, Formula: C40H52N4O15S2, MWT: 892.9887, Solubility: DMSO: ≥ 296 mg/mL; H<sub>2</sub>O: < 8.9 mg/mL, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: P-glycoprotein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Bitopertin (R enantiomer), Alternative-names: RG1678 (R enantiomer);RG 1678 (R enantiomer);RG-1678 (R enantiomer);RO4917838 (R enantiomer), CAS# 845614-12-2, Formula: C21H20F7N3O4S, MWT: 543.4550224, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GlyT;GlyT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

GSK3787, Alternative-names: , CAS# 188591-46-0, Formula: C15H12ClF3N2O3S, MWT: 392.7806, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

KN-92 (phosphate), Alternative-names: , CAS# 1135280-28-2, Formula: C24H28ClN2O7PS, MWT: 554.9801, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: CaMK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

KN-92 (hydrochloride), Alternative-names: , CAS# 1431698-47-3, Formula: C24H26Cl2N2O3S, MWT: 493.4458, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: CaMK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Bosentan (hydrate), Alternative-names: Benzenesulfonamide, CAS# 157212-55-0, Formula: C27H31N5O7S, MWT: 569.6293, Solubility: DMSO: ≥ 250 mg/mL; Ethanol: 118 mg/mL (Need ultrasonic and warming); H<sub>2</sub>O: < 0.1 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Entacapone, Alternative-names: , CAS# 130929-57-6, Formula: C14H15N3O5, MWT: 305.286, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;Metabolic Enzyme/Protease, Target: COMT;COMT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Fulvestrant, Alternative-names: ICI 182780;ZD 182780;ZD 9238;ZM 182780, CAS# 129453-61-8, Formula: C32H47F5O3S, MWT: 606.7708, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Launched, Pathway: Others;Autophagy, Target: Estrogen Receptor/ERR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Toremifene, Alternative-names: GTx 006;Z-Toremifene, CAS# 89778-26-7, Formula: C26H28ClNO, MWT: 405.9596, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Retinoic acid, Alternative-names: ATRA;Tretinoin;Vitamin A acid;all-trans-Retinoic acid, CAS# 302-79-4, Formula: C20H28O2, MWT: 300.4351, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage;NF-κB, Target: RAR/RXR;PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Doxifluridine, Alternative-names: Ro 21-9738;5-Fluoro-5'-deoxyuridine;5'-DFUR, CAS# 3094-09-5, Formula: C9H11FN2O5, MWT: 246.1924, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Daunorubicin (Hydrochloride), Alternative-names: RP 13057 Hydrochloride;Daunomycin;RP13057 Hydrochloride;RP-13057 Hydrochloride;Rubidomycin hydrochloride, CAS# 23541-50-6, Formula: C27H30ClNO10, MWT: 563.9808, Solubility: H<sub>2</sub>O: ≥ 34 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Antibody-drug Conjugate/ADC Related;Autophagy, Target: Topoisomerase;ADC Cytotoxin;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Toremifene (Citrate), Alternative-names: FC 1157a;NK 622, CAS# 89778-27-8, Formula: C32H36ClNO8, MWT: 598.0831, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Kaempferol, Alternative-names: Robigenin;Kempferol, CAS# 520-18-3, Formula: C15H10O6, MWT: 286.2363, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others;Autophagy, Target: Estrogen Receptor/ERR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

NB-598, Alternative-names: , CAS# 131060-14-5, Formula: C27H31NOS2, MWT: 449.6711, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

NB-598 (hydrochloride), Alternative-names: , CAS# 136719-25-0, Formula: C27H32ClNOS2, MWT: 486.1321, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

PCI-34051, Alternative-names: , CAS# 950762-95-5, Formula: C17H16N2O3, MWT: 296.3205, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Otenabant (Hydrochloride), Alternative-names: CP 945598 Hydrochloride, CAS# 686347-12-6, Formula: C25H26Cl3N7O, MWT: 546.8792, Solubility: DMSO: 1 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Otenabant, Alternative-names: CP-945598, CAS# 686344-29-6, Formula: C25H25Cl2N7O, MWT: 510.4183, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CI-994, Alternative-names: Acetyldinaline;Tacedinaline;PD 123654;Goe 5549, CAS# 112522-64-2, Formula: C15H15N3O2, MWT: 269.2985, Solubility: DMSO: ≥ 58 mg/mL, Clinical_Information: Phase 3, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

LY2608204, Alternative-names: , CAS# 1234703-40-2, Formula: C28H37N3O3S3, MWT: 559.8067, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Glucokinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

IKK 16, Alternative-names: , CAS# 873225-46-8, Formula: C28H29N5OS, MWT: 483.6277, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: IKK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

TAK-733, Alternative-names: , CAS# 1035555-63-5, Formula: C17H15F2IN4O4, MWT: 504.2267, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 1, Pathway: MAPK/ERK Pathway, Target: MEK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AZD5363, Alternative-names: Capivasertib, CAS# 1143532-39-1, Formula: C21H25ClN6O2, MWT: 428.9152, Solubility: DMSO: ≥ 10 mg/mL, Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR;Autophagy, Target: Akt;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

OC000459, Alternative-names: Timapiprant, CAS# 851723-84-7, Formula: C21H17FN2O2, MWT: 348.3703, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GW9508, Alternative-names: , CAS# 885101-89-3, Formula: C22H21NO3, MWT: 347.407, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPR40, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

5-Azacytidine, Alternative-names: Ladakamycin;5-AzaC;Azacitidine, CAS# 320-67-2, Formula: C8H12N4O5, MWT: 244.2047, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Launched  , Pathway: Cell Cycle/DNA Damage;Autophagy;Epigenetics, Target: Nucleoside Antimetabolite/Analog;Autophagy;DNA Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Daminozide, Alternative-names: , CAS# 1596-84-5, Formula: C6H12N2O3, MWT: 160.1711, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

DMAT, Alternative-names: Casein kinase II Inhibitor;CK2 Inhibitor, CAS# 749234-11-5, Formula: C9H7Br4N3, MWT: 476.788, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: Casein Kinase;Casein Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

(+)-MK 801 (Maleate), Alternative-names: Dizocilpine maleate;Dizocilpine hydrogen maleate;(+)-MK 801;MK 801, CAS# 77086-22-7, Formula: C20H19NO4, MWT: 337.3692, Solubility: 10 mM in DMSO; Ethanol：6 mg/mL; H<sub>2</sub>O：< 0.6 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

MLN120B, Alternative-names: ML120B, CAS# 783348-36-7, Formula: C19H15ClN4O2, MWT: 366.801, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: IKK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

A 438079 (hydrochloride), Alternative-names: , CAS# 899431-18-6, Formula: C13H10Cl3N5, MWT: 342.611, Solubility: H<sub>2</sub>O: ≥ 350 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: P2X Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

A 438079, Alternative-names: , CAS# 899507-36-9, Formula: C13H9Cl2N5, MWT: 306.1501, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: P2X Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Metiamide, Alternative-names: , CAS# 34839-70-8, Formula: C9H16N4S2, MWT: 244.3801, Solubility: DMSO：≥ 2.4 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

BMX-IN-1, Alternative-names: BMX kinase inhibitor, CAS# 1431525-23-3, Formula: C29H24N4O4S, MWT: 524.5903, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: BMX Kinase;Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Bicalutamide, Alternative-names: , CAS# 90357-06-5, Formula: C18H14F4N2O4S, MWT: 430.3733728, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others;Autophagy, Target: Androgen Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Pemetrexed, Alternative-names: LY231514, CAS# 137281-23-3, Formula: C20H21N5O6, MWT: 427.41064, Solubility: 10 mM in H<sub>2</sub>O, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Antifolate;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Pemetrexed (disodium), Alternative-names: LY231514 disodium, CAS# 150399-23-8, Formula: C20H19N5Na2O6, MWT: 471.37429856, Solubility: H<sub>2</sub>O: 11.19 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Antifolate;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Salinomycin, Alternative-names: Procoxacin, CAS# 53003-10-4, Formula: C42H70O11, MWT: 750.9986, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Anti-infection;Autophagy;Stem Cell/Wnt, Target: β-catenin;Bacterial;Autophagy;Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CAL-130 (Hydrochloride), Alternative-names: , CAS# 1431697-78-7, Formula: C23H23ClN8O, MWT: 462.9347, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Hoechst 33258, Alternative-names: bisBenzimide H 33258;H 33258, CAS# 23491-44-3, Formula: C25H24N6O, MWT: 424.4977, Solubility: DMSO: ≥ 44 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Hoechst 33342, Alternative-names: bisBenzimide H 33342;HOE 33342, CAS# 23491-52-3, Formula: C27H28N6O, MWT: 452.5508, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Hoechst 34580, Alternative-names: HOE 34580, CAS# 23555-00-2, Formula: C27H29N7, MWT: 451.5661, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Amyloid-β, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Nuclear yellow, Alternative-names: , CAS# 74681-68-8, Formula: C25H28Cl3N7O2S, MWT: 596.9595, Solubility: H<sub>2</sub>O: ≥ 6 mg/mL; DMSO: < 12.2 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

HOE-S 785026, Alternative-names: meta-Hoechst, CAS# 132869-83-1, Formula: C25H24N6O, MWT: 424.4977, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Methylproamine, Alternative-names: , CAS# 188247-01-0, Formula: C28H31N7, MWT: 465.5927, Solubility: DMSO: ≥ 41 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

HOE 32021, Alternative-names: , CAS# 23623-06-5, Formula: C26H26N6O, MWT: 438.5242, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

HOE 33187, Alternative-names: , CAS# 23623-08-7, Formula: C25H24N6, MWT: 408.4983, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

DMA, Alternative-names: , CAS# 188860-26-6, Formula: C27H28N6O2, MWT: 468.5502, Solubility: DMSO: ≥ 54 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

meta-iodoHoechst 33258, Alternative-names: iodoHoechst 33258, CAS# 158013-42-4, Formula: C25H23IN6, MWT: 534.3948, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Hoechst 33258 analog, Alternative-names: , CAS# 258843-62-8, Formula: C29H30N6O3, MWT: 510.5869, Solubility: DMSO: ≥ 51 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Hoechst 33258 analog 2, Alternative-names: , CAS# 23491-54-5, Formula: C26H26N6, MWT: 422.5248, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Hoechst 33258 analog 3, Alternative-names: , CAS# 23554-98-5, Formula: C26H26N6, MWT: 422.5248, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ortho-iodoHoechst 33258, Alternative-names: iodoHoechst 33258, CAS# 158013-41-3, Formula: C25H23IN6, MWT: 534.3948, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Hoechst 33342 analog, Alternative-names: , CAS# 178481-68-0, Formula: C32H37Cl2N7, MWT: 590.5891, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Hoechst 33258 analog 5, Alternative-names: , CAS# 23491-55-6, Formula: C29H26N6, MWT: 458.5569, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

HOE 32020, Alternative-names: , CAS# 23554-99-6, Formula: C25H23ClN6, MWT: 442.9433, Solubility: DMSO: ≥ 69 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Hoechst 33342 analog 2, Alternative-names: , CAS# 106050-84-4, Formula: C25H23IN6O, MWT: 550.3942, Solubility: DMSO: ≥ 57 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Hoechst 33258 analog 6, Alternative-names: , CAS# 129244-66-2, Formula: C33H40N6O, MWT: 536.7103, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

para-iodoHoechst 33258, Alternative-names: iodoHoechst 33258, CAS# 158013-43-5, Formula: C25H23IN6, MWT: 534.3948, Solubility: DMSO: 20.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA Stain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

RepSox, Alternative-names: E-616452;SJN 2511, CAS# 446859-33-2, Formula: C17H13N5, MWT: 287.3186, Solubility: DMSO: ≥ 52 mg/mL, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad, Target: TGF-β Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CGK733, Alternative-names: , CAS# 905973-89-9, Formula: C23H18Cl3FN4O3S, MWT: 555.8364232, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;PI3K/Akt/mTOR, Target: ATM/ATR;ATM/ATR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Cebranopadol, Alternative-names: GRT6005, CAS# 863513-91-1, Formula: C24H27FN2O, MWT: 378.4824, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Palifosfamide, Alternative-names: Isophosphoramide mustard;IPM;ZIO-201, CAS# 31645-39-3, Formula: C4H11Cl2N2O2P, MWT: 221.022102, Solubility: DMSO: ≥ 42 mg/mL, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage, Target: DNA Alkylator/Crosslinker, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Formoterol (Fumarate), Alternative-names: Formoterol, CAS# 43229-80-7, Formula: C19H24N2O4 . 1/2C4H4O4, MWT: 402.44, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Palbociclib (hydrochloride), Alternative-names: PD 0332991 hydrochloride, CAS# 827022-32-2, Formula: C24H30ClN7O2, MWT: 483.9937, Solubility: DMSO: 6 mg/mL (Need ultrasonic or warming); H<sub>2</sub>O: 4.9 mg/mL (Need ultrasonic or warming), Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

DOXO-EMCH, Alternative-names: Doxorubicin-EMCH, CAS# 151038-96-9, Formula: C37H42N4O13, MWT: 750.7484, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;Antibody-drug Conjugate/ADC Related, Target: Topoisomerase;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Afatinib (dimaleate), Alternative-names: BIBW 2992MA2;BIBW2992;Afatinib, CAS# 850140-73-7, Formula: C32H33ClFN5O11, MWT: 718.0827, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK;Autophagy, Target: EGFR;EGFR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

WEHI-539, Alternative-names: , CAS# 1431866-33-9, Formula: C31H29N5O3S2, MWT: 583.7236, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Edoxaban, Alternative-names: DU-176, CAS# 480449-70-5, Formula: C24H30ClN7O4S, MWT: 548.0575, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Factor Xa, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Edoxaban (tosylate), Alternative-names: DU-176b, CAS# 480449-71-6, Formula: C31H38ClN7O7S2, MWT: 720.2591, Solubility: DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Factor Xa, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Edoxaban (tosylate monohydrate), Alternative-names: , CAS# 1229194-11-9, Formula: C31H40ClN7O8S2, MWT: 738.2744, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Factor Xa, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Poloxime, Alternative-names: , CAS# 17302-61-3, Formula: C10H13NO2, MWT: 179.2157, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Polo-like Kinase (PLK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Vinblastine, Alternative-names: , CAS# 865-21-4, Formula: C46H58N4O9, MWT: 810.97412, Solubility: DMSO: ≥ 42 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Neuronal Signaling;Membrane Transporter/Ion Channel, Target: Microtubule/Tubulin;Microtubule/Tubulin;nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

MPTP (hydrochloride), Alternative-names: , CAS# 23007-85-4, Formula: C12H16ClN, MWT: 209.7151, Solubility: DMSO: 12 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Omadacycline, Alternative-names: PTK 0796;Amadacycline, CAS# 389139-89-3, Formula: C29H40N4O7, MWT: 556.6505, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

BMS 299897, Alternative-names: , CAS# 290315-45-6, Formula: C24H21ClF3NO4S, MWT: 511.9410496, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Neuronal Signaling, Target: γ-secretase;γ-secretase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Dynasore, Alternative-names: , CAS# 304448-55-3, Formula: C18H14N2O4, MWT: 322.3148, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cytoskeleton, Target: Dynamin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

SCH-1473759, Alternative-names: , CAS# 1094069-99-4, Formula: C20H26N8OS, MWT: 426.5385, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Epigenetics, Target: Aurora Kinase;Aurora Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

M344, Alternative-names: D 237;MS 344, CAS# 251456-60-7, Formula: C16H25N3O3, MWT: 307.388, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Talarozole, Alternative-names: R115866, CAS# 201410-53-9, Formula: C21H23N5S, MWT: 377.5058, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

EMD638683, Alternative-names: , CAS# 1181770-72-8, Formula: C18H18F2N2O4, MWT: 364.3433, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: SGK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

LY404039, Alternative-names: , CAS# 635318-11-5, Formula: C7H9NO6S, MWT: 235.2145, Solubility: DMSO:1 mg/mL;H<sub>2</sub>O:< 1 mg/mL, Clinical_Information: Phase 1, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Tenofovir (Disoproxil Fumarate), Alternative-names: Tenofovir DF, CAS# 202138-50-9, Formula: C23H34N5O14P, MWT: 635.5149, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection;Anti-infection, Target: HBV;Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Lu AE58054, Alternative-names: Idalopirdine, CAS# 467459-31-0, Formula: C20H19F5N2O, MWT: 398.3697, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Pirodavir, Alternative-names: R77975, CAS# 124436-59-5, Formula: C21H27N3O3, MWT: 369.4574, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Enterovirus, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

ZM 306416, Alternative-names: CB 676475, CAS# 690206-97-4, Formula: C16H13ClFN3O2, MWT: 333.7447, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

LY 344864, Alternative-names: , CAS# 186544-26-3, Formula: C21H22FN3O, MWT: 351.4173, Solubility: DMSO: ≥ 350 mg/mL , Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ZM323881 (hydrochloride), Alternative-names: , CAS# 193000-39-4, Formula: C22H19ClFN3O2, MWT: 411.8566, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

GS-9620, Alternative-names: Vesatolimod, CAS# 1228585-88-3, Formula: C22H30N6O2, MWT: 410.5126, Solubility: DMSO: 4.8 mg/mL (Need ultrasonic), Clinical_Information: Phase 2, Pathway: Immunology/Inflammation, Target: Toll-like Receptor (TLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Acyclovir, Alternative-names: Aciclovir;Acycloguanosine, CAS# 59277-89-3, Formula: C8H11N5O3, MWT: 225.2046, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: HSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Abacavir, Alternative-names: , CAS# 136470-78-5, Formula: C14H18N6O, MWT: 286.3323, Solubility: DMSO: ≥ 3 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Penciclovir, Alternative-names: BRL 39123;VSA 671, CAS# 39809-25-1, Formula: C10H15N5O3, MWT: 253.2578, Solubility: DMSO: ≥ 53 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: HSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Valacyclovir, Alternative-names: Valaciclovir, CAS# 124832-26-4, Formula: C13H20N6O4, MWT: 324.3357, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: HSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Famciclovir, Alternative-names: BRL 42810, CAS# 104227-87-4, Formula: C14H19N5O4, MWT: 321.3318, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: HSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

VAL-083, Alternative-names: Dianhydrodulcitol;Dianhydrogalactitol, CAS# 23261-20-3, Formula: C6H10O4, MWT: 146.1412, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage, Target: DNA Alkylator/Crosslinker, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Lu AE58054 (Hydrochloride), Alternative-names: Idalopirdine Hydrochloride, CAS# 467458-02-2, Formula: C20H20ClF5N2O, MWT: 434.8306, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

FK 3311, Alternative-names: , CAS# 116686-15-8, Formula: C15H13F2NO4S, MWT: 341.3298, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

NP118809, Alternative-names: 39-1B4, CAS# 41332-24-5, Formula: C32H32N2O, MWT: 460.6093, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

PFI-1, Alternative-names: , CAS# 1403764-72-6, Formula: C16H17N3O4S, MWT: 347.3889, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Folinic acid (Calcium), Alternative-names: Leucovorin Calcium;Calcium Folinate, CAS# 1492-18-8, Formula: C20H21CaN7O7, MWT: 511.50144, Solubility: H<sub>2</sub>O: ≥ 200 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Antifolate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Mesna, Alternative-names: Sodium 2-mercaptoethanesulfonate;Mesnum, CAS# 19767-45-4, Formula: C2H5NaO3S2, MWT: 164.17906928, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Vinblastine (sulfate), Alternative-names: Vincaleukoblastine sulfate salt, CAS# 143-67-9, Formula: C46H60N4O13S, MWT: 909.0526, Solubility: DMSO: ≥ 44 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Autophagy, Target: Microtubule/Tubulin;Microtubule/Tubulin;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Teniposide, Alternative-names: VM26, CAS# 29767-20-2, Formula: C32H32O13S, MWT: 656.6537, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Milrinone, Alternative-names: Win 47203, CAS# 78415-72-2, Formula: C12H9N3O, MWT: 211.21936, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

ALK-IN-1, Alternative-names: , CAS# 1197958-12-5, Formula: C26H34ClN6O2P, MWT: 529.0139, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: ALK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Azilsartan (medoxomil), Alternative-names: TAK-491, CAS# 863031-21-4, Formula: C30H24N4O8, MWT: 568.5336, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Emtricitabine, Alternative-names: BW1592, CAS# 143491-57-0, Formula: C8H10FN3O3S, MWT: 247.2467, Solubility: DMSO: 10.8 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Amiodarone (hydrochloride), Alternative-names: , CAS# 19774-82-4, Formula: C25H30ClI2NO3, MWT: 681.7725, Solubility: DMSO: 24.5 mg/mL, Clinical_Information: Launched, Pathway: Autophagy;Membrane Transporter/Ion Channel, Target: Autophagy;Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Atrasentan, Alternative-names: ABT-627;(+)-A 127722;A-147627, CAS# 173937-91-2, Formula: C29H38N2O6, MWT: 510.6218, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Atrasentan (hydrochloride), Alternative-names: ABT-627;Abbott 147627, CAS# 195733-43-8, Formula: C29H39ClN2O6, MWT: 547.0828, Solubility: DMSO: ≥ 33.3 mg/mL; H<sub>2</sub>O: < 5 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

MK-5172, Alternative-names: Grazoprevir, CAS# 1350514-68-9, Formula: C38H50N6O9S, MWT: 766.9034, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

MK-5172 (potassium salt), Alternative-names: Grazoprevir potassium salt, CAS# 1206524-86-8, Formula: C38H49KN6O9S, MWT: 804.9938, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

MK-5172 (hydrate), Alternative-names: Grazoprevir hydrate, CAS# 1350462-55-3, Formula: C38H52N6O10S, MWT: 784.9187, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

MK-5172 (sodium salt), Alternative-names: Grazoprevir sodium salt, CAS# 1425038-27-2, Formula: C38H49N6NaO9S, MWT: 788.8853, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Baricitinib (phosphate), Alternative-names: INCB028050;LY3009104, CAS# 1187595-84-1, Formula: C16H20N7O6PS, MWT: 469.412, Solubility: DMSO: ≥ 4.7 mg/mL, Clinical_Information: Launched, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Reparixin, Alternative-names: Repertaxin;DF 1681Y, CAS# 266359-83-5, Formula: C14H21NO3S, MWT: 283.3864, Solubility: DMSO: ≥ 500 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Reparixin (L-lysine salt), Alternative-names: Repertaxin L-lysine salt, CAS# 266359-93-7, Formula: C20H35N3O5S, MWT: 429.574, Solubility: H<sub>2</sub>O: ≥ 200 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

BMS-564929, Alternative-names: , CAS# 627530-84-1, Formula: C14H12ClN3O3, MWT: 305.7164, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

AZD-3463, Alternative-names: ALK/IGF1R inhibitor, CAS# 1356962-20-3, Formula: C24H25ClN6O, MWT: 448.9479, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Autophagy;Protein Tyrosine Kinase/RTK, Target: IGF-1R;Autophagy;ALK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

mTOR-IN-1, Alternative-names: , CAS# 1207358-59-5, Formula: C25H30N8O2, MWT: 474.5581, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

LY 303511, Alternative-names: , CAS# 154447-38-8, Formula: C19H18N2O2, MWT: 306.3584, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Lomeguatrib, Alternative-names: PaTrin-2, CAS# 192441-08-0, Formula: C10H8BrN5OS, MWT: 326.1724, Solubility: DMSO: ≥ 56 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: DNA Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PQ401, Alternative-names: , CAS# 196868-63-0, Formula: C18H16ClN3O2, MWT: 341.7915, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: IGF-1R, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AG 18, Alternative-names: RG-50810;Tyrphostin A23, CAS# 118409-57-7, Formula: C10H6N2O2, MWT: 186.1668, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

SC-514, Alternative-names: GK 01140, CAS# 354812-17-2, Formula: C9H8N2OS2, MWT: 224.3026, Solubility: DMSO: ≥ 53 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: IKK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Lesinurad, Alternative-names: RDEA594, CAS# 878672-00-5, Formula: C17H14BrN3O2S, MWT: 404.2809, Solubility: DMSO: ≥ 39 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: URAT1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Tilbroquinol, Alternative-names: , CAS# 7175-09-9, Formula: C10H8BrNO, MWT: 238.0806, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Ebrotidine, Alternative-names: FI3542, CAS# 100981-43-9, Formula: C14H17BrN6O2S3, MWT: 477.4228, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Zaltidine, Alternative-names: CP-57361, CAS# 85604-00-8, Formula: C8H10N6S, MWT: 222.2702, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

(S)-(+)-Ibuprofen, Alternative-names: (S)-Ibuprofen, CAS# 51146-56-6, Formula: C13H18O2, MWT: 206.2808, Solubility: H<sub>2</sub>O: 1 mg/mL (Need ultrasonic and warming); DMSO: < 0.1 mg/mL, Clinical_Information: Phase 1, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

(R)-(-)-Ibuprofen, Alternative-names: (R)-Ibuprofen, CAS# 51146-57-7, Formula: C13H18O2, MWT: 206.2808, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Tripelennamine (hydrochloride), Alternative-names: Pyribenzamine hydrochloride, CAS# 154-69-8, Formula: C16H22ClN3, MWT: 291.819, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Azilsartan, Alternative-names: TAK-536, CAS# 147403-03-0, Formula: C25H20N4O5, MWT: 456.4501, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Sodium phenylbutyrate, Alternative-names: Sodium 4-phenylbutyrate;TriButyrate, CAS# 1716-12-7, Formula: C10H11NaO2, MWT: 186.1829, Solubility: H<sub>2</sub>O: 23.5 mg/mL, Clinical_Information: Launched, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Dabigatran etexilate (mesylate), Alternative-names: BIBR 1048MS;Dabigatran etexilate methanesulfonate, CAS# 872728-81-9, Formula: C35H45N7O8S, MWT: 723.8389, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Dabigatran, Alternative-names: BIBR 953;BIBR 953ZW, CAS# 211914-51-1, Formula: C25H25N7O3, MWT: 471.5111, Solubility: DMSO: < 1 mg/mL; H<sub>2</sub>O: < 1 mg/mL, Clinical_Information: Phase 4, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Flecainide (acetate), Alternative-names: , CAS# 54143-56-5, Formula: C19H24F6N2O5, MWT: 474.3947, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

GSK126, Alternative-names: EZH2 inhibitor;GSK2816126A, CAS# 1346574-57-9, Formula: C31H38N6O2, MWT: 526.6724, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Epigenetics, Target: Histone Methyltransferase;Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AZD-2461, Alternative-names: , CAS# 1174043-16-3, Formula: C22H22FN3O3, MWT: 395.4268, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

RITA, Alternative-names: NSC 652287, CAS# 213261-59-7, Formula: C14H12O3S2, MWT: 292.3733, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;Autophagy;Apoptosis, Target: DNA Alkylator/Crosslinker;Autophagy;MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

GW1929, Alternative-names: , CAS# 196808-24-9, Formula: C30H29N3O4, MWT: 495.569, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

LDK378, Alternative-names: Ceritinib, CAS# 1032900-25-6, Formula: C28H36ClN5O3S, MWT: 558.1351, Solubility: DMSO: 5.6 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: IGF-1R;Insulin Receptor;ALK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

LDK378 (dihydrochloride), Alternative-names: Ceritinib dihydrochloride, CAS# 1380575-43-8, Formula: C28H38Cl3N5O3S, MWT: 631.057, Solubility: H<sub>2</sub>O: ≥ 170 mg/mL, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: IGF-1R;Insulin Receptor;ALK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

DCC-2618, Alternative-names: , CAS# 1225278-16-9, Formula: C26H21F2N5O3, MWT: 489.4734, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR;c-Kit, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GW 441756, Alternative-names: , CAS# 504433-23-2, Formula: C17H13N3O, MWT: 275.30462, Solubility: DMSO: < 11.2 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Trk Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Amprenavir, Alternative-names: , CAS# 161814-49-9, Formula: C25H35N3O6S, MWT: 505.6269, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HIV Protease;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Fosamprenavir (Calcium Salt), Alternative-names: GW433908G, CAS# 226700-81-8, Formula: C25H34CaN3O9PS, MWT: 623.6689, Solubility: H<sub>2</sub>O: 0.25 mg/mL (Need ultrasonic and warming); DMSO: 1.8 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HIV Protease;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Emodin, Alternative-names: Frangula emodin, CAS# 518-82-1, Formula: C15H10O5, MWT: 270.2369, Solubility: DMSO: 9.4 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: Autophagy;Casein Kinase;Casein Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Formoterol, Alternative-names: (-)-Formoterol;Arformoterol;(R,R)-Formoterol, CAS# 67346-49-0, Formula: C19H24N2O4, MWT: 344.40486, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Tadalafil, Alternative-names: , CAS# 171596-29-5, Formula: C22H19N3O4, MWT: 389.404, Solubility: DMSO: ≥ 52 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Boldenone Undecylenate, Alternative-names: , CAS# 13103-34-9, Formula: C30H44O3, MWT: 452.6685, Solubility: DMSO: ≥ 41 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

EPZ-5676, Alternative-names: Pinometostat, CAS# 1380288-87-8, Formula: C30H42N8O3, MWT: 562.7063, Solubility: DMSO: ≥ 47.8 mg/mL, Clinical_Information: Phase 1, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Wnt-C59, Alternative-names: C59, CAS# 1243243-89-1, Formula: C25H21N3O, MWT: 379.4537, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Stem Cell/Wnt, Target: Porcupine;Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SCH772984, Alternative-names: , CAS# 942183-80-4, Formula: C33H33N9O2, MWT: 587.6742, Solubility: DMSO: ≥ 51 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Pemetrexed (disodium hemipenta hydrate), Alternative-names: Pemetrexed sodium hydrate, CAS# 357166-30-4, Formula: C20H21N5O6 . 5/2 H2O . 2Na, MWT: 516.41, Solubility: H<sub>2</sub>O: ≥ 29 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Antifolate;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Inolitazone (dihydrochloride), Alternative-names: Efatutazone;CS-7017;RS5444, CAS# 223132-38-5, Formula: C27H28Cl2N4O4S, MWT: 575.5066, Solubility: DMSO: ≥ 245 mg/mL, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ifosfamide, Alternative-names: , CAS# 3778-73-2, Formula: C7H15Cl2N2O2P, MWT: 261.086, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: DNA Alkylator/Crosslinker, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Cyclophosphamide, Alternative-names: , CAS# 50-18-0, Formula: C7H15Cl2N2O2P, MWT: 261.086, Solubility: DMSO: ≥ 38 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: DNA Alkylator/Crosslinker, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

4'-Demethylepipodophyllotoxin, Alternative-names: 4'-O-demethylepipodophyllotoxin;4'-DMEP, CAS# 6559-91-7, Formula: C21H20O8, MWT: 400.3787, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Clevidipine, Alternative-names: , CAS# 167221-71-8, Formula: C21H23Cl2NO6, MWT: 456.3164, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

GSK2606414, Alternative-names: , CAS# 1337531-36-8, Formula: C24H20F3N5O, MWT: 451.4437, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: PERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AGI-5198, Alternative-names: IDH-C35, CAS# 1355326-35-0, Formula: C27H31FN4O2, MWT: 462.5591, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Isocitrate Dehydrogenase (IDH), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Mefloquine (hydrochloride), Alternative-names: Mefloquin hydrochloride, CAS# 51773-92-3, Formula: C17H17ClF6N2O, MWT: 414.7730992, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Autophagy;Anti-infection, Target: Autophagy;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Nordihydroguaiaretic acid, Alternative-names: NDGA, CAS# 500-38-9, Formula: C18H22O4, MWT: 302.3649, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: Phase 2, Pathway: Autophagy;NF-κB, Target: Autophagy;Keap1-Nrf2, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

IPA-3, Alternative-names: , CAS# 42521-82-4, Formula: C20H14O2S2, MWT: 350.4539, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: PAK;PAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Bivalirudin (Trifluoroacetate), Alternative-names: Bivalirudin, CAS# 128270-60-0, Formula: C100H138DF3N24O35, MWT: 2295.314831378, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Leuprolide Acetate, Alternative-names: Leuprorelin acetate, CAS# 74381-53-6, Formula: C61H88N16O14, MWT: 1269.45022, Solubility: DMSO: ≥ 43.4 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Mifepristone, Alternative-names: RU486;RU 38486, CAS# 84371-65-3, Formula: C29H35NO2, MWT: 429.5937, Solubility: DMSO: ≥ 59 mg/mL, Clinical_Information: Launched, Pathway: Others;GPCR/G Protein;Autophagy, Target: Progesterone Receptor;Glucocorticoid Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

XMD17-109, Alternative-names: , CAS# 1435488-37-1, Formula: C36H46N8O3, MWT: 638.80224, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

A 83-01, Alternative-names: , CAS# 909910-43-6, Formula: C25H19N5S, MWT: 421.5168, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;TGF-beta/Smad, Target: ALK;TGF-β Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

LY2801653 (dihydrochloride), Alternative-names: Merestinib dihydrochloride, CAS# 1206801-37-7, Formula: C30H24Cl2F2N6O3, MWT: 625.4528, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Pyridostatin, Alternative-names: RR82, CAS# 1085412-37-8, Formula: C31H32N8O5, MWT: 596.6364, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: G-quadruplex, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

360A, Alternative-names: , CAS# 794458-56-3, Formula: C27H23N5O2+2, MWT: 449.5027, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: G-quadruplex, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Balaglitazone, Alternative-names: DRF 2593;NN 2344, CAS# 199113-98-9, Formula: C20H17N3O4S, MWT: 395.4317, Solubility: DMSO: ≥ 500 mg/mL, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Pitolisant (oxalate), Alternative-names: Tiprolisant oxalate, CAS# 362665-57-4, Formula: C19H28ClNO5, MWT: 385.8823, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AZD3514, Alternative-names: , CAS# 1240299-33-5, Formula: C25H32F3N7O2, MWT: 519.5625, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GZD824, Alternative-names: , CAS# 1257628-77-5, Formula: C29H27F3N6O, MWT: 532.5595, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Bcr-Abl, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

P005091, Alternative-names: P5091, CAS# 882257-11-6, Formula: C12H7Cl2NO3S2, MWT: 348.22488, Solubility: DMSO: 68 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Deubiquitinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Lck Inhibitor, Alternative-names: , CAS# 847950-09-8, Formula: C31H30N8O, MWT: 530.6229, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

MK-3207, Alternative-names: , CAS# 957118-49-9, Formula: C31H29F2N5O3, MWT: 557.5905, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein;Neuronal Signaling, Target: CGRP Receptor;CGRP Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Miriplatin (hydrate), Alternative-names: , CAS# 250159-48-9, Formula: C34H70N2O5Pt, MWT: 782.014, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: DNA Alkylator/Crosslinker, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

20-HETE, Alternative-names: 20-hydroxy Arachidonic Acid, CAS# 79551-86-3, Formula: C20H32O3, MWT: 320.4663, Solubility: DMSO: ≥ 3.2 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AEE788, Alternative-names: NVP-AEE 788, CAS# 497839-62-0, Formula: C27H32N6, MWT: 440.5832, Solubility: DMSO: 10 mM, Clinical_Information: Phase 2, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

BAM7, Alternative-names: , CAS# 331244-89-4, Formula: C21H19N5O2S, MWT: 405.4729, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Forskolin, Alternative-names: Coleonol;Colforsin, CAS# 66575-29-9, Formula: C22H34O7, MWT: 410.5012, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2g

Rufinamide, Alternative-names: CGP 33101;E 2080;RUF 331, CAS# 106308-44-5, Formula: C10H8F2N4O, MWT: 238.1935, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Gambogic Acid, Alternative-names: Beta-Guttiferrin, CAS# 2752-65-0, Formula: C38H44O8, MWT: 628.7512, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;Apoptosis, Target: Autophagy;Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Bavisant, Alternative-names: JNJ-31001074, CAS# 929622-08-2, Formula: C19H27N3O2, MWT: 329.4366, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Bavisant (dihydrochloride), Alternative-names: , CAS# 929622-09-3, Formula: C19H29Cl2N3O2, MWT: 402.3585, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Bavisant (dihydrochloride hydrate), Alternative-names: JNJ31001074AAC, CAS# 1103522-80-0, Formula: C19H31Cl2N3O3, MWT: 420.3737, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

PI4KIII beta inhibitor 3, Alternative-names: , CAS# 1245319-54-3, Formula: C22H22N8OS, MWT: 446.5281, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI4K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Lomustine, Alternative-names: , CAS# 13010-47-4, Formula: C9H16ClN3O2, MWT: 233.6952, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: DNA Alkylator/Crosslinker;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

PJ34 (hydrochloride), Alternative-names: , CAS# 344458-15-7, Formula: C17H18ClN3O2, MWT: 331.7967, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

PJ34, Alternative-names: , CAS# 344458-19-1, Formula: C17H17N3O2, MWT: 295.3358, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

BMS-833923, Alternative-names: XL-139, CAS# 1059734-66-5, Formula: C30H27N5O, MWT: 473.5683, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Stem Cell/Wnt, Target: Smo, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Vildagliptin, Alternative-names: LAF237;NVP-LAF 237, CAS# 274901-16-5, Formula: C17H25N3O2, MWT: 303.3993, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

UPF 1069, Alternative-names: , CAS# 1048371-03-4, Formula: C17H13NO3, MWT: 279.29, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Rocuronium (Bromide), Alternative-names: , CAS# 119302-91-9, Formula: C32H53BrN2O4, MWT: 609.6782, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AR-A014418, Alternative-names: AR 0133418;GSK 3β inhibitor;AR 014418, CAS# 487021-52-3, Formula: C12H12N4O4S, MWT: 308.3131, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;PI3K/Akt/mTOR, Target: GSK-3;GSK-3, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Pafuramidine, Alternative-names: DB289, CAS# 186953-56-0, Formula: C20H20N4O3, MWT: 364.3978, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Vortioxetine, Alternative-names: Lu AA 21004, CAS# 508233-74-7, Formula: C18H22N2S, MWT: 298.4457, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Vortioxetine (hydrobromide), Alternative-names: Lu AA21004 hydrobromide, CAS# 960203-27-4, Formula: C18H23BrN2S, MWT: 379.3576, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

RG7388, Alternative-names: Idasanutlin, CAS# 1229705-06-9, Formula: C31H29Cl2F2N3O4, MWT: 616.4824664, Solubility: DMSO: ≥ 45 mg/mL, Clinical_Information: Phase 3, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Azathramycin, Alternative-names: Azaerythromycin A;9-Deoxo-9a-aza-9a-homoerythromycin A;Desmethyl Azithromycin, CAS# 76801-85-9, Formula: C37H70N2O12, MWT: 734.9579, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection;Autophagy, Target: Bacterial;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

SDZ 220-581, Alternative-names: , CAS# 174575-17-8, Formula: C16H17ClNO5P, MWT: 369.736642, Solubility: DMSO: 8.57 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

SDZ 220-581 (Ammonium salt), Alternative-names: , CAS# 179411-94-0, Formula: C16H20ClN2O5P, MWT: 386.767162, Solubility: DMSO: < 3.9 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Phloretin, Alternative-names: NSC 407292;RJC 02792, CAS# 60-82-2, Formula: C15H14O5, MWT: 274.2686, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: SGLT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg

MK-6892, Alternative-names: , CAS# 917910-45-3, Formula: C19H22N4O5, MWT: 386.40178, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPR109A, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Clemizole, Alternative-names: , CAS# 442-52-4, Formula: C19H20ClN3, MWT: 325.8352, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Immunology/Inflammation;GPCR/G Protein;Anti-infection, Target: HCV Protease;Histamine Receptor;Histamine Receptor;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

AVL-292, Alternative-names: Spebrutinib;CC-292, CAS# 1202757-89-8, Formula: C22H22FN5O3, MWT: 423.4402, Solubility: DMSO: ≥ 45 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AZ20, Alternative-names: , CAS# 1233339-22-4, Formula: C21H24N4O3S, MWT: 412.5052, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;PI3K/Akt/mTOR, Target: ATM/ATR;ATM/ATR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Fosbretabulin (disodium), Alternative-names: CA 4DP;CA 4P;Combretastatin A4 disodium phosphate, CAS# 168555-66-6, Formula: C18H19Na2O8P, MWT: 440.292, Solubility: H<sub>2</sub>O: 4.4 mg/mL (Need ultrasonic and warming); DMSO: < 0.044 mg/mL, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Brassinolide, Alternative-names: Brassin lactone, CAS# 72962-43-7, Formula: C28H48O6, MWT: 480.6771, Solubility: DMSO: ≥ 5.2 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Costunolide, Alternative-names: (+)-Costunolide;Costunolid;Costus lactone;NSC 106404, CAS# 553-21-9, Formula: C15H20O2, MWT: 232.3181, Solubility: DMSO: ≥ 49 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

PRT062607 (Hydrochloride), Alternative-names: P505-15 Hydrochloride, CAS# 1370261-97-4, Formula: C19H24ClN9O, MWT: 429.9066, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Syk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Clemizole (hydrochloride), Alternative-names: , CAS# 1163-36-6, Formula: C19H21Cl2N3, MWT: 362.2961, Solubility: DMSO: ≥ 3.6 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Immunology/Inflammation;GPCR/G Protein;Anti-infection, Target: HCV Protease;Histamine Receptor;Histamine Receptor;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Curcumin, Alternative-names: Indian Saffron;Turmeric yellow;Natural Yellow 3;Diferuloylmethane, CAS# 458-37-7, Formula: C21H20O6, MWT: 368.3799, Solubility: DMSO: ≥ 185 mg/mL, Clinical_Information: Phase 4, Pathway: Autophagy;NF-κB, Target: Autophagy;Keap1-Nrf2, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Lck inhibitor 2, Alternative-names: , CAS# 944795-06-6, Formula: C18H17N5O2, MWT: 335.3599, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Omadacycline (mesylate), Alternative-names: PTK 0796 mesylate;Amadacycline mesylate, CAS# 1196800-40-4, Formula: C30H44N4O10S, MWT: 652.7562, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Salinomycin (sodium salt), Alternative-names: Salinomycin sodium;Sodium salinomycin, CAS# 55721-31-8, Formula: C42H69NaO11, MWT: 772.9804, Solubility: DMSO: ≥ 15 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AVL-292 (benzenesulfonate), Alternative-names: Spebrutinib besylate;CC-292 besylate, CAS# 1360053-81-1, Formula: C28H28FN5O6S, MWT: 581.6152, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

IDO5L, Alternative-names: , CAS# 914471-09-3, Formula: C9H7ClFN5O2, MWT: 271.6356, Solubility: DMSO: ≥ 52 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Indoleamine 2,3-Dioxygenase (IDO), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

INCB 024360, Alternative-names: Epacadostat, CAS# 1204669-58-8, Formula: C11H13BrFN7O4S, MWT: 438.2328, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: Indoleamine 2,3-Dioxygenase (IDO), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

6-Thioguanine, Alternative-names: 6-TG;2-Amino-6-mercaptopurine;2-Amino-6-purinethiol, CAS# 154-42-7, Formula: C5H5N5S, MWT: 167.1917, Solubility: DMSO: 10 mg/mL, Clinical_Information: Launched, Pathway: Autophagy;Epigenetics, Target: Autophagy;DNA Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Topotecan (Hydrochloride), Alternative-names: SK&F 104864-A;SKF 104864A;SKFS 104864A;NSC 609669;Nogitecan hydrochloride, CAS# 119413-54-6, Formula: C23H24ClN3O5, MWT: 457.9068, Solubility: DMSO: 15.3 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Topoisomerase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

6-Mercaptopurine, Alternative-names: Mercaptopurine;6-MP, CAS# 50-44-2, Formula: C5H4N4S, MWT: 152.1771, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Mitotane, Alternative-names: 2,4′-DDD;o,p'-DDD, CAS# 53-19-0, Formula: C14H10Cl4, MWT: 320.0412, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Pitolisant (hydrochloride), Alternative-names: Ciproxidine;BF 2649, CAS# 903576-44-3, Formula: C17H27Cl2NO, MWT: 332.3084, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

N3PT, Alternative-names: N3-pyridyl thiamine, CAS# 13860-66-7, Formula: C13H19Cl2N3OS, MWT: 336.2805, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Beclometasone dipropionate, Alternative-names: , CAS# 5534-09-8, Formula: C28H37ClO7, MWT: 521.04218, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Micafungin (sodium), Alternative-names: FK 463, CAS# 208538-73-2, Formula: C56H70N9NaO23S, MWT: 1292.256, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Dexamethasone, Alternative-names: MK 125;NSC 34521;Prednisolone F, CAS# 50-02-2, Formula: C22H29FO5, MWT: 392.4611, Solubility: DMSO: ≥ 56 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Autophagy, Target: Glucocorticoid Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

SMIP004, Alternative-names: , CAS# 143360-00-3, Formula: C13H19NO, MWT: 205.2961, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Tacrolimus, Alternative-names: Fujimycin;FR900506;FK506, CAS# 104987-11-3, Formula: C44H69NO12, MWT: 804.0182, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Launched, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

MK-0773, Alternative-names: PF-05314882, CAS# 606101-58-0, Formula: C27H34FN5O2, MWT: 479.5896, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Granisetron, Alternative-names: , CAS# 109889-09-0, Formula: C18H24N4O, MWT: 312.4094, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Granisetron (Hydrochloride), Alternative-names: BRL 43694A, CAS# 107007-99-8, Formula: C18H25ClN4O, MWT: 348.8703, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Necrostatin 2, Alternative-names: , CAS# 852391-19-6, Formula: C13H12ClN3O2, MWT: 277.7063, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Tenovin-1, Alternative-names: , CAS# 380315-80-0, Formula: C20H23N3O2S, MWT: 369.4805, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;Epigenetics;Cell Cycle/DNA Damage;Apoptosis, Target: Autophagy;Sirtuin;Sirtuin;MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PR-619, Alternative-names: 2,6-Diamino-3,5-dithiocyanopyridine, CAS# 2645-32-1, Formula: C7H5N5S2, MWT: 223.2781, Solubility: DMSO: ≥ 21 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Deubiquitinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PluriSln 1, Alternative-names: NSC 14613, CAS# 91396-88-2, Formula: C12H11N3O, MWT: 213.2352, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Stearoyl-CoA Desaturase (SCD), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

QNZ, Alternative-names: EVP4593, CAS# 545380-34-5, Formula: C22H20N4O, MWT: 356.4204, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ascomycin, Alternative-names: Immunomycin;FR-900520;FK520, CAS# 104987-12-4, Formula: C43H69NO12, MWT: 792.0074, Solubility: DMSO: ≥ 39 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Bilobalide, Alternative-names: (-)-Bilobalide, CAS# 33570-04-6, Formula: C15H18O8, MWT: 326.2986, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Capsaicin, Alternative-names: (E)-Capsaicin;8-Methyl-N-vanillyl-trans-6-nonenamide, CAS# 404-86-4, Formula: C18H27NO3, MWT: 305.4119, Solubility: DMSO: ≥ 44 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Autophagy, Target: TRP Channel;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

LY2795050, Alternative-names: , CAS# 1346133-08-1, Formula: C23H22ClN3O2, MWT: 407.8927, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AZD1080, Alternative-names: , CAS# 612487-72-6, Formula: C19H18N4O2, MWT: 334.37182, Solubility: DMSO: 21.35 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;PI3K/Akt/mTOR, Target: GSK-3;GSK-3, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Resminostat, Alternative-names: RAS2410;4SC-201;RAS 2410;RAS-2410, CAS# 864814-88-0, Formula: C16H19N3O4S, MWT: 349.4048, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Resminostat (hydrochloride), Alternative-names: RAS2410 hydrochloride;4SC-201 hydrochloride, CAS# 1187075-34-8, Formula: C16H20ClN3O4S, MWT: 385.8657, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: Phase 2, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Reversine, Alternative-names: , CAS# 656820-32-5, Formula: C21H27N7O, MWT: 393.4854, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Epigenetics, Target: Aurora Kinase;Aurora Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

TUG-770, Alternative-names: , CAS# 1402601-82-4, Formula: C19H14FNO2, MWT: 307.3183632, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPR40, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Genz-644282, Alternative-names: , CAS# 529488-28-6, Formula: C22H21N3O5, MWT: 407.4193, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

RG2833, Alternative-names: RGFP109, CAS# 1215493-56-3, Formula: C20H25N3O2, MWT: 339.4314, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Salmeterol (xinafoate), Alternative-names: GR 33343X xinafoate, CAS# 94749-08-3, Formula: C36H45NO7, MWT: 603.745, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

GANT 61, Alternative-names: NSC 136476, CAS# 500579-04-4, Formula: C27H35N5, MWT: 429.6003, Solubility: DMSO: 17.6 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Stem Cell/Wnt, Target: Autophagy;Gli, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CX-6258, Alternative-names: , CAS# 1202916-90-2, Formula: C26H24ClN3O3, MWT: 461.9401, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

CX-6258 (hydrochloride hydrate), Alternative-names: , CAS# 1353858-99-7, Formula: C26H27Cl2N3O4, MWT: 516.4163, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Istaroxime, Alternative-names: PST2744, CAS# 203737-93-3, Formula: C21H32N2O3, MWT: 360.4904, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: Na+/K+ ATPase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

NU 7026, Alternative-names: LY293646, CAS# 154447-35-5, Formula: C17H15NO3, MWT: 281.3059, Solubility: DMSO: 2.8 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;Cell Cycle/DNA Damage, Target: DNA-PK;DNA-PK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Geniposide, Alternative-names: , CAS# 24512-63-8, Formula: C17H24O10, MWT: 388.3665, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Amyloid-β, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Genistein, Alternative-names: NPI 031L, CAS# 446-72-0, Formula: C15H10O5, MWT: 270.2369, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 4, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK;Autophagy, Target: EGFR;EGFR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

XL388, Alternative-names: , CAS# 1251156-08-7, Formula: C23H22FN3O4S, MWT: 455.5019, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

H-1152, Alternative-names: , CAS# 451462-58-1, Formula: C16H21N3O2S, MWT: 319.4218, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

H-1152 (dihydrochloride), Alternative-names: , CAS# 871543-07-6, Formula: C16H23Cl2N3O2S, MWT: 392.3437, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

FH535, Alternative-names: , CAS# 108409-83-2, Formula: C13H10Cl2N2O4S, MWT: 361.2005, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Stem Cell/Wnt;Stem Cell/Wnt;NF-κB, Target: PPAR;β-catenin;Wnt;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Alvimopan (monohydrate), Alternative-names: , CAS# 1383577-62-5, Formula: C25H34N2O5, MWT: 442.5479, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Alvimopan (dihydrate), Alternative-names: LY 246736 dihydrate;ADL 8-2698 dihydrate, CAS# 170098-38-1, Formula: C25H36N2O6, MWT: 460.5631, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

INCB28060, Alternative-names: Capmatinib;INC-280, CAS# 1029712-80-8, Formula: C23H17FN6O, MWT: 412.4191, Solubility: DMSO: 12.66 mg/mL, Clinical_Information: Phase 4, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Dutasteride, Alternative-names: GG 745;GI 198745, CAS# 164656-23-9, Formula: C27H30F6N2O2, MWT: 528.5297, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: 5 alpha Reductase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

TCS 359, Alternative-names: , CAS# 301305-73-7, Formula: C18H20N2O4S, MWT: 360.4274, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: FLT3, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

CC-930, Alternative-names: Tanzisertib;CC930;CC 930, CAS# 899805-25-5, Formula: C21H23F3N6O2, MWT: 448.4415, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 2, Pathway: MAPK/ERK Pathway, Target: JNK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Gabapentin, Alternative-names: , CAS# 60142-96-3, Formula: C9H17NO2, MWT: 171.2368, Solubility: 10 mM in H<sub>2</sub>O, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

XL-147, Alternative-names: SAR245408;pilaralisib, CAS# 934526-89-3, Formula: C25H25ClN6O4S, MWT: 541.0218, Solubility: DMSO: 6 mg/mL, Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

PD 123319 (ditrifluoroacetate), Alternative-names: , CAS# 136676-91-0, Formula: C35H34F6N4O7, MWT: 736.6574792, Solubility: H<sub>2</sub>O: ≥ 36 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

PD 123319, Alternative-names: (S)-(+)-PD 123319, CAS# 130663-39-7, Formula: C31H32N4O3, MWT: 508.6108, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AH 6809, Alternative-names: , CAS# 33458-93-4, Formula: C17H14O5, MWT: 298.2901, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Tanaproget, Alternative-names: NSP-989, CAS# 304853-42-7, Formula: C16H15N3OS, MWT: 297.3748, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Progesterone Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Puromycin aminonucleoside, Alternative-names: 3'-Amino-3'-deoxy-N6,N6-dimethyladenosine, CAS# 58-60-6, Formula: C12H18N6O3, MWT: 294.3097, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

MB05032, Alternative-names: , CAS# 261365-11-1, Formula: C11H15N2O4PS, MWT: 302.2866, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Retinyl glucoside, Alternative-names: Retinyl β-D-glucoside, CAS# 136778-12-6, Formula: C26H40O6, MWT: 448.5922, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

JNK-IN-7, Alternative-names: JNK inhibitor, CAS# 1408064-71-0, Formula: C28H27N7O2, MWT: 493.5597, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: JNK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Lucidin, Alternative-names: NSC 30546, CAS# 478-08-0, Formula: C15H10O5, MWT: 270.2369, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AGI-6780, Alternative-names: , CAS# 1432660-47-3, Formula: C21H18F3N3O3S2, MWT: 481.5111, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Isocitrate Dehydrogenase (IDH), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

c-Met inhibitor 1, Alternative-names: , CAS# 1357072-61-7, Formula: C17H14N8S, MWT: 362.4117, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Sodium Channel inhibitor 1, Alternative-names: , CAS# 1198117-23-5, Formula: C24H19F4N3O3, MWT: 473.4196, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

NVP-BGJ398 (phosphate), Alternative-names: Infigratinib phosphate;BGJ-398 phosphate, CAS# 1310746-10-1, Formula: C26H34Cl2N7O7P, MWT: 658.4706, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

360A (iodide), Alternative-names: 360 A iodide, CAS# 737763-37-0, Formula: C27H23I2N5O2, MWT: 703.3127, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: G-quadruplex, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

KN-93 (hydrochloride), Alternative-names: KN 93 hydrochloride;KN93 hydrochloride, CAS# 1956426-56-4, Formula: C26H30Cl2N2O4S, MWT: 537.4984, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: CaMK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

DB07268, Alternative-names: , CAS# 929007-72-7, Formula: C17H15N5O2, MWT: 321.3333, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: JNK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Zileuton, Alternative-names: A 64077;Abbott 64077, CAS# 111406-87-2, Formula: C11H12N2O2S, MWT: 236.2902, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: 5-Lipoxygenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

A 77-01, Alternative-names: , CAS# 607737-87-1, Formula: C18H14N4, MWT: 286.3306, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad, Target: TGF-β Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Eltrombopag, Alternative-names: SB-497115;SB-497115-GR, CAS# 496775-61-2, Formula: C25H22N4O4, MWT: 442.4666, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: Thrombopoietin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Eltrombopag (Olamine), Alternative-names: Eltrombopag diethanolamine salt;SB-497115GR, CAS# 496775-62-3, Formula: C29H36N6O6, MWT: 564.6328, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: Thrombopoietin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Kinetin, Alternative-names: 6-Furfuryladenine;N6-Furfuryladenine, CAS# 525-79-1, Formula: C10H9N5O, MWT: 215.2114, Solubility: DMSO: 8.8 mg/mL (Need warming), Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Ansamitocin P-3, Alternative-names: Antibiotic C 15003P3;Maytansinol butyrate;C15003P3, CAS# 66584-72-3, Formula: C32H43ClN2O9, MWT: 635.1448, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Cariprazine, Alternative-names: RGH-188, CAS# 839712-12-8, Formula: C21H32Cl2N4O, MWT: 427.411, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Cariprazine (hydrochloride), Alternative-names: RGH188 hydrochloride, CAS# 1083076-69-0, Formula: C21H33Cl3N4O, MWT: 463.8719, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Letermovir, Alternative-names: AIC246, CAS# 917389-32-3, Formula: C29H28F4N4O4, MWT: 572.5507, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: CMV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Capsazepine, Alternative-names: , CAS# 138977-28-3, Formula: C19H21ClN2O2S, MWT: 376.9002, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Pramiracetam, Alternative-names: , CAS# 68497-62-1, Formula: C14H27N3O2, MWT: 269.3831, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Phenylpiracetam, Alternative-names: , CAS# 77472-70-9, Formula: C12H14N2O2, MWT: 218.2518, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Noopept, Alternative-names: GVS-111;SGS-111;Omberacetam, CAS# 157115-85-0, Formula: C17H22N2O4, MWT: 318.3676, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Sildenafil (citrate), Alternative-names: UK-92480 citrate, CAS# 171599-83-0, Formula: C28H38N6O11S, MWT: 666.6999, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Autophagy, Target: Phosphodiesterase (PDE);Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Sildenafil, Alternative-names: UK-92480, CAS# 139755-83-2, Formula: C22H30N6O4S, MWT: 474.5764, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Autophagy, Target: Phosphodiesterase (PDE);Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

IWP-2, Alternative-names: , CAS# 686770-61-6, Formula: C22H18N4O2S3, MWT: 466.5989, Solubility: DMSO: < 4.7 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

SN-38, Alternative-names: NK012, CAS# 86639-52-3, Formula: C22H20N2O5, MWT: 392.4046, Solubility: DMSO: ≥ 40 mg/mL, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Topoisomerase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Etimizol, Alternative-names: Ethymisole;Antiffine;Ethimizole;Ethylnorantifein;Ethylnorantifeine;Ethylnorantiffeine;Ethymisol;Ethymisole;Etimizole, CAS# 64-99-3, Formula: C9H14N4O2, MWT: 210.2331, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Vinorelbine (ditartrate), Alternative-names: KW-2307;Nor-5'-anhydrovinblastine ditartrate, CAS# 125317-39-7, Formula: C53H66N4O20, MWT: 1079.10594, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Autophagy, Target: Microtubule/Tubulin;Microtubule/Tubulin;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

SB-505124, Alternative-names: , CAS# 694433-59-5, Formula: C20H21N3O2, MWT: 335.3996, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad, Target: TGF-β Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

SB-505124 (hydrochloride), Alternative-names: , CAS# 356559-13-2, Formula: C20H22ClN3O2, MWT: 371.8606, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad, Target: TGF-β Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

PND-1186, Alternative-names: SR-2516;VS-4718, CAS# 1061353-68-1, Formula: C25H26F3N5O3, MWT: 501.5009, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK, Target: FAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Dasatinib (hydrochloride), Alternative-names: BMS 354825 hydrochloride, CAS# 854001-07-3, Formula: C22H27Cl2N7O2S, MWT: 524.4665, Solubility: DMSO: 15 mg/mL, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Autophagy, Target: Src;Bcr-Abl;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Erlotinib (mesylate), Alternative-names: CP-358774;OSI-774;NSC 718781;R 1415, CAS# 248594-19-6, Formula: C23H27N3O7S, MWT: 489.5414, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK;Autophagy, Target: EGFR;EGFR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Gefitinib (hydrochloride), Alternative-names: ZD-1839 hydrochloride, CAS# 184475-55-6, Formula: C22H25Cl2FN4O3, MWT: 483.3633, Solubility: DMSO: 0.227 mg/mL; H<sub>2</sub>O：< 4.8 mg/mL, Clinical_Information: Launched, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g

Lenalidomide (hydrochloride), Alternative-names: CC-5013 hydrochloride, CAS# 1243329-97-6, Formula: C13H14ClN3O3, MWT: 295.7216, Solubility: DMSO, Clinical_Information: Launched, Pathway: Apoptosis, Target: TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Sorafenib, Alternative-names: Bay 43-9006, CAS# 284461-73-0, Formula: C21H16ClF3N4O3, MWT: 464.825, Solubility: DMSO: ≥ 45 mg/mL, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;MAPK/ERK Pathway;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Autophagy;Protein Tyrosine Kinase/RTK, Target: VEGFR;Raf;FLT3;PDGFR;Autophagy;c-Kit, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2g

Vandetanib (trifluoroacetate), Alternative-names: ZD6474 trifluoroacetate, CAS# 338992-53-3, Formula: C24H25BrF4N4O4, MWT: 589.3773, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;Autophagy, Target: VEGFR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Vandetanib (hydrochloride), Alternative-names: ZD6474 hydrochloride, CAS# 524722-52-9, Formula: C22H25BrClFN4O2, MWT: 511.8149, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;Autophagy, Target: VEGFR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Masitinib (mesylate), Alternative-names: AB-1010 mesylate, CAS# 1048007-93-7, Formula: C29H34N6O4S2, MWT: 594.748, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: PDGFR;c-Kit, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Malotilate, Alternative-names: NKK 105, CAS# 59937-28-9, Formula: C12H16O4S2, MWT: 288.383, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: 5-Lipoxygenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Ivacaftor (benzenesulfonate), Alternative-names: VX-770 benzenesulfonate, CAS# 1134822-09-5, Formula: C30H34N2O6S, MWT: 550.6658, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: CFTR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ivacaftor (hydrate), Alternative-names: VX-770 hydrate, CAS# 1134822-07-3, Formula: C24H30N2O4, MWT: 410.506, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: CFTR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Docetaxel (Trihydrate), Alternative-names: , CAS# 148408-66-6, Formula: C43H59NO17, MWT: 861.92506, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

OTX-015, Alternative-names: MK-8628;Birabresib, CAS# 202590-98-5, Formula: C25H22ClN5O2S, MWT: 491.9925, Solubility: DMSO: ≥ 49 mg/mL, Clinical_Information: Phase 2, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Hydroxyfasudil, Alternative-names: HA-1100, CAS# 105628-72-6, Formula: C14H17N3O3S, MWT: 307.3681, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Launched, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Hydroxyfasudil (hydrochloride), Alternative-names: HA-1100 hydrochloride;HA 1100 hydrochloride;HA1100 hydrochloride, CAS# 155558-32-0, Formula: C14H18ClN3O3S, MWT: 343.829, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Matrine, Alternative-names: Sophocarpidine;Matridin-15-one;Vegard;α-Matrine, CAS# 519-02-8, Formula: C15H24N2O, MWT: 248.3639, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;Autophagy, Target: Opioid Receptor;Opioid Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Trifluorothymidine, Alternative-names: Trifluridine;FTD;5-Trifluorothymidine;NSC 529182;NSC 75520, CAS# 70-00-8, Formula: C10H11F3N2O5, MWT: 296.2, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Apoptosis;Cell Cycle/DNA Damage, Target: Thymidylate Synthase;Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

EBE-A22, Alternative-names: , CAS# 229476-53-3, Formula: C17H16BrN3O2, MWT: 374.2318, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

JANEX-1, Alternative-names: WHI-P131, CAS# 202475-60-3, Formula: C16H15N3O3, MWT: 297.3086, Solubility: DMSO：≥ 3 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

WHI-P154, Alternative-names: , CAS# 211555-04-3, Formula: C16H14BrN3O3, MWT: 376.2047, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AG-1478, Alternative-names: Tyrphostin AG-1478;NSC 693255, CAS# 153436-53-4, Formula: C16H14ClN3O2, MWT: 315.7543, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Nelarabine, Alternative-names: 506U78;GW 506U78;Nelzarabine, CAS# 121032-29-9, Formula: C11H15N5O5, MWT: 297.2673, Solubility: DMSO: 9.8 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Trabectedin, Alternative-names: Ecteinascidin 743;ET-743;Ecteinascidin, CAS# 114899-77-3, Formula: C39H43N3O11S, MWT: 761.8372, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Tenofovir, Alternative-names: GS 1278;PMPA;TDF, CAS# 147127-20-6, Formula: C9H14N5O4P, MWT: 287.2123, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CUDC-907, Alternative-names: , CAS# 1339928-25-4, Formula: C23H24N8O4S, MWT: 508.5529, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR;Epigenetics;Cell Cycle/DNA Damage, Target: PI3K;HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Deltarasin, Alternative-names: , CAS# 1440898-61-2, Formula: C40H37N5O, MWT: 603.7547, Solubility: DMSO: ≥ 42 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Azaphen (dihydrochloride monohydrate), Alternative-names: Azafen dihydrochloride monohydrate;Pipofezin dihydrochloride monohydrate;Pipofezine dihydrochloride monohydrate;Azaphenonxazine dihydrochloride monohydrate, CAS# 63302-99-8, Formula: C16H23Cl2N5O2, MWT: 388.2921, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

MMAD, Alternative-names: Demethyldolastatin 10;Monomethylauristatin D;Monomethyl Dolastatin 10, CAS# 203849-91-6, Formula: C41H66N6O6S, MWT: 771.0643, Solubility: DMSO: 24.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Vc-MMAD, Alternative-names: , CAS# 1401963-17-4, Formula: C70H104N12O14S, MWT: 1369.712, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Mc-MMAD, Alternative-names: , CAS# 1401963-15-2, Formula: C51H77N7O9S, MWT: 964.2635, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Alogliptin, Alternative-names: SYR-322, CAS# 850649-61-5, Formula: C18H21N5O2, MWT: 339.3916, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Dipeptidyl Peptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Clozapine (N-oxide), Alternative-names: , CAS# 34233-69-7, Formula: C18H19ClN4O, MWT: 342.8227, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Risperidone, Alternative-names: R 64 766, CAS# 106266-06-2, Formula: C23H27FN4O2, MWT: 410.4845, Solubility: DMSO: < 4.1 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

XL019, Alternative-names: , CAS# 945755-56-6, Formula: C25H28N6O2, MWT: 444.5288, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Tulathromycin A, Alternative-names: Tulathromycin;CP 472295, CAS# 217500-96-4, Formula: C41H79N3O12, MWT: 806.0789, Solubility: DMSO: ≥ 45 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Istaroxime (hydrochloride), Alternative-names: PST2744 (hydrochloride), CAS# 374559-48-5, Formula: C21H33ClN2O3, MWT: 396.9513, Solubility: DMSO: ≥ 45 mg/mL, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: Na+/K+ ATPase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Delanzomib, Alternative-names: CEP-18770, CAS# 847499-27-8, Formula: C21H28BN3O5, MWT: 413.27512, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Proteasome, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ONX-0914, Alternative-names: PR-957, CAS# 960374-59-8, Formula: C31H40N4O7, MWT: 580.6719, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Proteasome, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

GSK343, Alternative-names: , CAS# 1346704-33-3, Formula: C31H39N7O2, MWT: 541.6871, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Epigenetics;Autophagy, Target: Histone Methyltransferase;Epigenetic Reader Domain;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

R1530, Alternative-names: , CAS# 882531-87-5, Formula: C18H14ClFN4O, MWT: 356.7814, Solubility: DMSO: ≥ 53 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

RGFP966, Alternative-names: , CAS# 1357389-11-7, Formula: C21H19FN4O, MWT: 362.4001632, Solubility: DMSO: ≥ 360 mg/mL , Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

NVP-BSK805, Alternative-names: BSK 805;BSK-805;BSK805, CAS# 1092499-93-8, Formula: C27H28F2N6O, MWT: 490.5476, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

LCL161, Alternative-names: , CAS# 1005342-46-0, Formula: C26H33FN4O3S, MWT: 500.6286, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Apoptosis, Target: IAP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CO-1686, Alternative-names: Rociletinib;AVL-301;CNX-419, CAS# 1374640-70-6, Formula: C27H28F3N7O3, MWT: 555.5515, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: Phase 3, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

RKI-1447, Alternative-names: , CAS# 1342278-01-6, Formula: C16H14N4O2S, MWT: 326.373, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: ROCK;ROCK;ROCK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

LY2090314, Alternative-names: , CAS# 603288-22-8, Formula: C28H25FN6O3, MWT: 512.5349, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 2, Pathway: Stem Cell/Wnt;PI3K/Akt/mTOR, Target: GSK-3;GSK-3, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Troglitazone, Alternative-names: CS-045, CAS# 97322-87-7, Formula: C24H27NO5S, MWT: 441.5399, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy;NF-κB, Target: PPAR;Autophagy;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Nifuratel, Alternative-names: NF 113;SAP 113;Methylmercadone, CAS# 4936-47-4, Formula: C10H11N3O5S, MWT: 285.2764, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Bacterial;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Gabapentin (hydrochloride), Alternative-names: , CAS# 60142-95-2, Formula: C9H18ClNO2, MWT: 207.6977, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Tipiracil (hydrochloride), Alternative-names: , CAS# 183204-72-0, Formula: C9H12Cl2N4O2, MWT: 279.1232, Solubility: H<sub>2</sub>O: ≥ 66.66 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Talnetant, Alternative-names: SB 223412, CAS# 174636-32-9, Formula: C25H22N2O2, MWT: 382.4544, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Talnetant (hydrochloride), Alternative-names: SB 223412 hydrochloride;SB 223412-A, CAS# 204519-66-4, Formula: C25H23ClN2O2, MWT: 418.9153, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

CPPHA, Alternative-names: , CAS# 693288-97-0, Formula: C22H15ClN2O4, MWT: 406.8185, Solubility: DMSO: ≥ 58 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Dabrafenib (Mesylate), Alternative-names: GSK2118436 Mesylate;GSK 2118436B, CAS# 1195768-06-9, Formula: C24H24F3N5O5S3, MWT: 615.6681, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: Launched, Pathway: MAPK/ERK Pathway, Target: Raf, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Firategrast, Alternative-names: SB 683699, CAS# 402567-16-2, Formula: C27H27F2NO6, MWT: 499.5032, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: Phase 2, Pathway: Cytoskeleton, Target: Integrin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

StemRegenin 1, Alternative-names: SR1, CAS# 1227633-49-9, Formula: C24H23N5OS, MWT: 429.5373, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

SB-269970 (hydrochloride), Alternative-names: SB-269970A, CAS# 261901-57-9, Formula: C18H29ClN2O3S, MWT: 388.9525, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

SB-269970, Alternative-names: , CAS# 201038-74-6, Formula: C18H28N2O3S, MWT: 352.4915, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

UNC1215, Alternative-names: , CAS# 1415800-43-9, Formula: C32H43N5O2, MWT: 529.7161, Solubility: DMSO: ≥ 270 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SB-222200, Alternative-names: , CAS# 174635-69-9, Formula: C26H24N2O, MWT: 380.4816, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

XL228, Alternative-names: , CAS# 898280-07-4, Formula: C22H31N9O, MWT: 437.5412, Solubility: DMSO, Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Cell Cycle/DNA Damage;Epigenetics;Protein Tyrosine Kinase/RTK, Target: Src;Bcr-Abl;Aurora Kinase;Aurora Kinase;IGF-1R, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

SJB2-043, Alternative-names: , CAS# 63388-44-3, Formula: C17H9NO3, MWT: 275.2583, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Deubiquitinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Solasodine, Alternative-names: Purapuridine;Solancarpidine;Solasodin, CAS# 126-17-0, Formula: C27H43NO2, MWT: 413.6358, Solubility: DMSO: < 4.4 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

3,3'-Diindolylmethane, Alternative-names: DIM;Arundine;HB 236, CAS# 1968-05-4, Formula: C17H14N2, MWT: 246.3065, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ledipasvir, Alternative-names: GS-5885, CAS# 1256388-51-8, Formula: C49H54F2N8O6, MWT: 888.9999, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

EI1, Alternative-names: Ezh2 inhibitor, CAS# 1418308-27-6, Formula: C23H26N4O2, MWT: 390.4781, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Epigenetics, Target: Histone Methyltransferase;Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Batimastat, Alternative-names: BB94, CAS# 130370-60-4, Formula: C23H31N3O4S2, MWT: 477.64, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

Batimastat (sodium salt), Alternative-names: BB-94 sodium salt, CAS# 130464-84-5, Formula: C23H30N3NaO4S2, MWT: 499.6218, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

MLN2238, Alternative-names: Ixazomib, CAS# 1072833-77-2, Formula: C14H19BCl2N2O4, MWT: 361.02866, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Autophagy, Target: Proteasome;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

UNC1999, Alternative-names: , CAS# 1431612-23-5, Formula: C33H43N7O2, MWT: 569.7402, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Epigenetics;Autophagy, Target: Histone Methyltransferase;Epigenetic Reader Domain;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

BIX 02565, Alternative-names: , CAS# 1311367-27-7, Formula: C26H30N6O2, MWT: 458.5554, Solubility: DMSO: 20.75 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: Ribosomal S6 Kinase (RSK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Delavirdine, Alternative-names: U 90152;BHAP-U 90152, CAS# 136817-59-9, Formula: C22H28N6O3S, MWT: 456.5611, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Delavirdine (mesylate), Alternative-names: U 90152, CAS# 147221-93-0, Formula: C23H32N6O6S2, MWT: 552.6668, Solubility: DMSO: ≥ 40.3 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

PP1, Alternative-names: AGL 1872;EI 275, CAS# 172889-26-8, Formula: C16H19N5, MWT: 281.3556, Solubility: DMSO: ≥ 28 mg/mL (Need ultrasonic) , Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

PP2, Alternative-names: AGL 1879, CAS# 172889-27-9, Formula: C15H16ClN5, MWT: 301.774, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Necrostatin 2 (racemate), Alternative-names: Necrostatin-2 racemate, CAS# 852391-15-2, Formula: C13H12ClN3O2, MWT: 277.7063, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Necrostatin 2 (S enantiomer), Alternative-names: , CAS# 852391-20-9, Formula: C13H12ClN3O2, MWT: 277.7063, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Necrostatin-1, Alternative-names: , CAS# 4311-88-0, Formula: C13H13N3OS, MWT: 259.3268, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Apoptosis, Target: Autophagy;RIP kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

DHEA, Alternative-names: trans-Dehydroandrosterone;Prasterone;Dehydroisoandrosterone;Dehydroepiandrosterone, CAS# 53-43-0, Formula: C19H28O2, MWT: 288.42442, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AZD1208, Alternative-names: , CAS# 1204144-28-4, Formula: C21H21N3O2S, MWT: 379.4753, Solubility: DMSO: 28.5 mg/mL, Clinical_Information: Phase 1, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Cidofovir, Alternative-names: GS 0504;HPMPC;(S)-HPMPC, CAS# 113852-37-2, Formula: C8H14N3O6P, MWT: 279.187, Solubility: H<sub>2</sub>O: 6.4 mg/mL (Need warming), Clinical_Information: Launched, Pathway: Anti-infection, Target: CMV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Sunitinib, Alternative-names: SU 11248, CAS# 557795-19-4, Formula: C22H27FN4O2, MWT: 398.4738, Solubility: DMSO: 25 mg/mL, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Autophagy, Target: VEGFR;PDGFR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

TDZD-8, Alternative-names: GSK-3β Inhibitor I;NP 01139, CAS# 327036-89-5, Formula: C10H10N2O2S, MWT: 222.2636, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;PI3K/Akt/mTOR, Target: GSK-3;GSK-3, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AZD2858, Alternative-names: , CAS# 486424-20-8, Formula: C21H23N7O3S, MWT: 453.5174, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;PI3K/Akt/mTOR, Target: GSK-3;GSK-3, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Ro3280, Alternative-names: , CAS# 1062243-51-9, Formula: C27H35F2N7O3, MWT: 543.6087, Solubility: DMSO: 6.4 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Polo-like Kinase (PLK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Valdecoxib, Alternative-names: SC 65872, CAS# 181695-72-7, Formula: C16H14N2O3S, MWT: 314.3589, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Erastin, Alternative-names: , CAS# 571203-78-6, Formula: C30H31ClN4O4, MWT: 547.0446, Solubility: DMSO: 6.4 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Ferroptosis , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

CID 2011756, Alternative-names: , CAS# 638156-11-3, Formula: C22H21ClN2O3, MWT: 396.8667, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: PKD, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ro 31-8220 (mesylate), Alternative-names: Ro 31-8220 methanesulfonate;Bisindolylmaleimide IX mesylate, CAS# 138489-18-6, Formula: C26H27N5O5S2, MWT: 553.6531, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Ro 31-8220, Alternative-names: Bisindolylmaleimide IX, CAS# 125314-64-9, Formula: C25H23N5O2S, MWT: 457.5474, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Vilanterol (trifenatate), Alternative-names: GW642444M, CAS# 503070-58-4, Formula: C44H49Cl2NO7, MWT: 774.7684, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Vilanterol, Alternative-names: GW642444X;GW642444, CAS# 503068-34-6, Formula: C24H33Cl2NO5, MWT: 486.4285, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

SRPIN340, Alternative-names: SRPK inhibitor, CAS# 218156-96-8, Formula: C18H18F3N3O, MWT: 349.3502, Solubility: DMSO: ≥ 42 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: SRPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Levalbuterol (tartrate), Alternative-names: Levosalbutamol tartrate, CAS# 661464-94-4, Formula: C30H48N2O12, MWT: 628.70832, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

ETP-46464, Alternative-names: , CAS# 1345675-02-6, Formula: C30H22N4O2, MWT: 470.52128, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;Cell Cycle/DNA Damage;PI3K/Akt/mTOR, Target: mTOR;ATM/ATR;ATM/ATR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Alvelestat, Alternative-names: AZD9668, CAS# 848141-11-7, Formula: C25H22F3N5O4S, MWT: 545.5335, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Elastase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Verapamil (hydrochloride), Alternative-names: (±)-Verapamil hydrochlorid, CAS# 152-11-4, Formula: C27H39ClN2O4, MWT: 491.0626, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

WEHI-539 hydrochloride, Alternative-names: , CAS# 2070018-33-4, Formula: C31H30ClN5O3S2, MWT: 620.1846, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Refametinib (R enantiomer), Alternative-names: BAY 869766 R enantiomer;RDEA119 R enantiomer, CAS# 923032-38-6, Formula: C19H20F3IN2O5S, MWT: 572.3371796, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: MEK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

PF-3084014, Alternative-names: Nirogacestat;PF-03084014, CAS# 1290543-63-3, Formula: C27H41F2N5O, MWT: 489.6441, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Stem Cell/Wnt;Neuronal Signaling, Target: γ-secretase;γ-secretase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ICI 118,551 (hydrochloride), Alternative-names: ICI 118551 hydrochloride, CAS# 72795-01-8, Formula: C17H28ClNO2, MWT: 313.8627, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

A 839977, Alternative-names: , CAS# 870061-27-1, Formula: C19H14Cl2N6O, MWT: 413.2601, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: P2X Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Rosiglitazone (maleate), Alternative-names: BRL 49653C, CAS# 155141-29-0, Formula: C22H23N3O7S, MWT: 473.49892, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy;NF-κB, Target: PPAR;Autophagy;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

BAY 57-1293, Alternative-names: Pritelivir;AIC316, CAS# 348086-71-5, Formula: C18H18N4O3S2, MWT: 402.4905, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: HSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

GNE-617, Alternative-names: , CAS# 1362154-70-8, Formula: C21H15F2N3O3S, MWT: 427.4239, Solubility: DMSO: ≥ 42.85 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Nampt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Honokiol, Alternative-names: NSC 293100, CAS# 35354-74-6, Formula: C18H18O2, MWT: 266.3343, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway;PI3K/Akt/mTOR;Autophagy, Target: ERK;ERK;Akt;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

TAK-632, Alternative-names: , CAS# 1228591-30-7, Formula: C27H18F4N4O3S, MWT: 554.5154, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway;Cell Cycle/DNA Damage;Epigenetics, Target: Raf;Aurora Kinase;Aurora Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Gabapentin enacarbil, Alternative-names: XP-13512, CAS# 478296-72-9, Formula: C16H27NO6, MWT: 329.3887, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Telmisartan, Alternative-names: BIBR 277, CAS# 144701-48-4, Formula: C33H30N4O2, MWT: 514.6169, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Autophagy;GPCR/G Protein, Target: Autophagy;Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Pioglitazone, Alternative-names: U 72107, CAS# 111025-46-8, Formula: C19H20N2O3S, MWT: 356.4387, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

GM6001, Alternative-names: Galardin;Ilomastat, CAS# 142880-36-2, Formula: C20H28N4O4, MWT: 388.4607, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

WHI-P180, Alternative-names: Janex 3, CAS# 211555-08-7, Formula: C16H15N3O3, MWT: 297.3086, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: VEGFR;EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

WHI-P180 (hydrochloride), Alternative-names: Janex 3 hydrochloride;, CAS# 153437-55-9, Formula: C16H16ClN3O3, MWT: 333.7695, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: VEGFR;EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg

A 419259, Alternative-names: RK-20449, CAS# 364042-47-7, Formula: C29H34N6O, MWT: 482.6199, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

A 419259 (trihydrochloride), Alternative-names: RK 20449 trihydrochloride, CAS# 1435934-25-0, Formula: C29H37Cl3N6O, MWT: 592.0027, Solubility: H<sub>2</sub>O: ≥ 55 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Resiquimod, Alternative-names: R848;S28463, CAS# 144875-48-9, Formula: C17H22N4O2, MWT: 314.3822, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation, Target: Toll-like Receptor (TLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Trilostane, Alternative-names: Win 24540, CAS# 13647-35-3, Formula: C20H27NO3, MWT: 329.4333, Solubility: DMSO: ≥ 56 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Arctiin, Alternative-names: Arctii;NSC 315527;Arctigenin-4-glucoside, CAS# 20362-31-6, Formula: C27H34O11, MWT: 534.55226, Solubility: DMSO: ≥ 5.4 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Tandospirone, Alternative-names: SM-3997, CAS# 87760-53-0, Formula: C21H29N5O2, MWT: 383.4873, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Rigosertib, Alternative-names: ON-01910, CAS# 592542-59-1, Formula: C21H25NO8S, MWT: 451.4901, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage, Target: Polo-like Kinase (PLK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

PD 169316, Alternative-names: , CAS# 152121-53-4, Formula: C20H13FN4O2, MWT: 360.3412, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway;Autophagy, Target: p38 MAPK;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Ezatiostat (hydrochloride), Alternative-names: TER199;TLK199, CAS# 286942-97-0, Formula: C27H36ClN3O6S, MWT: 566.10924, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Gutathione S-transferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Ezatiostat, Alternative-names: TER199;TLK199, CAS# 168682-53-9, Formula: C27H35N3O6S, MWT: 529.6483, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Gutathione S-transferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Purvalanol B, Alternative-names: NG 95, CAS# 212844-54-7, Formula: C20H25ClN6O3, MWT: 432.9039, Solubility: DMSO: ≥ 40 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Ondansetron (Hydrochloride), Alternative-names: GR 38032;SN 307;NSC 665799, CAS# 99614-01-4, Formula: C18H20ClN3O, MWT: 329.8239, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Ondansetron (hydrochloride dihydrate), Alternative-names: GR 38032;SN 307;NSC 665799, CAS# 103639-04-9, Formula: C18H24ClN3O3, MWT: 365.8545, Solubility: H<sub>2</sub>O: 61.66 mg/mL (Need warming), Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Pyrimethamine, Alternative-names: Pirimecidan;Pirimetamin;RP 4753, CAS# 58-14-0, Formula: C12H13ClN4, MWT: 248.7114, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Anti-infection, Target: Antifolate;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

2-Deoxy-D-glucose, Alternative-names: 2-Deoxy-D-arabino-hexose;D-Arabino-2-deoxyhexose, CAS# 154-17-6, Formula: C6H12O5, MWT: 164.1565, Solubility: DMSO: ≥ 51 mg/mL; H<sub>2</sub>O: ≥ 24 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: Hexokinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Birinapant, Alternative-names: TL32711, CAS# 1260251-31-7, Formula: C42H56F2N8O6, MWT: 806.9409, Solubility: DMSO: ≥ 40 mg/mL, Clinical_Information: Phase 2, Pathway: Apoptosis, Target: IAP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

MLN9708, Alternative-names: Ixazomib citrate, CAS# 1239908-20-3, Formula: C20H23BCl2N2O9, MWT: 517.1216, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Autophagy, Target: Proteasome;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

LXR-623, Alternative-names: WAY 252623, CAS# 875787-07-8, Formula: C21H12ClF5N2, MWT: 422.778396, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: LXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Palosuran, Alternative-names: ACT-058362, CAS# 540769-28-6, Formula: C25H30N4O2, MWT: 418.5313, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Urotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

FAAH inhibitor 1, Alternative-names: , CAS# 326866-17-5, Formula: C24H23N3O3S3, MWT: 497.6527, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Metabolic Enzyme/Protease, Target: FAAH;FAAH, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

PYR-41, Alternative-names: , CAS# 418805-02-4, Formula: C17H13N3O7, MWT: 371.301, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: E1/E2/E3 Enzyme, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

PYZD-4409, Alternative-names: , CAS# 423148-78-1, Formula: C14H7ClFN3O5, MWT: 351.6739, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: E1/E2/E3 Enzyme, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SR-3677, Alternative-names: , CAS# 1072959-67-1, Formula: C22H24N4O4, MWT: 408.4503, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Stem Cell/Wnt;Cell Cycle/DNA Damage;Autophagy, Target: ROCK;ROCK;ROCK;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

VU0152100, Alternative-names: VU152100, CAS# 409351-28-6, Formula: C18H19N3O2S, MWT: 341.42736, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

GNF-5837, Alternative-names: , CAS# 1033769-28-6, Formula: C28H21F4N5O2, MWT: 535.4922, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Trk Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

MS436, Alternative-names: , CAS# 1395084-25-9, Formula: C18H17N5O3S, MWT: 383.4243, Solubility: DMSO: 25.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

GSK1324726A, Alternative-names: I-BET726, CAS# 1300031-52-0, Formula: C25H23ClN2O3, MWT: 434.9147, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ZCL278, Alternative-names: , CAS# 587841-73-4, Formula: C21H19BrClN5O4S2, MWT: 584.8937, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Ras, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Methotrexate, Alternative-names: Amethopterin;CL14377;WR19039, CAS# 59-05-2, Formula: C20H22N8O5, MWT: 454.4393, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Antibody-drug Conjugate/ADC Related, Target: Antifolate;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AWD 131-138, Alternative-names: Imepitoin, CAS# 188116-07-6, Formula: C13H14ClN3O2, MWT: 279.7222, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AZ505 (ditrifluoroacetate), Alternative-names: AZ 505 ditrifluoroacetate;AZ-505 ditrifluoroacetate, CAS# 1035227-44-1, Formula: C33H40Cl2F6N4O8, MWT: 805.5891, Solubility: DMSO: ≥ 42 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AZ505, Alternative-names: , CAS# 1035227-43-0, Formula: C29H38Cl2N4O4, MWT: 577.5424, Solubility: , Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg

Arginase inhibitor 1, Alternative-names: , CAS# 1345808-25-4, Formula: C13H27BN2O4, MWT: 286.1755, Solubility: DMSO: ≥ 48 mg/mL; H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

CBB1007, Alternative-names: , CAS# 1379573-92-8, Formula: C27H34N8O4, MWT: 534.61, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

TIC10 isomer, Alternative-names: ONC201 isomer, CAS# 41276-02-2, Formula: C24H26N4O, MWT: 386.4894, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

PF-4708671, Alternative-names: , CAS# 1255517-76-0, Formula: C19H21F3N6, MWT: 390.4055, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: Ribosomal S6 Kinase (RSK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AZD7545, Alternative-names: , CAS# 252017-04-2, Formula: C19H18ClF3N2O5S, MWT: 478.8698, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: PDHK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Pacritinib, Alternative-names: SB1518, CAS# 937272-79-2, Formula: C28H32N4O3, MWT: 472.5787, Solubility: DMSO: < 4.7 mg/mL, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK;Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: FLT3;JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Cortisone (acetate), Alternative-names: Cortisone 21-acetate, CAS# 50-04-4, Formula: C23H30O6, MWT: 402.4807, Solubility: DMSO: 6.8 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

SKLB610, Alternative-names: , CAS# 1125780-41-7, Formula: C21H16F3N3O3, MWT: 415.3652, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: VEGFR;PDGFR;FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

IOWH-032, Alternative-names: IOWH032, CAS# 1191252-49-9, Formula: C22H15Br2N3O4, MWT: 545.1802, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: CFTR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Isoliquiritigenin, Alternative-names: GU17;ISL;Isoliquiritigen, CAS# 961-29-5, Formula: C15H12O4, MWT: 256.2534, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease;Autophagy, Target: Aldose Reductase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Flupirtine, Alternative-names: D 9998, CAS# 56995-20-1, Formula: C15H17FN4O2, MWT: 304.3195, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling;Membrane Transporter/Ion Channel, Target: iGluR;iGluR;Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Napabucasin, Alternative-names: , CAS# 83280-65-3, Formula: C14H8O4, MWT: 240.2109, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Deltarasin (hydrochloride), Alternative-names: , CAS# 1440898-82-7, Formula: C40H38ClN5O, MWT: 640.2156, Solubility: DMSO: ≥ 52 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

HG-9-91-01, Alternative-names: SIK inhibitor 1, CAS# 1456858-58-4, Formula: C32H37N7O3, MWT: 567.6813, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Salt-inducible Kinase (SIK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

LEE011, Alternative-names: Ribociclib, CAS# 1211441-98-3, Formula: C23H30N8O, MWT: 434.5373, Solubility: DMSO: ≥ 4.3 mg/mL; DMSO: < 8.4 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Imeglimin, Alternative-names: EMD 387008, CAS# 775351-65-0, Formula: C6H13N5, MWT: 155.2009, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Epigenetics;PI3K/Akt/mTOR, Target: AMPK;AMPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

AVE 0991, Alternative-names: , CAS# 304462-19-9, Formula: C29H32N4O5S2, MWT: 580.7182, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

AVE 0991 (sodium salt), Alternative-names: , CAS# 306288-04-0, Formula: C29H31N4NaO5S2, MWT: 602.7, Solubility: DMSO: ≥ 55 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Rolipram, Alternative-names: (R,S)-Rolipram;SB 95952;ZK 62711, CAS# 61413-54-5, Formula: C16H21NO3, MWT: 275.3428, Solubility: DMSO: ≥ 41 mg/mL, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Valganciclovir (hydrochloride), Alternative-names: , CAS# 175865-59-5, Formula: C14H23ClN6O5, MWT: 390.8226, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: CMV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Adrenosterone, Alternative-names: (+)-Adrenosterone, CAS# 382-45-6, Formula: C19H24O3, MWT: 300.3921, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

JW 55, Alternative-names: , CAS# 664993-53-7, Formula: C25H26N2O5, MWT: 434.4843, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

EPZ-6438, Alternative-names: Tazemetostat;E-7438, CAS# 1403254-99-8, Formula: C34H44N4O4, MWT: 572.7375, Solubility: DMSO: 5.0 mg/mL (need ultrasonic), Clinical_Information: Phase 2, Pathway: Epigenetics;Epigenetics, Target: Histone Methyltransferase;Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Cilostazol, Alternative-names: OPC 13013;OPC 21, CAS# 73963-72-1, Formula: C20H27N5O2, MWT: 369.4607, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Autophagy, Target: Phosphodiesterase (PDE);Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Fosaprepitant, Alternative-names: L-758298, CAS# 172673-20-0, Formula: C23H22F7N4O6P, MWT: 614.4066, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Fosaprepitant (dimeglumine), Alternative-names: MK-0517, CAS# 265121-04-8, Formula: C37H56F7N6O16P, MWT: 1004.834, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: Neurokinin Receptor;Neurokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Cisapride, Alternative-names: R 51619;(±)-Cisaprid, CAS# 81098-60-4, Formula: C23H29ClFN3O4, MWT: 465.9454632, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Glycopyrrolate, Alternative-names: Glycopyrrolate bromide;Glycopyrronium bromide, CAS# 596-51-0, Formula: C19H28BrNO3, MWT: 398.3345, Solubility: H<sub>2</sub>O: ≥ 45 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Valproic acid (sodium salt), Alternative-names: Sodium Valproate, CAS# 1069-66-5, Formula: C8H15NaO2, MWT: 166.1933, Solubility: H<sub>2</sub>O: ≥ 48 mg/mL, Clinical_Information: Launched, Pathway: Autophagy;Epigenetics;Cell Cycle/DNA Damage, Target: Autophagy;HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Valproic acid, Alternative-names: VPA;2-Propylpentanoic Acid, CAS# 99-66-1, Formula: C8H16O2, MWT: 144.2114, Solubility: 10 mM in H<sub>2</sub>O, Clinical_Information: Launched, Pathway: Autophagy;Epigenetics;Cell Cycle/DNA Damage, Target: Autophagy;HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Exemestane, Alternative-names: FCE 24304;EXE, CAS# 107868-30-4, Formula: C20H24O2, MWT: 296.4034, Solubility: DMSO: ≥ 54 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Aromatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Finasteride, Alternative-names: MK-906, CAS# 98319-26-7, Formula: C23H36N2O2, MWT: 372.5441, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: 5 alpha Reductase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Finasteride (acetate), Alternative-names: MK-906 acetate, CAS# 222989-99-3, Formula: C25H40N2O4, MWT: 432.5961, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: 5 alpha Reductase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Melatonin, Alternative-names: N-Acetyl-5-methoxytryptamine, CAS# 73-31-4, Formula: C13H16N2O2, MWT: 232.2783, Solubility: DMSO: ≥ 68 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Autophagy, Target: Melatonin Receptor;Melatonin Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

(±)-Bisoprolol (hemifumarate), Alternative-names: Bisoprolol hemifumarate salt, CAS# 104344-23-2, Formula: C40H66N2O12, MWT: 766.9583, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Bendamustine (hydrochloride), Alternative-names: SDX-105;EP-3101 , CAS# 3543-75-7, Formula: C16H22Cl3N3O2, MWT: 394.7238, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: DNA Alkylator/Crosslinker, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Dacarbazine, Alternative-names: Imidazole Carboxamide, CAS# 4342-03-4, Formula: C6H10N6O, MWT: 182.1832, Solubility: DMSO: < 9.4 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Epirubicin (hydrochloride), Alternative-names: 4'-Epidoxorubicin hydrochloride, CAS# 56390-09-1, Formula: C27H30ClNO11, MWT: 579.9802, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Etoposide, Alternative-names: VP-16;VP-16-213, CAS# 33419-42-0, Formula: C29H32O13, MWT: 588.5566, Solubility: DMSO: ≥ 39 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Topoisomerase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Raloxifene (hydrochloride), Alternative-names: LY156758 hydrochloride, CAS# 82640-04-8, Formula: C28H28ClNO4S, MWT: 510.0442, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others;Autophagy, Target: Estrogen Receptor/ERR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Letrozole, Alternative-names: CGS 20267, CAS# 112809-51-5, Formula: C17H11N5, MWT: 285.30274, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Autophagy;Others, Target: Autophagy;Aromatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Folinic acid (calcium salt pentahydrate), Alternative-names: Leucovorin calcium salt pentahydrate, CAS# 6035-45-6, Formula: C20H33CaN7O12 2+, MWT: 603.59262284, Solubility: H<sub>2</sub>O: 18.04 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Antifolate, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Vincristine (sulfate), Alternative-names: Leurocristine sulfate;22-Oxovincaleukoblastine sulfate, CAS# 2068-78-2, Formula: C46H58N4O14S, MWT: 923.0361, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Agomelatine (hydrochloride), Alternative-names: S-20098 hydrochloride, CAS# 1176316-99-6, Formula: C15H18ClNO2, MWT: 279.7619, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Agomelatine (L(+)-Tartaric acid), Alternative-names: S-20098 L(+)-Tartaric acid, CAS# 824393-18-2, Formula: C19H23NO8, MWT: 393.3878, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Leflunomide, Alternative-names: HWA486;RS-34821;SU101, CAS# 75706-12-6, Formula: C12H9F3N2O2, MWT: 270.2073, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Dienogest, Alternative-names: STS 557, CAS# 65928-58-7, Formula: C20H25NO2, MWT: 311.418, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others;Autophagy, Target: Progesterone Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Entecavir (monohydrate), Alternative-names: SQ 34676;BMS-200475, CAS# 209216-23-9, Formula: C12H17N5O4, MWT: 295.2945, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: HBV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Posaconazole (hydrate), Alternative-names: SCH56592 hydrate, CAS# 1198769-38-8, Formula: C37H44F2N8O5, MWT: 718.7927, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Prasugrel (hydrochloride), Alternative-names: , CAS# 389574-19-0, Formula: C20H21ClFNO3S, MWT: 409.902, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: P2Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Prasugrel (Maleic acid), Alternative-names: , CAS# 389574-20-3, Formula: C24H24FNO7S, MWT: 489.5133, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: P2Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Acarbose, Alternative-names: BAY g 5421, CAS# 56180-94-0, Formula: C25H43NO18, MWT: 645.60482, Solubility: H<sub>2</sub>O: 325 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Acarbose (sulfate), Alternative-names: Bay-g 5421 sulfate, CAS# 1221158-13-9, Formula: C25H45NO22S, MWT: 743.6833, Solubility: 10 mM in H<sub>2</sub>O, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Adapalene, Alternative-names: CD271, CAS# 106685-40-9, Formula: C28H28O3, MWT: 412.5201, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Adapalene (sodium salt), Alternative-names: CD 271 sodium salt, CAS# 911110-93-5, Formula: C28H27NaO3, MWT: 434.502, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Amisulpride, Alternative-names: DAN 2163, CAS# 71675-85-9, Formula: C17H27N3O4S, MWT: 369.479, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Amisulpride (hydrochloride), Alternative-names: DAN 2163 hydrochloride, CAS# 81342-13-4, Formula: C17H28ClN3O4S, MWT: 405.9399, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Aniracetam, Alternative-names: Ro 13-5057, CAS# 72432-10-1, Formula: C12H13NO3, MWT: 219.2365, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel;Membrane Transporter/Ion Channel;Neuronal Signaling, Target: nAChR;nAChR;iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Artemisinin, Alternative-names: Qinghaosu;NSC 369397, CAS# 63968-64-9, Formula: C15H22O5, MWT: 282.3322, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: HCV;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Benazepril, Alternative-names: , CAS# 86541-75-5, Formula: C24H28N2O5, MWT: 424.4895, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Benazepril (hydrochloride), Alternative-names: CGS14824A, CAS# 86541-74-4, Formula: C24H29ClN2O5, MWT: 460.9505, Solubility: DMSO: ≥ 92 mg/mL; H<sub>2</sub>O: 15.33 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Biperiden, Alternative-names: KL 373, CAS# 514-65-8, Formula: C21H29NO, MWT: 311.4611, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Cetirizine (dihydrochloride), Alternative-names: P071, CAS# 83881-52-1, Formula: C21H27Cl3N2O3, MWT: 461.8097, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Tolterodine, Alternative-names: (R)-(+)-Tolterodine;(+)-Tolterodine;(R)-Tolterodine;PNU-200583, CAS# 124937-51-5, Formula: C22H31NO, MWT: 325.4876, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Btk inhibitor 1, Alternative-names: , CAS# 1412418-47-3, Formula: C22H22N6O, MWT: 386.4497, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

HPGDS inhibitor 1, Alternative-names: , CAS# 1033836-12-2, Formula: C19H19F4N3O, MWT: 381.3672728, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: PGE synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Deguelin, Alternative-names: (-)-Deguelin;(-)-cis-Deguelin, CAS# 522-17-8, Formula: C23H22O6, MWT: 394.4172, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

HG-10-102-01, Alternative-names: LRRK2 inhibitor 1, CAS# 1351758-81-0, Formula: C17H20ClN5O3, MWT: 377.8254, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: LRRK2, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

1-Naphthyl PP1, Alternative-names: 1-NA-PP 1, CAS# 221243-82-9, Formula: C19H19N5, MWT: 317.3877, Solubility: DMSO: 14.25 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

1-NM-PP1, Alternative-names: PP1 Analog II, CAS# 221244-14-0, Formula: C20H21N5, MWT: 331.4142, Solubility: DMSO: 27.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

CNX-774, Alternative-names: , CAS# 1202759-32-7, Formula: C26H22FN7O3, MWT: 499.4964, Solubility: DMSO: ≥ 45.2 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SKLB1002, Alternative-names: , CAS# 1225451-84-2, Formula: C13H12N4O2S2, MWT: 320.39, Solubility: DMSO: 5.625 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

NVP 231, Alternative-names: , CAS# 362003-83-6, Formula: C25H25N3O2S, MWT: 431.5499, Solubility: DMSO: ≥ 41 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

BML-277, Alternative-names: Chk2 Inhibitor II;C 3742, CAS# 516480-79-8, Formula: C20H14ClN3O2, MWT: 363.7971, Solubility: DMSO: ≥ 55 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Checkpoint Kinase (Chk), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

LH846, Alternative-names: , CAS# 639052-78-1, Formula: C16H13ClN2OS, MWT: 316.8052, Solubility: DMSO: ≥ 45 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: Casein Kinase;Casein Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

GNF-5, Alternative-names: , CAS# 778277-15-9, Formula: C20H17F3N4O3, MWT: 418.3692, Solubility: DMSO: ≥ 49 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Bcr-Abl, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

TR-14035, Alternative-names: , CAS# 232271-19-1, Formula: C24H21Cl2NO5, MWT: 474.33324, Solubility: DMSO：≥ 41 mg/mL, Clinical_Information: No Development Reported, Pathway: Cytoskeleton, Target: Integrin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Meptazinol (hydrochloride), Alternative-names: IL-22811 hydrochloride;WY-22811 hydrochloride, CAS# 59263-76-2, Formula: C15H24ClNO, MWT: 269.8102, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

RN486, Alternative-names: , CAS# 1242156-23-5, Formula: C35H35FN6O3, MWT: 606.6892, Solubility: DMSO: 24 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

LY2334737, Alternative-names: , CAS# 892128-60-8, Formula: C17H25F2N3O5, MWT: 389.3943, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Mc-Val-Cit-PABC-PNP, Alternative-names: Maleimidocaproyl-L-valine-L-citrulline-p-aminobenzyl alcohol p-nitrophenyl carbonate, CAS# 159857-81-5, Formula: C35H43N7O11, MWT: 737.75622, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: ADC Linker, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

GDC-0032, Alternative-names: Taselisib;RG-7604, CAS# 1282512-48-4, Formula: C24H28N8O2, MWT: 460.5315, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Refametinib, Alternative-names: BAY 869766;BAY 86-97661;RDEA119, CAS# 923032-37-5, Formula: C19H20F3IN2O5S, MWT: 572.3372, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 2, Pathway: MAPK/ERK Pathway, Target: MEK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

L-Thyroxine, Alternative-names: Levothyroxine;T4, CAS# 51-48-9, Formula: C15H11I4NO4, MWT: 776.87, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

L-Thyroxine (sodium salt pentahydrate), Alternative-names: Sodium levothyroxine pentahydrate, CAS# 6106-07-6, Formula: C15H20I4NNaO9, MWT: 888.9282, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Bumetanide, Alternative-names: Ro 10-6338;PF 1593, CAS# 28395-03-1, Formula: C17H20N2O5S, MWT: 364.4161, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: NKCC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Gimeracil, Alternative-names: Gimestat, CAS# 103766-25-2, Formula: C5H4ClNO2, MWT: 145.5438, Solubility: DMSO: 29 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Mizoribine, Alternative-names: NSC 289637;HE 69, CAS# 50924-49-7, Formula: C9H13N3O6, MWT: 259.216, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Anidulafungin, Alternative-names: LY303366, CAS# 166663-25-8, Formula: C58H73N7O17, MWT: 1140.23692, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Dolastatin 10, Alternative-names: DLS 10;NSC 376128, CAS# 110417-88-4, Formula: C42H68N6O6S, MWT: 785.0909, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Flumatinib (mesylate), Alternative-names: , CAS# 895519-91-2, Formula: C30H33F3N8O4S, MWT: 658.6945, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: Bcr-Abl;PDGFR;c-Kit, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Floxuridine, Alternative-names: 5-Fluorouracil 2'-deoxyriboside, CAS# 50-91-9, Formula: C9H11FN2O5, MWT: 246.1924, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Streptozocin, Alternative-names: Streptozotocin;U 9889, CAS# 18883-66-4, Formula: C8H15N3O7, MWT: 265.2206, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Cell Cycle/DNA Damage, Target: DNA Alkylator/Crosslinker;DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Zoledronic Acid, Alternative-names: Zoledronate;CGP 42446;CGP42446A;ZOL 446, CAS# 118072-93-8, Formula: C5H10N2O7P2, MWT: 272.0896, Solubility: DMSO: < 1 mg/mL, Clinical_Information: Launched, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Doxazosin (mesylate), Alternative-names: UK 33274 mesylate, CAS# 77883-43-3, Formula: C24H29N5O8S, MWT: 547.5807, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Autophagy, Target: Adrenergic Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Doxazosin, Alternative-names: UK 33274, CAS# 74191-85-8, Formula: C23H25N5O5, MWT: 451.4751, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Edaravone, Alternative-names: MCI-186, CAS# 89-25-8, Formula: C10H10N2O, MWT: 174.1992, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Etomidate, Alternative-names: R 16659, CAS# 33125-97-2, Formula: C14H16N2O2, MWT: 244.289, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Etomidate (hydrochloride), Alternative-names: R16659 hydrochloride, CAS# 53188-20-8, Formula: C14H17ClN2O2, MWT: 280.75, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Fluconazole, Alternative-names: UK-49858, CAS# 86386-73-4, Formula: C13H12F2N6O, MWT: 306.2708, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Fluconazole (hydrate), Alternative-names: UK 49858 hydrate, CAS# 155347-36-7, Formula: C13H14F2N6O2, MWT: 324.2861, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Fluconazole (mesylate), Alternative-names: UK 49858 mesylate, CAS# 159532-41-9, Formula: C14H16F2N6O4S, MWT: 402.3764, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Fluoxetine (hydrochloride), Alternative-names: LY-110140, CAS# 56296-78-7, Formula: C17H19ClF3NO, MWT: 345.7871, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;Autophagy, Target: Serotonin Transporter;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Fluvoxamine (maleate), Alternative-names: , CAS# 61718-82-9, Formula: C19H25F3N2O6, MWT: 434.4068, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Fluvoxamine, Alternative-names: , CAS# 54739-18-3, Formula: C15H21F3N2O2, MWT: 318.3347, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Gatifloxacin, Alternative-names: BMS 206584-01;PD 135432;AM-1155, CAS# 112811-59-3, Formula: C19H22FN3O4, MWT: 375.3941, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Gatifloxacin (hydrochloride), Alternative-names: AM 1155 hydrochloride;BMS 206584-01 hydrochloride;PD 135432 hydrochloride, CAS# 121577-32-0, Formula: C19H23ClFN3O4, MWT: 411.855, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Gatifloxacin (mesylate), Alternative-names: AM 1155 mesylate;BMS 206584-01 mesylate;PD 135432 mesylate, CAS# 316819-28-0, Formula: C20H26FN3O7S, MWT: 471.4998, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Glimepiride, Alternative-names: Glimperide, CAS# 93479-97-1, Formula: C24H34N4O5S, MWT: 490.6156, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Ketoconazole, Alternative-names: (¡À)-Ketoconazol, CAS# 65277-42-1, Formula: C26H28Cl2N4O4, MWT: 531.43092, Solubility: DMSO: ≥ 5.3 mg/mL; DMSO: 53 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Anti-infection;Metabolic Enzyme/Protease, Target: Fungal;Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

(+)-Ketoconazole, Alternative-names: , CAS# 142128-59-4, Formula: C26H28Cl2N4O4, MWT: 531.4309, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Metabolic Enzyme/Protease, Target: Fungal;Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Lansoprazole, Alternative-names: AG-1749, CAS# 103577-45-3, Formula: C16H14F3N3O2S, MWT: 369.3615, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Lansoprazole (sodium), Alternative-names: AG-1749 sodium, CAS# 226904-00-3, Formula: C16H13F3N3NaO2S, MWT: 391.3433, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

MK-8033 (hydrochloride), Alternative-names: , CAS# 1283000-43-0, Formula: C25H22ClN5O3S, MWT: 507.9919, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Phenformin (hydrochloride), Alternative-names: Phenethylbiguanide hydrochloride, CAS# 834-28-6, Formula: C10H16ClN5, MWT: 241.7205, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Epigenetics;PI3K/Akt/mTOR, Target: AMPK;AMPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g

Metformin (hydrochloride), Alternative-names: 1,1-Dimethylbiguanide hydrochloride, CAS# 1115-70-4, Formula: C4H12ClN5, MWT: 165.6246, Solubility: H<sub>2</sub>O: ≥ 32 mg/mL; DMSO: ≥ 1.7 mg/mL, Clinical_Information: Launched, Pathway: Autophagy;Epigenetics;PI3K/Akt/mTOR, Target: Autophagy;AMPK;AMPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50g

Tamoxifen (Citrate), Alternative-names: ICI 46474, CAS# 54965-24-1, Formula: C32H37NO8, MWT: 563.6381, Solubility: DMSO: ≥ 570 mg/mL, Clinical_Information: Launched, Pathway: Others;Autophagy, Target: Estrogen Receptor/ERR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

GSK 650394, Alternative-names: , CAS# 890842-28-1, Formula: C25H22N2O2, MWT: 382.4544, Solubility: DMSO: ≥ 40.7 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: SGK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Levetiracetam, Alternative-names: UCB L059, CAS# 102767-28-2, Formula: C8H14N2O2, MWT: 170.209, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Acitretin, Alternative-names: Ro 10-1670, CAS# 55079-83-9, Formula: C21H26O3, MWT: 326.4294, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Acitretin (sodium), Alternative-names: Ro 10-1670 sodium, CAS# 925701-88-8, Formula: C21H25NaO3, MWT: 348.4112, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Daptomycin, Alternative-names: LY146032, CAS# 103060-53-3, Formula: C72H101N17O26, MWT: 1620.671, Solubility: H<sub>2</sub>O: ≥ 66.66 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Dorzolamide (hydrochloride), Alternative-names: L671152 hydrochloride;MK507 hydrochloride, CAS# 130693-82-2, Formula: C10H17ClN2O4S3, MWT: 360.901, Solubility: H<sub>2</sub>O: 14 mg/mL; DMSO: < 1 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Carbonic Anhydrase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Dorzolamide, Alternative-names: L671152;MK507, CAS# 120279-96-1, Formula: C10H16N2O4S3, MWT: 324.44, Solubility: H<sub>2</sub>O: 14 mg/mL; DMSO: < 1 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Carbonic Anhydrase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

P 22077, Alternative-names: , CAS# 1247819-59-5, Formula: C12H7F2NO3S2, MWT: 315.3156864, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Deubiquitinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

VE-822, Alternative-names: VX-970;Berzosertib, CAS# 1232416-25-9, Formula: C24H25N5O3S, MWT: 463.552, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;PI3K/Akt/mTOR, Target: ATM/ATR;ATM/ATR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Gestodene, Alternative-names: SHB 331;WL 70, CAS# 60282-87-3, Formula: C21H26O2, MWT: 310.4299, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Progesterone Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Drospirenone, Alternative-names: Dihydrospirorenone, CAS# 67392-87-4, Formula: C24H30O3, MWT: 366.4932, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Progesterone Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Isotretinoin, Alternative-names: 13-cis-Retinoic acid, CAS# 4759-48-2, Formula: C20H28O2, MWT: 300.43512, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Meropenem, Alternative-names: , CAS# 96036-03-2, Formula: C17H25N3O5S, MWT: 383.4625, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Meropenem (trihydrate), Alternative-names: , CAS# 119478-56-7, Formula: C17H31N3O8S, MWT: 437.5083, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Minoxidil, Alternative-names: U10858, CAS# 38304-91-5, Formula: C9H15N5O, MWT: 209.2483, Solubility: DMSO: 7 mg/mL (Need warming), Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Omeprazole, Alternative-names: , CAS# 73590-58-6, Formula: C17H19N3O3S, MWT: 345.416, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Autophagy, Target: Proton Pump;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Oxcarbazepine, Alternative-names: , CAS# 28721-07-5, Formula: C15H12N2O2, MWT: 252.268, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Pizotifen, Alternative-names: Pizotyline, CAS# 15574-96-6, Formula: C19H21NS, MWT: 295.4417, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Pizotifen (malate), Alternative-names: Pizotyline malate, CAS# 5189-11-7, Formula: C23H27NO5S, MWT: 429.5292, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Stavudine, Alternative-names: d4T, CAS# 3056-17-5, Formula: C10H12N2O4, MWT: 224.2133, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection;Autophagy;Anti-infection, Target: Reverse Transcriptase;Autophagy;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Stavudine (sodium), Alternative-names: d4T sodium, CAS# 134624-73-0, Formula: C10H11N2NaO4, MWT: 246.1951, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Tenofovir (hydrate), Alternative-names: GS 1278 hydrate;PMPA hydrate;TDF hydrate, CAS# 206184-49-8, Formula: C9H16N5O5P, MWT: 305.2276, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Tenofovir (maleate), Alternative-names: GS 1278 maleate;PMPA maleate;TDF maleate, CAS# 1236287-04-9, Formula: C13H18N5O8P, MWT: 403.2845, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Tigecycline, Alternative-names: GAR-936, CAS# 220620-09-7, Formula: C29H39N5O8, MWT: 585.6487, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Autophagy, Target: Bacterial;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Tigecycline (hydrochloride), Alternative-names: GAR-936 hydrochloride, CAS# 197654-04-9, Formula: C29H40ClN5O8, MWT: 622.1096, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Tigecycline (mesylate), Alternative-names: GAR-936 mesylate, CAS# 1135871-27-0, Formula: C30H43N5O11S, MWT: 681.7543, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Embelin, Alternative-names: Embelic acid;Emberine;NSC 91874, CAS# 550-24-3, Formula: C17H26O4, MWT: 294.3859, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Apoptosis, Target: IAP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

SB 203580 (hydrochloride), Alternative-names: RWJ 64809 hydrochloride, CAS# 869185-85-3, Formula: C21H17ClFN3OS, MWT: 413.8956, Solubility: H<sub>2</sub>O: 8.43 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway;PI3K/Akt/mTOR;Autophagy, Target: p38 MAPK;Akt;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Vecuronium (bromide), Alternative-names: , CAS# 50700-72-6, Formula: C34H57BrN2O4, MWT: 637.7314, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Clopidogrel (hydrogen sulfate), Alternative-names: (S)-(+)-Clopidogrel bisulfate;(S)-(+)-Clopidogrel hydrogen sulfate, CAS# 120202-66-6, Formula: C16H18ClNO6S2, MWT: 419.9002, Solubility: DMSO: ≥ 46.7 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: P2Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Risedronate (sodium), Alternative-names: Risedronic Acid Sodium, CAS# 115436-72-1, Formula: C7H11NNaO7P2+, MWT: 306.1014847, Solubility: H<sub>2</sub>O: ≥ 3.2 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Sumatriptan (succinate), Alternative-names: GR 43175, CAS# 103628-48-4, Formula: C18H27N3O6S, MWT: 413.4885, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Topiramate, Alternative-names: McN 4853;RWJ 17021, CAS# 97240-79-4, Formula: C12H21NO8S, MWT: 339.362, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Zileuton (sodium), Alternative-names: , CAS# 118569-21-4, Formula: C11H11N2NaO2S, MWT: 258.272, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: 5-Lipoxygenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Ziprasidone (hydrochloride), Alternative-names: CP-88059 hydrochloride, CAS# 122883-93-6, Formula: C21H22Cl2N4OS, MWT: 449.3966, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Zonisamide, Alternative-names: AD 810;CI 912, CAS# 68291-97-4, Formula: C8H8N2O3S, MWT: 212.2257, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Membrane Transporter/Ion Channel, Target: Calcium Channel;Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Zonisamide (sodium), Alternative-names: AD 810 sodium;CI 912 sodium, CAS# 68291-98-5, Formula: C8H7N2NaO3S, MWT: 234.2076, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Membrane Transporter/Ion Channel, Target: Calcium Channel;Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Atazanavir (sulfate), Alternative-names: BMS-232632 sulfate, CAS# 229975-97-7, Formula: C38H54N6O11S, MWT: 802.934, Solubility: DMSO; H<sub>2</sub>O: < 0.1 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HIV Protease;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ofloxacin, Alternative-names: , CAS# 82419-36-1, Formula: C18H20FN3O4, MWT: 361.3675, Solubility: DMSO: ≥ 4 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Marbofloxacin, Alternative-names: , CAS# 115550-35-1, Formula: C17H19FN4O4, MWT: 362.3556, Solubility: DMSO: ≥ 3.8 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Nocodazole, Alternative-names: Oncodazole;R17934, CAS# 31430-18-9, Formula: C14H11N3O3S, MWT: 301.3204, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Protein Tyrosine Kinase/RTK;Autophagy;Cell Cycle/DNA Damage, Target: Microtubule/Tubulin;Microtubule/Tubulin;Bcr-Abl;Autophagy;CRISPR/Cas9, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Marbofloxacin (hydrochloride), Alternative-names: , CAS# 115551-26-3, Formula: C17H20ClFN4O4, MWT: 398.8165, Solubility: DMSO: 2 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Moxifloxacin, Alternative-names: , CAS# 151096-09-2, Formula: C21H24FN3O4, MWT: 401.4314, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Iloperidone (hydrochloride), Alternative-names: HP 873 hydrochloride, CAS# 1299470-39-5, Formula: C24H28ClFN2O4, MWT: 462.9415, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Betamethasone, Alternative-names: , CAS# 378-44-9, Formula: C22H29FO5, MWT: 392.4611, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Betamethasone (hydrochloride), Alternative-names: , CAS# 956901-32-9, Formula: C22H30ClFO5, MWT: 428.922, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

NBI-98782, Alternative-names: (+)-DTBZ;(+)-α-Dihydrotetrabenazine; (+)-α-DHTBZ, CAS# 85081-18-1, Formula: C19H29NO3, MWT: 319.4384, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: Monoamine Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

NBI-98854, Alternative-names: (2R,3R,11bR)-rel-Dihydrotetrabenazine;(2R,3R,11bR)-rel-DHTBZ, CAS# 171598-74-6, Formula: C19H29NO3, MWT: 319.4384, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: Monoamine Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Diphylline, Alternative-names: Diprophylline, CAS# 479-18-5, Formula: C10H14N4O4, MWT: 254.2426, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;GPCR/G Protein, Target: Phosphodiesterase (PDE);Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Aztreonam, Alternative-names: , CAS# 78110-38-0, Formula: C13H17N5O8S2, MWT: 435.4328, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Perindopril, Alternative-names: S-9490, CAS# 82834-16-0, Formula: C19H32N2O5, MWT: 368.4678, Solubility: DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Perindopril (erbumine), Alternative-names: Perindopril tert-butylamine salt, CAS# 107133-36-8, Formula: C23H43N3O5, MWT: 441.6046, Solubility: DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Prostaglandin E1, Alternative-names: PGE1, CAS# 745-65-3, Formula: C20H34O5, MWT: 354.481, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Norfloxacin, Alternative-names: , CAS# 70458-96-7, Formula: C16H18FN3O3, MWT: 319.3308, Solubility: DMSO: < 1 mg/mL, Clinical_Information: Phase 4, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Norfloxacin (hydrochloride), Alternative-names: , CAS# 68077-27-0, Formula: C16H19ClFN3O3, MWT: 355.7917, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g

Cidofovir (dihydrate), Alternative-names: HPMPC dihydrate;(S)-HPMPC dihydrate, CAS# 149394-66-1, Formula: C8H18N3O8P, MWT: 315.2176, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: CMV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Natamycin, Alternative-names: Pimaricin, CAS# 7681-93-8, Formula: C33H47NO13, MWT: 665.7252, Solubility: DMSO: 10.75 mg/mL (Need warming), Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Bestatin, Alternative-names: Ubenimex, CAS# 58970-76-6, Formula: C16H24N2O4, MWT: 308.3728, Solubility: DMSO: 6 mg/mL (Need warming), Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Aminopeptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Bestatin (hydrochloride), Alternative-names: Ubenimex hydrochloride, CAS# 65391-42-6, Formula: C16H25ClN2O4, MWT: 344.8337, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Aminopeptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Bestatin (trifluoroacetate), Alternative-names: Ubenimex trifluoroacetate, CAS# 223763-80-2, Formula: C18H25F3N2O6, MWT: 422.3961096, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Aminopeptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Reserpine, Alternative-names: , CAS# 50-55-5, Formula: C33H40N2O9, MWT: 608.6787, Solubility: DMSO: 7 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Autophagy, Target: Monoamine Transporter;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Reserpine (hydrochloride), Alternative-names: , CAS# 16994-56-2, Formula: C33H41ClN2O9, MWT: 645.1396, Solubility: DMSO: ≥ 12.66 mg/mL; H<sub>2</sub>O: < 0.1 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Monoamine Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Furosemide, Alternative-names: , CAS# 54-31-9, Formula: C12H11ClN2O5S, MWT: 330.7441, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: NKCC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Furosemide (sodium), Alternative-names: , CAS# 41733-55-5, Formula: C12H10ClN2NaO5S, MWT: 352.726, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: NKCC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

K145, Alternative-names: SphK2 inhibitor, CAS# 1309444-75-4, Formula: C18H24N2O3S, MWT: 348.4597, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: SPHK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

K145 (hydrochloride), Alternative-names: SphK2 inhibitor, CAS# 1449240-68-9, Formula: C18H25ClN2O3S, MWT: 384.9207, Solubility: 10 mM in DMSO; H<sub>2</sub>O: 126.7 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: SPHK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Parthenolide, Alternative-names: (-)-Parthenolide, CAS# 20554-84-1, Formula: C15H20O3, MWT: 248.3175, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Autophagy;Epigenetics;Cell Cycle/DNA Damage;Epigenetics;NF-κB, Target: Autophagy;HDAC;HDAC;DNA Methyltransferase;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Siramesine, Alternative-names: Lu 28-179, CAS# 147817-50-3, Formula: C30H31FN2O, MWT: 454.5783, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Sigma Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

TRAM-34, Alternative-names: , CAS# 289905-88-0, Formula: C22H17ClN2, MWT: 344.8368, Solubility: DMSO: ≥ 3.4 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Icilin, Alternative-names: AG-3-5, CAS# 36945-98-9, Formula: C16H13N3O4, MWT: 311.2921, Solubility: DMSO: ≥ 54 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

TCS 1102, Alternative-names: , CAS# 916141-36-1, Formula: C27H26N4O2S, MWT: 470.5859, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Orexin Receptor (OX Receptor), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

SB-334867, Alternative-names: SB 334867A, CAS# 249889-64-3, Formula: C17H14ClN5O2, MWT: 355.7784, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Orexin Receptor (OX Receptor), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Cefdinir, Alternative-names: , CAS# 91832-40-5, Formula: C14H13N5O5S2, MWT: 395.4135, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Clotrimazole, Alternative-names: , CAS# 23593-75-1, Formula: C22H17ClN2, MWT: 344.8368, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Autophagy, Target: Fungal;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Risperidone (hydrochloride), Alternative-names: R 64 766 hydrochloride, CAS# 666179-74-4, Formula: C23H28ClFN4O2, MWT: 446.9454, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Risperidone (mesylate), Alternative-names: R 64 766 mesylate, CAS# 666179-96-0, Formula: C24H31FN4O5S, MWT: 506.5901, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Prilocaine, Alternative-names: , CAS# 721-50-6, Formula: C13H20N2O, MWT: 220.3107, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Na+/K+ ATPase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Prilocaine (hydrochloride), Alternative-names: , CAS# 1786-81-8, Formula: C13H21ClN2O, MWT: 256.7716, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Na+/K+ ATPase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ibuprofen, Alternative-names: (¡À)-Ibuprofe, CAS# 15687-27-1, Formula: C13H18O2, MWT: 206.2808, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Ursodiol, Alternative-names: Ursodeoxycholic acid;UDCS, CAS# 128-13-2, Formula: C24H40O4, MWT: 392.572, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Ketorolac (tromethamine salt), Alternative-names: Ketorolac tris salt;Ketorolac Tromethamine, CAS# 74103-07-4, Formula: C19H24N2O6, MWT: 376.4037, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Telbivudine, Alternative-names: Epavudine;L-Thymidine;NV 02B, CAS# 3424-98-4, Formula: C10H14N2O5, MWT: 242.2286, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: HBV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Flucytosine, Alternative-names: 5-Fluorocytosine;NSC 103805;Ro 2-9915, CAS# 2022-85-7, Formula: C4H4FN3O, MWT: 129.0925, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Aminophylline, Alternative-names: , CAS# 317-34-0, Formula: C16H24N10O4, MWT: 420.4264, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Progesterone, Alternative-names: Pregn-4-ene-3,20-dione, CAS# 57-83-0, Formula: C21H30O2, MWT: 314.4617, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Progesterone Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Estradiol, Alternative-names: β-Estradiol;E2;17β-Estradiol;17β-Oestradiol, CAS# 50-28-2, Formula: C18H24O2, MWT: 272.382, Solubility: DMSO: ≥150 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Dexamethasone (acetate), Alternative-names: Dexamethasone 21-acetate, CAS# 1177-87-3, Formula: C24H31FO6, MWT: 434.4977, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Autophagy, Target: Glucocorticoid Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Amsacrine, Alternative-names: AMSA;m-AMSA;CI-880;SN-11841;acridinyl anisidide, CAS# 51264-14-3, Formula: C21H19N3O3S, MWT: 393.4589, Solubility: DMSO: 9.3 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Topoisomerase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Amsacrine (hydrochloride), Alternative-names: AMSA hydrochloride;m-AMSA hydrochloride;CI-880 hydrochloride;SN-11841 hydrochloride;acridinyl anisidide hydrochloride, CAS# 54301-15-4, Formula: C21H20ClN3O3S, MWT: 429.9198, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Autophagy, Target: Topoisomerase;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Terbinafine, Alternative-names: , CAS# 91161-71-6, Formula: C21H25N, MWT: 291.4299, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

L-DOPA, Alternative-names: Levodopa;3,4-Dihydroxyphenylalanine, CAS# 59-92-7, Formula: C9H11NO4, MWT: 197.1879, Solubility: H<sub>2</sub>O: 2 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Niacin, Alternative-names: Nicotinic acid;Vitamin B3, CAS# 59-67-6, Formula: C6H5NO2, MWT: 123.1094, Solubility: H<sub>2</sub>O: 15 mg/mL, Clinical_Information: Launched, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

L-Glutamine, Alternative-names: L-Glutamic acid 5-amide, CAS# 56-85-9, Formula: C5H10N2O3, MWT: 146.1445, Solubility: H<sub>2</sub>O: ≥ 40 mg/mL, Clinical_Information: Phase 4, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Pitavastatin (Calcium), Alternative-names: Pitavastatin hemicalcium;NK-104, CAS# 147526-32-7, Formula: C25H23FNO4 . 1/2 Ca, MWT: 440.49, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Autophagy;Metabolic Enzyme/Protease, Target: Autophagy;HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Cefditoren (Pivoxil), Alternative-names: Cefditoren pivoxyl;Cefditoren pivaloyloxymethyl ester;ME 1207, CAS# 117467-28-4, Formula: C25H28N6O7S3, MWT: 620.7208, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Verteporfin, Alternative-names: CL 318952, CAS# 129497-78-5, Formula: C41H42N4O8, MWT: 718.79, Solubility: DMSO: 5.6 mg/mL, Clinical_Information: Launched, Pathway: Stem Cell/Wnt;Autophagy, Target: YAP;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

AICAR, Alternative-names: Acadesine;AICA Riboside, CAS# 2627-69-2, Formula: C9H14N4O5, MWT: 258.2313, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 3, Pathway: Autophagy;Epigenetics;PI3K/Akt/mTOR, Target: Autophagy;AMPK;AMPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

AICAR (phosphate), Alternative-names: Acadesine phosphate;AICA Riboside phosphate, CAS# 681006-28-0, Formula: C9H17N4O9P, MWT: 356.2264, Solubility: DMSO: ≥ 75 mg/mL, Clinical_Information: Phase 3, Pathway: Autophagy;Epigenetics;PI3K/Akt/mTOR, Target: Autophagy;AMPK;AMPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

AP20187, Alternative-names: , CAS# 195514-80-8, Formula: C82H107N5O20, MWT: 1482.74848, Solubility: DMSO: ≥ 57 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

CC-401, Alternative-names: , CAS# 395104-30-0, Formula: C22H24N6O, MWT: 388.4655, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: MAPK/ERK Pathway, Target: JNK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

XL413, Alternative-names: , CAS# 1169558-38-6, Formula: C14H12ClN3O2, MWT: 289.717, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

XL413 (hydrochloride), Alternative-names: , CAS# 1169562-71-3, Formula: C14H13Cl2N3O2, MWT: 326.1779, Solubility: DMSO: 3.4 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

MDL-29951, Alternative-names: , CAS# 130798-51-5, Formula: C12H9Cl2NO4, MWT: 302.1102, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Parecoxib, Alternative-names: SC 69124, CAS# 198470-84-7, Formula: C19H18N2O4S, MWT: 370.4222, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Parecoxib (Sodium), Alternative-names: SC 69124A, CAS# 198470-85-8, Formula: C19H17N2NaO4S, MWT: 392.4041, Solubility: DMSO：≥ 32 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Pefloxacin, Alternative-names: Pefloxacinium, CAS# 70458-92-3, Formula: C17H20FN3O3, MWT: 333.3574, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Pefloxacin (mesylate), Alternative-names: Pefloxacinium mesylate, CAS# 70458-95-6, Formula: C18H24FN3O6S, MWT: 429.4631, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Pefloxacin (mesylate dihydrate), Alternative-names: Pefloxacinium mesylate dihydrate, CAS# 149676-40-4, Formula: C18H28FN3O8S, MWT: 465.4936, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Risedronic acid, Alternative-names: Risedronate, CAS# 105462-24-6, Formula: C7H11NO7P2, MWT: 283.1123, Solubility: DMSO: < 1 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Tranexamic acid, Alternative-names: , CAS# 1197-18-8, Formula: C8H15NO2, MWT: 157.2102, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Valacyclovir (hydrochloride), Alternative-names: Valaciclovir hydrochloride, CAS# 124832-27-5, Formula: C13H21ClN6O4, MWT: 360.7966, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: HSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Valsartan, Alternative-names: CGP 48933, CAS# 137862-53-4, Formula: C24H29N5O3, MWT: 435.5188, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Nicotinamide, Alternative-names: Niacinamide;Nicotinic acid amide;Vitamin B3, CAS# 98-92-0, Formula: C6H6N2O, MWT: 122.1246, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Fluvastatin (sodium), Alternative-names: , CAS# 93957-55-2, Formula: C24H26FNNaO4+, MWT: 434.46, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Autophagy;Metabolic Enzyme/Protease, Target: Autophagy;HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Pregnenolone, Alternative-names: Arthenolone;3β-Hydroxy-5-pregnen-20-one, CAS# 145-13-1, Formula: C21H32O2, MWT: 316.4776, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Autophagy;GPCR/G Protein, Target: Autophagy;Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Haloperidol, Alternative-names: , CAS# 52-86-8, Formula: C21H23ClFNO2, MWT: 375.8642, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Haloperidol (hydrochloride), Alternative-names: , CAS# 1511-16-6, Formula: C21H24Cl2FNO2, MWT: 412.3252, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Marinopyrrole A, Alternative-names: Maritoclax;(±)-Marinopyrrole , CAS# 1227962-62-0, Formula: C22H12Cl4N2O4, MWT: 510.1537, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Dacinostat, Alternative-names: NVP-LAQ824;LAQ824, CAS# 404951-53-7, Formula: C22H25N3O3, MWT: 379.4522, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Epigenetics;Cell Cycle/DNA Damage, Target: Autophagy;HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

KY02111, Alternative-names: , CAS# 1118807-13-8, Formula: C18H17ClN2O3S, MWT: 376.8572, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Tenovin-6, Alternative-names: , CAS# 1011557-82-6, Formula: C25H34N4O2S, MWT: 454.6281, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Epigenetics;Cell Cycle/DNA Damage;Apoptosis;Epigenetics;Cell Cycle/DNA Damage, Target: Autophagy;Sirtuin;Sirtuin;MDM-2/p53;HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

FRAX597, Alternative-names: , CAS# 1286739-19-2, Formula: C29H28ClN7OS, MWT: 558.0969, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: PAK;PAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

SCH 546738, Alternative-names: , CAS# 906805-42-3, Formula: C23H31Cl2N7O, MWT: 492.4445, Solubility: DMSO: 4.5 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Ledipasvir (acetone), Alternative-names: GS-5885 acetone, CAS# 1441674-54-9, Formula: C52H60F2N8O7, MWT: 947.079, Solubility: DMSO: ≥ 39 mg/mL, Clinical_Information: Phase 4, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ledipasvir (D-tartrate), Alternative-names: GS-5885 D-tartrate, CAS# 1502654-87-6, Formula: C53H60F2N8O12, MWT: 1039.087, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Methoxsalen, Alternative-names: 8-Methoxypsoralen;Xanthotoxin;8-MOP, CAS# 298-81-7, Formula: C12H8O4, MWT: 216.1895, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Adenine, Alternative-names: 6-Aminopurine;Vitamin B4, CAS# 73-24-5, Formula: C5H5N5, MWT: 135.1267, Solubility: DMSO: <1 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Ticlopidine (hydrochloride), Alternative-names: , CAS# 53885-35-1, Formula: C14H15Cl2NS, MWT: 300.2466, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Fluticasone (propionate), Alternative-names: , CAS# 80474-14-2, Formula: C25H31F3O5S, MWT: 500.5709, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Ketotifen (fumarate), Alternative-names: HC 20511 fumarate, CAS# 34580-14-8, Formula: C23H23NO5S, MWT: 425.4974, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Cytidine, Alternative-names: Cytosine β-D-riboside;Cytosine-1-β-D-ribofuranoside, CAS# 65-46-3, Formula: C9H13N3O5, MWT: 243.2166, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage, Target: Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Lovastatin, Alternative-names: Mevinolin, CAS# 75330-75-5, Formula: C24H36O5, MWT: 404.5396, Solubility: DMSO: ≥ 215 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Balofloxacin, Alternative-names: , CAS# 127294-70-6, Formula: C20H24FN3O4, MWT: 389.4207, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Lafutidine, Alternative-names: FRG-8813, CAS# 118288-08-7, Formula: C22H29N3O4S, MWT: 431.5484, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Duloxetine (hydrochloride), Alternative-names: (S)-Duloxetine hydrochloride;LY-248686 hydrochloride, CAS# 136434-34-9, Formula: C18H20ClNOS, MWT: 333.8755, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Ivabradine (hydrochloride), Alternative-names: , CAS# 148849-67-6, Formula: C27H37ClN2O5, MWT: 505.0461, Solubility: DMSO: ≥ 51 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Detomidine, Alternative-names: , CAS# 76631-46-4, Formula: C12H14N2, MWT: 186.253, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Detomidine (hydrochloride), Alternative-names: , CAS# 90038-01-0, Formula: C12H15ClN2, MWT: 222.7139, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

Mizolastine, Alternative-names: , CAS# 108612-45-9, Formula: C24H25FN6O, MWT: 432.4933, Solubility: DMSO: < 1 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Mizolastine (dihydrochloride), Alternative-names: , CAS# 1056596-82-7, Formula: C24H27Cl2FN6O, MWT: 505.4152, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

Arbidol (hydrochloride), Alternative-names: Umifenovir hydrochloride, CAS# 131707-23-8, Formula: C22H26BrClN2O3S, MWT: 513.8754, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Anti-infection, Target: Influenza Virus, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Scopolamine (hydrobromide), Alternative-names: (-)-Scopolamine hydrobromide;Hyoscine hydrobromide;Scopine hydrobromide, CAS# 114-49-8, Formula: C17H22BrNO4, MWT: 384.2649, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein;Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg

Aspirin, Alternative-names: ASA;Acetylsalicylic Acid, CAS# 50-78-2, Formula: C9H8O4, MWT: 180.1574, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Immunology/Inflammation;Autophagy, Target: COX;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Pravastatin, Alternative-names: , CAS# 81093-37-0, Formula: C23H36O7, MWT: 424.5277, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Pravastatin (sodium), Alternative-names: , CAS# 81131-70-6, Formula: C23H35NaO7, MWT: 446.5096, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Daunorubicin, Alternative-names: RP13057;Daunomycin;Rubidomycin, CAS# 20830-81-3, Formula: C27H29NO10, MWT: 527.5198, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;Antibody-drug Conjugate/ADC Related;Autophagy, Target: Topoisomerase;ADC Cytotoxin;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

(R)-Baclofen (hydrochloride), Alternative-names: STX 209 hydrochloride, CAS# 63701-55-3, Formula: C10H13Cl2NO2, MWT: 250.1217, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

L-Ascorbic acid, Alternative-names: L-Ascorbate;Vitamin C, CAS# 50-81-7, Formula: C6H8O6, MWT: 176.1241, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g

Salicylic acid, Alternative-names: 2-Hydroxybenzoic acid, CAS# 69-72-7, Formula: C7H6O3, MWT: 138.1207, Solubility: DMSO: ≥ 700 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;Autophagy, Target: COX;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g

Sodium Salicylate, Alternative-names: Salicylic acid sodium salt;2-Hydroxybenzoic acid sodium salt, CAS# 54-21-7, Formula: C7H5NaO3, MWT: 160.1026, Solubility: H<sub>2</sub>O: ≥ 200 mg/mL, Clinical_Information: Launched, Pathway: Autophagy;NF-κB, Target: Autophagy;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50g

Milnacipran, Alternative-names: , CAS# 92623-85-3, Formula: C15H22N2O, MWT: 246.348, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Milnacipran (hydrochloride), Alternative-names: , CAS# 101152-94-7, Formula: C15H23ClN2O, MWT: 282.8089, Solubility: DMSO: ≥ 48 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

Ro 25-6981, Alternative-names: , CAS# 169274-78-6, Formula: C22H29NO2, MWT: 339.4712, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Ro 25-6981 (Maleate), Alternative-names: , CAS# 1312991-76-6, Formula: C26H33NO6, MWT: 455.5433, Solubility: DMSO: ≥ 61 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Phlorizin, Alternative-names: Floridzin;NSC 2833, CAS# 60-81-1, Formula: C21H24O10, MWT: 436.4093, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: SGLT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g

Ganciclovir, Alternative-names: BW 759;2'-Nor-2'-deoxyguanosine, CAS# 82410-32-0, Formula: C9H13N5O4, MWT: 255.2306, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: HSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Conivaptan (hydrochloride), Alternative-names: YM 087, CAS# 168626-94-6, Formula: C32H27ClN4O2, MWT: 535.0354, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Vasopressin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Ro 28-1675, Alternative-names: , CAS# 300353-13-3, Formula: C18H22N2O3S2, MWT: 378.5089, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Glucokinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Icotinib, Alternative-names: BPI-2009, CAS# 610798-31-7, Formula: C22H21N3O4, MWT: 391.4198, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

AZD-9291, Alternative-names: Osimertinib;Mereletinib, CAS# 1421373-65-0, Formula: C28H33N7O2, MWT: 499.6073, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg

AZD-9291 (mesylate), Alternative-names: Osimertinib mesylate;Mereletinib mesylate, CAS# 1421373-66-1, Formula: C29H37N7O5S, MWT: 595.713, Solubility: DMSO, Clinical_Information: Launched, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g

Nemorubicin, Alternative-names: Methoxymorpholinyldoxorubicin;PNU 152243;PNU-152243A, CAS# 108852-90-0, Formula: C32H37NO13, MWT: 643.6351, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

PI3Kγ inhibitor 1, Alternative-names: , CAS# 1172118-03-4, Formula: C32H26N8O2S, MWT: 586.6663, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Entacapone (sodium salt), Alternative-names: , CAS# 1047659-02-8, Formula: C14H14N3NaO5, MWT: 327.2678, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;Metabolic Enzyme/Protease, Target: COMT;COMT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg

Abacavir (sulfate), Alternative-names: Abacavir Hemisulfate;ABC sulfate, CAS# 188062-50-2, Formula: C28H38N12O6S, MWT: 670.74312, Solubility: 10 mM in H<sub>2</sub>O, Clinical_Information: Launched, Pathway: Anti-infection, Target: Reverse Transcriptase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

CAY10650, Alternative-names: , CAS# 1233706-88-1, Formula: C28H25NO6, MWT: 471.5012, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg

BRL 54443, Alternative-names: , CAS# 57477-39-1, Formula: C14H18N2O, MWT: 230.3055, Solubility: DMSO: ≥ 51 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

TAK-779, Alternative-names: Takeda 779, CAS# 229005-80-5, Formula: C33H39ClN2O2, MWT: 531.1279, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein;Anti-infection, Target: CCR;CCR;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Mps1-IN-2, Alternative-names: , CAS# 1228817-38-6, Formula: C26H36N6O3, MWT: 480.6024, Solubility: DMSO: 14.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Mps1;Mps1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

ABT-333, Alternative-names: Dasabuvir, CAS# 1132935-63-7, Formula: C26H27N3O5S, MWT: 493.5747, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg

TGR5 Receptor Agonist, Alternative-names: , CAS# 1197300-24-5, Formula: C18H14Cl2N2O2, MWT: 361.222, Solubility: DMSO: ≥ 48 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPCR19, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Palovarotene, Alternative-names: R 667;Ro 3300074, CAS# 410528-02-8, Formula: C27H30N2O2, MWT: 414.5393, Solubility: DMSO: 19.5 mg/mL, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Lasmiditan, Alternative-names: COL-144;LY573144, CAS# 439239-90-4, Formula: C19H18F3N3O2, MWT: 377.3603, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

Topiroxostat, Alternative-names: FYX-051, CAS# 577778-58-6, Formula: C13H8N6, MWT: 248.2428, Solubility: DMSO: 23.5 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Xanthine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg

N6022, Alternative-names: , CAS# 1208315-24-5, Formula: C24H22N4O3, MWT: 414.4565, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: GSNOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg

EOS Med Chem, Medchem is Big

執大象，天下往，往而無害，安平泰

網址: www.eosmedchem.com 

2018. 4.18 Janpan CPHI, Attend

2018. 5.15 Israel Biomed, Attend

2018. 6. 20 China CPHI, W4E82

2018. 8. 28 Korea CPHI, Attend

2018. 10. 9 Spain World CPHI, Attend

郵箱: info@eosmedchem.com ; eosmedchem@gmail.com 

辦公室: 0086-531-69905422-806(直通)

攜帶番號 & WhatsApp & Wechat: +8618653174435

住所: Diaozhen Chemical Industrial Park, Jinan City, China