| Yohimbine (Hydrochloride), Alternative-names: , CAS# 65-19-0, Formula: C21H27ClN2O3, MWT: 390.9037, Solubility: DMSO: ≥ 10 mM; DMSO: < 12.4 mg/mL, Clinical_Information: Phase 4, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Rhein, Alternative-names: Rheic Acid;Rhubarb yellow;Monorhein, CAS# 478-43-3, Formula: C15H8O6, MWT: 284.2204, Solubility: DMSO: 12.17 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| Deferiprone, Alternative-names: , CAS# 30652-11-0, Formula: C7H9NO2, MWT: 139.1519, Solubility: DMSO: ≥ 1.5 mg/mL; H<sub>2</sub>O: < 6 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| PRE-084 (hydrochloride), Alternative-names: , CAS# 75136-54-8, Formula: C19H28ClNO3, MWT: 353.8835, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Sigma Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| TP-10, Alternative-names: , CAS# 898563-00-3, Formula: C26H19F3N4O, MWT: 460.4505, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TGR-1202, Alternative-names: RP5264, CAS# 1532533-67-7, Formula: C31H24F3N5O3, MWT: 571.5492, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TGR-1202 (hydrochloride), Alternative-names: RP5264 hydrochloride, CAS# 1532533-78-0, Formula: C31H25ClF3N5O3, MWT: 608.0101, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Mavoglurant, Alternative-names: AFQ056, CAS# 543906-09-8, Formula: C19H23NO3, MWT: 313.3908, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Rocaglamide, Alternative-names: Rocaglamide A;Roc-A, CAS# 84573-16-0, Formula: C29H31NO7, MWT: 505.5589, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CO-1686 (hydrobromide), Alternative-names: Rociletinib hydrobromide;AVL-301 hydrobromide;CNX-419 hydrobromide, CAS# 1446700-26-0, Formula: C27H29BrF3N7O3, MWT: 636.4634, Solubility: DMSO: ≥ 59 mg/mL, Clinical_Information: Phase 3, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vatalanib (free base), Alternative-names: PTK787 free base;PTK/ZK free base;CGP-79787 free base;ZK-222584 free base, CAS# 212141-54-3, Formula: C20H15ClN4, MWT: 346.8129, Solubility: DMSO: 125 mg/mL , Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vps34-IN-1, Alternative-names: , CAS# 1383716-33-3, Formula: C21H24ClN7O, MWT: 425.9146, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LMK-235, Alternative-names: , CAS# 1418033-25-6, Formula: C15H22N2O4, MWT: 294.3462, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 1-Methyl-7-nitroisatoic anhydride, Alternative-names: , CAS# 73043-80-8, Formula: C9H6N2O5, MWT: 222.15434, Solubility: DMSO: ≥ 21 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GSK4112, Alternative-names: SR6452, CAS# 1216744-19-2, Formula: C18H21ClN2O4S, MWT: 396.8883, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Ro 5126766, Alternative-names: CH5126766, CAS# 946128-88-7, Formula: C21H18FN5O5S, MWT: 471.4615, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: MAPK/ERK Pathway;MAPK/ERK Pathway, Target: Raf;MEK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Haloperidol (D4'), Alternative-names: , CAS# 136765-35-0, Formula: C21H19D4ClFNO2, MWT: 379.8889, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| DASA-58, Alternative-names: , CAS# 1203494-49-8, Formula: C19H23N3O6S2, MWT: 453.5324, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| L-685458, Alternative-names: L-685,458, CAS# 292632-98-5, Formula: C39H52N4O6, MWT: 672.8534, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Neuronal Signaling, Target: γ-secretase;γ-secretase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| (±)-Methotrimeprazine (D6), Alternative-names: dl-Methotrimeprazine D6, CAS# 1189805-51-3, Formula: C19H18D6N2OS, MWT: 334.5086, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;Immunology/Inflammation;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Enalaprilat D5, Alternative-names: MK-422 D5, CAS# 349554-00-3, Formula: C18H19D5N2O5, MWT: 353.4244, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Angiotensin-converting Enzyme (ACE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Simetryn, Alternative-names: , CAS# 1014-70-6, Formula: C8H15N5S, MWT: 213.3032, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| Kasugamycin (hydrochloride hydrate), Alternative-names: , CAS# 200132-83-8, Formula: C14H28ClN3O10, MWT: 433.8392, Solubility: DMSO: < 6.6 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Quizalofop-p-ethyl, Alternative-names: (R)-Quizalofop ethyl;Quinofop-ethyl, CAS# 100646-51-3, Formula: C19H17ClN2O4, MWT: 372.8023, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| AMG319, Alternative-names: , CAS# 1608125-21-8, Formula: C21H16FN7, MWT: 385.3970432, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| UNC0642, Alternative-names: , CAS# 1481677-78-4, Formula: C29H44F2N6O2, MWT: 546.6955, Solubility: DMSO: 295 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Epigenetics;GPCR/G Protein, Target: Histone Methyltransferase;Sigma Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| FPS-ZM1, Alternative-names: , CAS# 945714-67-0, Formula: C20H22ClNO, MWT: 327.8478, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Amyloid-β, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Lorediplon, Alternative-names: , CAS# 917393-39-6, Formula: C20H15FN4O2S, MWT: 394.4221, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Ribocil, Alternative-names: , CAS# 1381289-58-2, Formula: C19H22N6OS, MWT: 382.4826, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ribocil-C, Alternative-names: , CAS# 1825355-56-3, Formula: C21H21N7OS, MWT: 419.50274, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Lasofoxifene (Tartrate), Alternative-names: CP-336156, CAS# 190791-29-8, Formula: C32H37NO8, MWT: 563.6381, Solubility: DMSO: 6 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ferulic acid (sodium), Alternative-names: Sodium ferulate, CAS# 24276-84-4, Formula: C10H9NaO4, MWT: 216.1658, Solubility: DMSO: 16.66 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Pyr10, Alternative-names: , CAS# 1315323-00-2, Formula: C18H13F6N3O2S, MWT: 449.3701, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DMXAA, Alternative-names: ASA-404;Vadimezan, CAS# 117570-53-3, Formula: C17H14O4, MWT: 282.2906, Solubility: DMSO: 6.5 mg/mL, Clinical_Information: Phase 2, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| APD597, Alternative-names: JNJ-38431055, CAS# 897732-93-3, Formula: C21H29N5O6S, MWT: 479.5499, Solubility: DMSO: ≥ 19 mg/mL, Clinical_Information: Phase 1, Pathway: GPCR/G Protein, Target: GPR119, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| L67, Alternative-names: DNA Ligase Inhibitor, CAS# 325970-71-6, Formula: C16H14Br2N4O4, MWT: 486.11476, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| L-778123 (hydrochloride), Alternative-names: L-778,123 hydrochloride, CAS# 253863-00-2, Formula: C22H21Cl2N5O, MWT: 442.341, Solubility: DMSO: ≥ 25 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Farnesyl Transferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AMG-337, Alternative-names: , CAS# 1173699-31-4, Formula: C23H22FN7O3, MWT: 463.4643, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ro 46-2005, Alternative-names: , CAS# 150725-87-4, Formula: C23H27N3O6S, MWT: 473.542, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| JAK3-IN-1, Alternative-names: , CAS# 1805787-93-2, Formula: C26H30ClN7O2, MWT: 508.0151, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| 9-Azido-Neu5DAz, Alternative-names: , CAS# 1639411-87-2, Formula: C14H22N6O8, MWT: 402.3599, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Fenoterol (hydrobromide), Alternative-names: Fenoterol bromide;Th-1165a;Phenoterol hydrobromide, CAS# 1944-12-3, Formula: C17H22BrNO4, MWT: 384.2649, Solubility: DMSO：≥ 38 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| RRx-001, Alternative-names: , CAS# 925206-65-1, Formula: C5H6BrN3O5, MWT: 268.02224, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| CJ-42794, Alternative-names: CJ-042794, CAS# 847728-01-2, Formula: C22H17ClFNO4, MWT: 413.8261, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Eleutheroside E, Alternative-names: , CAS# 39432-56-9, Formula: C34H46O18, MWT: 742.7183, Solubility: DMSO: ≥ 7.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Gonadorelin (acetate), Alternative-names: , CAS# 34973-08-5, Formula: C57H79N17O15, MWT: 1242.342, Solubility: DMSO：≥ 12.5 mg/mL, Clinical_Information: Phase 4, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NQDI-1, Alternative-names: , CAS# 175026-96-7, Formula: C19H13NO4, MWT: 319.3108, Solubility: DMSO: 10 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Caspase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Sirtinol, Alternative-names: , CAS# 410536-97-9, Formula: C26H22N2O2, MWT: 394.4651, Solubility: DMSO: 6.5 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Autophagy;Epigenetics;Cell Cycle/DNA Damage, Target: Autophagy;Sirtuin;Sirtuin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Didox, Alternative-names: N,3,4-Trihydroxybenzamide, CAS# 69839-83-4, Formula: C7H7NO4, MWT: 169.1348, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Amprolium (hydrochloride), Alternative-names: , CAS# 137-88-2, Formula: C14H20Cl2N4, MWT: 315.2414, Solubility: H<sub>2</sub>O: ≥ 200 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Ellipticine, Alternative-names: , CAS# 519-23-3, Formula: C17H14N2, MWT: 246.3065, Solubility: DMSO: 5.8 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| beta-Mangostin, Alternative-names: β-Mangostin, CAS# 20931-37-7, Formula: C25H28O6, MWT: 424.4862, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Coixol, Alternative-names: 6-Methoxy-2-benzoxazolinone;6-MBOA, CAS# 532-91-2, Formula: C8H7NO3, MWT: 165.1461, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ligustrazine (hydrochloride), Alternative-names: Chuanxiongzine hydrochloride;Tetramethylpyrazine hydrochloride, CAS# 76494-51-4, Formula: C8H12N2, MWT: 136.1943, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ligustilide, Alternative-names: , CAS# 4431-01-0, Formula: C12H14O2, MWT: 190.2384, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Salidroside, Alternative-names: Rhodioloside, CAS# 10338-51-9, Formula: C14H20O7, MWT: 300.3044, Solubility: H<sub>2</sub>O: 150 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Safflower Yellow, Alternative-names: Carthamine, CAS# 36338-96-2, Formula: C43H42O22, MWT: 910.7804, Solubility: DMSO: ≥ 39 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Baicalin, Alternative-names: Baicalein 7-O-β-D-glucuronide, CAS# 21967-41-9, Formula: C21H18O11, MWT: 446.361, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;NF-κB, Target: Autophagy;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Diosgenin, Alternative-names: , CAS# 512-04-9, Formula: C27H42O3, MWT: 414.6206, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling;JAK/STAT Signaling;Stem Cell/Wnt, Target: JAK;JAK;JAK;STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Eicosapentaenoic acid (ethyl ester), Alternative-names: Ethyl eicosapentaenoate;EPA ethyl ester, CAS# 86227-47-6, Formula: C22H34O2, MWT: 330.5042, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Cefsulodin (sodium), Alternative-names: , CAS# 52152-93-9, Formula: C22H19N4NaO8S2, MWT: 554.528, Solubility: DMSO: 17 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Cefonicid (sodium), Alternative-names: Cefonicid disodium salt, CAS# 61270-78-8, Formula: C18H16N6Na2O8S3, MWT: 586.5296, Solubility: DMSO: 16 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Mezlocillin (sodium), Alternative-names: , CAS# 42057-22-7, Formula: C21H24N5NaO8S2, MWT: 561.5637, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Benzetimide (hydrochloride), Alternative-names: R4929, CAS# 5633-14-7, Formula: C23H27ClN2O2, MWT: 398.9257, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ceftizoxime (sodium), Alternative-names: , CAS# 68401-82-1, Formula: C13H12N5NaO5S2, MWT: 405.3846, Solubility: DMSO: 15 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Chlorphenoxamine, Alternative-names: , CAS# 77-38-3, Formula: C18H22ClNO, MWT: 303.8264, Solubility: DMSO: ≥ 48 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Clebopride (malate), Alternative-names: , CAS# 57645-91-7, Formula: C24H30ClN3O7, MWT: 507.9639, Solubility: DMSO：≥ 34 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Nifursol, Alternative-names: , CAS# 16915-70-1, Formula: C12H7N5O9, MWT: 365.2121, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Ancitabine (hydrochloride), Alternative-names: Cyclocytidine hydrochloride;Cyclo-CMP hydrochloride;Cyclo-C, CAS# 10212-25-6, Formula: C9H12ClN3O4, MWT: 261.6623, Solubility: DMSO: ≥ 10 mM; DMSO: < 11.4 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| LOXO-101 (sulfate), Alternative-names: Larotrectinib sulfate, CAS# 1223405-08-0, Formula: C21H24F2N6O6S, MWT: 526.5137, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Trk Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| GSK163090, Alternative-names: , CAS# 844903-58-8, Formula: C25H29N5O, MWT: 415.5307, Solubility: DMSO: 16.5 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Remimazolam (benzenesulfonate), Alternative-names: CN-7056 benzenesulfonate, CAS# 1001415-66-2, Formula: C27H25BrN4O5S, MWT: 597.4802, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| GBT 440, Alternative-names: Voxelotor, CAS# 1446321-46-5, Formula: C19H19N3O3, MWT: 337.3725, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| THS-044, Alternative-names: , CAS# 62054-67-5, Formula: C11H12F3N3O3, MWT: 291.2265, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LMI070, Alternative-names: NVS-SM1;Branaplam, CAS# 1562338-42-4, Formula: C22H27N5O2, MWT: 393.4821, Solubility: DMSO: 6.12 mg/mL, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Calicheamicin, Alternative-names: Calicheamicin γ1, CAS# 108212-75-5, Formula: C55H74IN3O21S4, MWT: 1368.348, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Antibody-drug Conjugate/ADC Related, Target: DNA Alkylator/Crosslinker;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| alpha-Amanitin, Alternative-names: α-Amanitin;α-Amatoxin, CAS# 23109-05-9, Formula: C39H54N10O14S, MWT: 918.9697, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related;Cell Cycle/DNA Damage, Target: ADC Cytotoxin;DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Maytansinol, Alternative-names: Ansamitocin P-0, CAS# 57103-68-1, Formula: C28H37ClN2O8, MWT: 565.055, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| D-JNKI-1, Alternative-names: AM-111;XG-102;NH2-DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-COOH, CAS# 1445179-97-4, Formula: C164H286N66O40, MWT: 3822.44, Solubility: H<sub>2</sub>O: ≥ 50 mg/mL, Clinical_Information: Phase 3, Pathway: MAPK/ERK Pathway, Target: JNK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Harmine, Alternative-names: Telepathine, CAS# 442-51-3, Formula: C13H12N2O, MWT: 212.2472, Solubility: DMSO: 10 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Neuronal Signaling;GPCR/G Protein, Target: Autophagy;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| Methoxyphenamine (Hydrochloride), Alternative-names: NSC-65644, CAS# 5588-10-3, Formula: C11H18ClNO, MWT: 215.7197, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Metamizole (sodium hydrate), Alternative-names: , CAS# 5907-38-0, Formula: C13H18N3NaO5S, MWT: 351.3539, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| Selonsertib, Alternative-names: GS-4997, CAS# 1448428-04-3, Formula: C24H24FN7O, MWT: 445.4921, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 2, Pathway: Apoptosis, Target: Caspase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Elagolix, Alternative-names: NBI-56418, CAS# 834153-87-6, Formula: C32H30F5N3O5, MWT: 631.589716, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ombitasvir, Alternative-names: ABT-267, CAS# 1258226-87-7, Formula: C50H67N7O8, MWT: 894.1091, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| thymus peptide C, Alternative-names: , CAS# 316791-23-8, Formula: CH3, MWT: 15.03452, Solubility: H<sub>2</sub>O: 25 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Elbasvir, Alternative-names: MK-8742, CAS# 1370468-36-2, Formula: C49H55N9O7, MWT: 882.0171, Solubility: DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MSX-122, Alternative-names: , CAS# 897657-95-3, Formula: C16H16N6, MWT: 292.3384, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| NS-398, Alternative-names: , CAS# 123653-11-2, Formula: C13H18N2O5S, MWT: 314.3574, Solubility: DMSO: 9 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Acacetin, Alternative-names: 5,7-Dihydroxy-4'-methoxyflavone, CAS# 480-44-4, Formula: C16H12O5, MWT: 284.2635, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PF-3274167, Alternative-names: , CAS# 900510-03-4, Formula: C19H19ClFN5O3, MWT: 419.8372, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Oxytocin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MUT056399, Alternative-names: , CAS# 1269055-85-7, Formula: C15H13F2NO3, MWT: 293.2654, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Mephenesin, Alternative-names: , CAS# 59-47-2, Formula: C10H14O3, MWT: 182.2164, Solubility: DMSO: ≥ 1.8 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Hematoxylin, Alternative-names: Natural Black 1;Haematoxylin, CAS# 517-28-2, Formula: C16H14O6, MWT: 302.2787, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Gynostemma Extract, Alternative-names: Ginsenoside C-Mx1;Gynosaponin I;Gypenoside IX;Notoginsenoside Fd, CAS# 80321-63-7, Formula: C47H80O17, MWT: 917.1279, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| FIIN-2, Alternative-names: , CAS# 1633044-56-0, Formula: C35H38N8O4, MWT: 634.7274, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| McMMAF, Alternative-names: Maleimidocaproyl monomethylauristatin F, CAS# 863971-19-1, Formula: C49H76N6O11, MWT: 925.16134, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BRD7552, Alternative-names: , CAS# 1137359-47-7, Formula: C33H33N3O15, MWT: 711.62622, Solubility: DMSO: ≥ 38 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ponceau 4R, Alternative-names: Acid Red 18;New Coccine, CAS# 2611-82-7, Formula: C20H11N2Na3O10S3, MWT: 604.473, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Amaranth, Alternative-names: Acid Red 27;Azorubin S;FD & C Red Dye No. 2, CAS# 915-67-3, Formula: C20H14N2Na3O10S3 3+, MWT: 607.4952221, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| 6-Quinoxalinecarboxylic acid, 2,3-bis(bromomethyl)-, Alternative-names: , CAS# 32602-11-2, Formula: C11H8Br2N2O2, MWT: 360.0014, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: ADC Linker, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Degarelix, Alternative-names: , CAS# 214766-78-6, Formula: C82H103ClN18O16, MWT: 1632.259, Solubility: H<sub>2</sub>O: ≥ 500 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Tauroursodeoxycholate (Sodium), Alternative-names: Sodium tauroursodeoxycholate;Tauroursodeoxycholic acid sodium salt, CAS# 35807-85-3, Formula: C26H44NNaO6S, MWT: 521.6854, Solubility: H<sub>2</sub>O: ≥ 39 mg/mL, Clinical_Information: Launched, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Aglafoline, Alternative-names: Aglafolin;Rocaglamide U;(-)-Methyl rocaglate, CAS# 143901-35-3, Formula: C28H28O8, MWT: 492.5171, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| PKR-IN-2, Alternative-names: , CAS# 1628428-01-2, Formula: C24H28N4O4S, MWT: 468.5685, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SKF 38393 (hydrochloride), Alternative-names: (¡À)-SKF-38393 hydrochloride;SKF-38393, CAS# 62717-42-4, Formula: C16H18ClNO2, MWT: 291.7726, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| DEL-22379, Alternative-names: , CAS# 181223-80-3, Formula: C26H28N4O3, MWT: 444.5255, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Acalabrutinib, Alternative-names: ACP-196, CAS# 1420477-60-6, Formula: C26H23N7O2, MWT: 465.5065, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NS-018 (hydrochloride), Alternative-names: NS018 hydrochloride;NS 018 hydrochloride, CAS# 1239358-85-0, Formula: C21H21ClFN7, MWT: 425.8897, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Phase 2, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NS-018, Alternative-names: , CAS# 1239358-86-1, Formula: C21H20FN7, MWT: 389.4288, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 2, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CCT251545, Alternative-names: , CAS# 1661839-45-7, Formula: C23H24ClN5O, MWT: 421.9225, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| E-982, Alternative-names: , CAS# 858102-78-0, Formula: C25H31NO6S, MWT: 473.5817, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LY3023414, Alternative-names: , CAS# 1386874-06-1, Formula: C23H26N4O3, MWT: 406.4775, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR;Cell Cycle/DNA Damage;PI3K/Akt/mTOR;PI3K/Akt/mTOR, Target: DNA-PK;DNA-PK;PI3K;mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Sudan I, Alternative-names: Solvent Yellow 14, CAS# 842-07-9, Formula: C16H12N2O, MWT: 248.2793, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Sunset Yellow FCF, Alternative-names: Food Yellow 3;Orange Yellow S;C.I. 15985, CAS# 2783-94-0, Formula: C16H10N2Na2O7S2, MWT: 452.3693, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Tartrazine, Alternative-names: Acid Yellow 23;FD&C Yellow 5;C.I. 19140, CAS# 1934-21-0, Formula: C16H9N4Na3O9S2, MWT: 534.3633, Solubility: DMSO: 10 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Fast Green FCF, Alternative-names: Food green 3;FD&C Green No. 3;C.I. 42053, CAS# 2353-45-9, Formula: C37H34N2Na2O10S3, MWT: 808.8478, Solubility: H<sub>2</sub>O: ≥ 66.66 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Brilliant Blue FCF, Alternative-names: Acid Blue 9;E133;Erioglaucine disodium salt;FD&C Blue No. 1, CAS# 3844-45-9, Formula: C37H34N2Na2O9S3, MWT: 792.8484, Solubility: H<sub>2</sub>O: ≥ 48 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Aucubin, Alternative-names: , CAS# 479-98-1, Formula: C15H22O9, MWT: 346.3298, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Pachymic acid, Alternative-names: 3-O-Acetyltumulosic acid, CAS# 29070-92-6, Formula: C33H52O5, MWT: 528.763, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway;PI3K/Akt/mTOR, Target: ERK;ERK;Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| STING agonist-1, Alternative-names: G10, CAS# 702662-50-8, Formula: C21H16ClFN2O3S, MWT: 430.8797432, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: STING, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| SGC707, Alternative-names: , CAS# 1687736-54-4, Formula: C16H18N4O2, MWT: 298.3397, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| XY1, Alternative-names: , CAS# 1624117-53-8, Formula: C17H19N3O2, MWT: 297.3517, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| ATP-polyamine-biotin, Alternative-names: , CAS# 1800401-93-7, Formula: C32H58N11O14P3S, MWT: 945.8545, Solubility: H<sub>2</sub>O: 6 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Centrinone-B, Alternative-names: , CAS# 1798871-31-4, Formula: C27H27F2N7O5S2, MWT: 631.6739864, Solubility: DMSO: 8.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Polo-like Kinase (PLK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tubastatin-A, Alternative-names: , CAS# 1252003-15-8, Formula: C20H21N3O2, MWT: 335.3996, Solubility: DMSO: ≥ 45 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Epigenetics;Cell Cycle/DNA Damage, Target: Autophagy;HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ARQ-092, Alternative-names: Miransertib, CAS# 1313881-70-7, Formula: C27H24N6, MWT: 432.5197, Solubility: DMSO: ≥ 40.2 mg/mL, Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR, Target: Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| DCVC, Alternative-names: S-[(1E)-1,2-dichloroethenyl]--L-cysteine, CAS# 13419-46-0, Formula: C5H7Cl2NO2S, MWT: 216.0856, Solubility: DMSO; H<sub>2</sub>O: 1.034 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| CC-115 (hydrochloride), Alternative-names: , CAS# 1300118-55-1, Formula: C16H17ClN8O, MWT: 372.8122, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR;Cell Cycle/DNA Damage;PI3K/Akt/mTOR, Target: DNA-PK;DNA-PK;mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| LJI308, Alternative-names: , CAS# 1627709-94-7, Formula: C21H18F2N2O2, MWT: 368.3766, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: Ribosomal S6 Kinase (RSK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| VU0361737, Alternative-names: ML-128, CAS# 1161205-04-4, Formula: C13H11ClN2O2, MWT: 262.6917, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NSC59984, Alternative-names: , CAS# 803647-40-7, Formula: C12H15N3O4, MWT: 265.2652, Solubility: DMSO: ≥ 38 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Nastorazepide, Alternative-names: Z-360, CAS# 209219-38-5, Formula: C29H36N4O5, MWT: 520.6199, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Cholecystokinin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 1-Naphthyl PP1 (hydrochloride), Alternative-names: 1-NA-PP 1 hydrochloride, CAS# 956025-47-1, Formula: C19H20ClN5, MWT: 353.8486, Solubility: DMSO: ≥ 73 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| (-)-p-Bromotetramisole (oxalate), Alternative-names: L-p-Bromotetramisole oxalate;6-Bromolevamisole oxalate;(-)-p-Bromolevamisole oxalate, CAS# 62284-79-1, Formula: C13H13BrN2O4S, MWT: 373.2223, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SW044248, Alternative-names: , CAS# 522650-83-5, Formula: C22H23N5O2S, MWT: 421.5153, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vesnarinone, Alternative-names: OPC-8212, CAS# 81840-15-5, Formula: C22H25N3O4, MWT: 395.4516, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Velneperit, Alternative-names: S2367, CAS# 342577-38-2, Formula: C17H24F3N3O3S, MWT: 407.451, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Neuropeptide Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BAY 41-2272, Alternative-names: , CAS# 256376-24-6, Formula: C20H17FN6, MWT: 360.3876, Solubility: DMSO: 17.5 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Guanylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Relebactam, Alternative-names: MK-7655, CAS# 1174018-99-5, Formula: C12H20N4O6S, MWT: 348.3754, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Grapiprant, Alternative-names: CJ-023423;RQ-00000007;AAT-007, CAS# 415903-37-6, Formula: C26H29N5O3S, MWT: 491.6052, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Peficitinib, Alternative-names: ASP015K;JNJ-54781532, CAS# 944118-01-8, Formula: C18H22N4O2, MWT: 326.3929, Solubility: DMSO: ≥ 60 mg/mL, Clinical_Information: Phase 3, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| MCB-613, Alternative-names: , CAS# 1162656-22-5, Formula: C20H20N2O, MWT: 304.3856, Solubility: DMSO: 10 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GSK2256294A, Alternative-names: GSK 2256294, CAS# 1142090-23-0, Formula: C21H24F3N7O, MWT: 447.4568, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Anlotinib, Alternative-names: , CAS# 1058156-90-3, Formula: C23H22FN3O3, MWT: 407.4375, Solubility: DMSO: ≥ 44 mg/mL, Clinical_Information: Phase 3, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Echinocystic acid, Alternative-names: , CAS# 510-30-5, Formula: C30H48O4, MWT: 472.69972, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| A-1155463, Alternative-names: , CAS# 1235034-55-5, Formula: C35H32FN5O4S2, MWT: 669.7881, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| HPOB, Alternative-names: , CAS# 1429651-50-2, Formula: C17H18N2O4, MWT: 314.3358, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LED209, Alternative-names: , CAS# 245342-14-7, Formula: C19H17N3O2S2, MWT: 383.4872, Solubility: DMSO: < 3.8 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PD 151746, Alternative-names: , CAS# 179461-52-0, Formula: C11H8FNO2S, MWT: 237.2501, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Proteasome, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| VLX1570, Alternative-names: , CAS# 1431280-51-1, Formula: C23H17F2N3O6, MWT: 469.3943864, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage, Target: Deubiquitinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tocofersolan, Alternative-names: D-α-Tocopherol polyethylene glycol 1000 succinate;TPGS;Vitamin E-TPGS, CAS# 9002-96-4, Formula: C35H58O6, MWT: 574.8314, Solubility: DMSO: ≥ 5.7 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| Microcystin-LR, Alternative-names: Cyanoginosin-LR;MC-LR;Toxin T 17 (Microcystis aeruginosa), CAS# 101043-37-2, Formula: C49H74N10O12, MWT: 995.1716, Solubility: Ethanol: 0.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50ug |
| CB-5083, Alternative-names: , CAS# 1542705-92-9, Formula: C24H23N5O2, MWT: 413.4717, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage, Target: p97, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Calyculin A, Alternative-names: (-)-Calyculin A, CAS# 101932-71-2, Formula: C50H81N4O15P, MWT: 1009.17, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10ug |
| Eupatilin, Alternative-names: , CAS# 22368-21-4, Formula: C18H16O7, MWT: 344.3154, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Autophagy;NF-κB, Target: PPAR;Autophagy;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Quercitrin, Alternative-names: Quercetin 3-rhamnoside, CAS# 522-12-3, Formula: C21H20O11, MWT: 448.3769, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;MAPK/ERK Pathway, Target: Autophagy;Ribosomal S6 Kinase (RSK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GPRP (acetate), Alternative-names: Gly-Pro-Arg-Pro acetate;Glycyl-L-prolyl-L-arginyl-L-proline acetate;Pefa 6003;Pefabloc FG, CAS# 157009-81-9, Formula: C20H35N7O7, MWT: 485.5346, Solubility: H<sub>2</sub>O: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Cytoskeleton, Target: Integrin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| JNJ-42165279, Alternative-names: , CAS# 1346528-50-4, Formula: C18H17ClF2N4O3, MWT: 410.8024, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;Metabolic Enzyme/Protease, Target: FAAH;FAAH, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Oltipraz, Alternative-names: RP 35972;NSC 347901, CAS# 64224-21-1, Formula: C8H6N2S3, MWT: 226.3416, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| Olmutinib, Alternative-names: HM61713, BI 1482694, CAS# 1353550-13-6, Formula: C26H26N6O2S, MWT: 486.5887, Solubility: DMSO: ≥ 44 mg/mL, Clinical_Information: Phase 2, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DprE1-IN-1, Alternative-names: AZ 7371, CAS# 1494675-86-3, Formula: C18H21N5O3, MWT: 355.3911, Solubility: DMSO: 11 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| PS-1145, Alternative-names: , CAS# 431898-65-6, Formula: C17H11ClN4O, MWT: 322.7484, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: IKK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GSK0660, Alternative-names: , CAS# 1014691-61-2, Formula: C19H18N2O5S2, MWT: 418.4866, Solubility: DMSO: ≥ 49 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| N-Acetyl-Calicheamicin, Alternative-names: N-Acetyl-Calicheamicin γ;N-Acetyl-γ-calicheamicin, CAS# 108212-76-6, Formula: C57H76IN3O22S4, MWT: 1410.385, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Glyoxalase I inhibitor (free base), Alternative-names: , CAS# 174568-92-4, Formula: C21H29BrN4O8S, MWT: 577.446, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
GW274150, Alternative-names: , CAS# 210354-22-6, Formula: C8H17N3O2S, MWT: 219.3045, Solubility: H<sub>2</sub>O: ≥ 62 mg/mL
, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation, Target: NO Synthase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| (-)-Indolactam V, Alternative-names: Indolactam V, CAS# 90365-57-4, Formula: C17H23N3O2, MWT: 301.3834, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Daucosterol, Alternative-names: Eleutheroside A;β-Sitosterol β-D-glucoside, CAS# 474-58-8, Formula: C35H60O6, MWT: 576.8473, Solubility: DMSO: 7.9 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MIR96-IN-1, Alternative-names: , CAS# 1311982-88-3, Formula: C33H48N8O2, MWT: 588.7866, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: MicroRNA, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Eliglustat (hemitartrate), Alternative-names: Genz-112638;Eliglustat tartrate, CAS# 928659-70-5, Formula: C50H78N4O14, MWT: 959.1727, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Eliglustat, Alternative-names: Genz 99067, CAS# 491833-29-5, Formula: C23H36N2O4, MWT: 404.5429, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Indirubin-3'-monoxime, Alternative-names: Indirubin-3'-oxime, CAS# 160807-49-8, Formula: C16H11N3O2, MWT: 277.2774, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;PI3K/Akt/mTOR;Metabolic Enzyme/Protease, Target: GSK-3;GSK-3;5-Lipoxygenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tyr-Gly-Gly-Phe-Met-OH, Alternative-names: Met-Enkephalin;Methionine enkephalin, CAS# 58569-55-4, Formula: C27H35N5O7S, MWT: 573.6611, Solubility: DMSO: ≥ 40 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| MCC950 (sodium), Alternative-names: CP-456773 sodium;CRID3 sodium salt, CAS# 256373-96-3, Formula: C20H23N2NaO5S, MWT: 426.4618, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NOD-like Receptor (NLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Fmoc-Val-Cit-PAB-MMAE, Alternative-names: , CAS# 1350456-56-2, Formula: C73H104N10O14, MWT: 1345.665, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Acetylene-linker-Val-Cit-PABC-MMAE, Alternative-names: LCB14-0602, CAS# 1411977-95-1, Formula: C67H106N10O16, MWT: 1307.616, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| mDPR-Val-Cit-PAB-MMAE, Alternative-names: , CAS# 1491152-26-1, Formula: C65H100N12O15, MWT: 1289.561, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Cucurbitacin I, Alternative-names: Elatericin B;JSI-124;NSC-521777, CAS# 2222-07-3, Formula: C30H42O7, MWT: 514.6503, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Apigenin, Alternative-names: 4',5,7-Trihydroxyflavone;Apigenine;Apigenol;C.I. Natural Yellow 1, CAS# 520-36-5, Formula: C15H10O5, MWT: 270.2369, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;NF-κB, Target: Autophagy;IKK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NSC305787 (hydrochloride), Alternative-names: , CAS# 53868-26-1, Formula: C25H31Cl3N2O, MWT: 481.8854, Solubility: DMSO: 8 mg/mL, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| VU0357017 (hydrochloride), Alternative-names: CID-25010775, CAS# 1135242-13-5, Formula: C18H28ClN3O3, MWT: 369.8862, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| KS176, Alternative-names: , CAS# 1253452-78-6, Formula: C22H19N3O5, MWT: 405.4034, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: BCRP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PRT4165, Alternative-names: NSC600157, CAS# 31083-55-3, Formula: C15H9NO2, MWT: 235.2375, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: E1/E2/E3 Enzyme, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PFK-158, Alternative-names: , CAS# 1462249-75-7, Formula: C18H11F3N2O, MWT: 328.2879496, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 1, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| YHO-13351 (free base), Alternative-names: , CAS# 912288-64-3, Formula: C26H33N3O4S, MWT: 483.6229, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: BCRP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DPC-681, Alternative-names: DPH-153893, CAS# 284661-68-3, Formula: C35H48FN5O5S, MWT: 669.8495, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HIV Protease, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| AN3199, Alternative-names: , CAS# 1187187-10-5, Formula: C17H18BNO5, MWT: 327.1395, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| BMS-202, Alternative-names: PD-1/PD-L1 inhibitor 2, CAS# 1675203-84-5, Formula: C25H29N3O3, MWT: 419.5161, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: PD-1/PD-L1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| M1 receptor modulator, Alternative-names: MK-7622, CAS# 1227923-29-6, Formula: C25H25N3O2, MWT: 399.4849, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PI3Kα inhibitor 1, Alternative-names: , CAS# 1235449-52-1, Formula: C23H25N9O3S, MWT: 507.5681, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GSK2838232, Alternative-names: , CAS# 1443460-91-0, Formula: C48H73ClN2O6, MWT: 809.556, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GSK2330672, Alternative-names: , CAS# 1345982-69-5, Formula: C28H38N2O7S, MWT: 546.6755, Solubility: DMSO: 21.5 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| HDAC-IN-3, Alternative-names: , CAS# 1018673-42-1, Formula: C22H33N3O4, MWT: 403.5151, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| GSK2981278, Alternative-names: , CAS# 1474110-21-8, Formula: C25H35NO5S, MWT: 461.6141, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: ROR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 4EGI-1, Alternative-names: , CAS# 315706-13-9, Formula: C18H12Cl2N4O4S, MWT: 451.2833, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Eukaryotic Initiation Factor (eIF), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Ombrabulin (hydrochloride), Alternative-names: AVE8062;AVE8062A;AC7700, CAS# 253426-24-3, Formula: C21H27ClN2O6, MWT: 438.9019, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SC66, Alternative-names: , CAS# 871361-88-5, Formula: C18H16N2O, MWT: 276.3324, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Daprodustat, Alternative-names: GSK1278863, CAS# 960539-70-2, Formula: C19H27N3O6, MWT: 393.4342, Solubility: DMSO: < 6.8 mg/mL, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Hederagenin, Alternative-names: , CAS# 465-99-6, Formula: C30H48O4, MWT: 472.69972, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Diosmetin, Alternative-names: , CAS# 520-34-3, Formula: C16H12O6, MWT: 300.2629, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Orexin 2 Receptor Agonist, Alternative-names: , CAS# 1796565-52-0, Formula: C32H34N4O5S, MWT: 586.7012, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Orexin Receptor (OX Receptor), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SID 3712249, Alternative-names: MiR-544 Inhibitor 1, CAS# 522606-67-3, Formula: C17H21N7, MWT: 323.3955, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: MicroRNA, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NK-252, Alternative-names: , CAS# 1414963-82-8, Formula: C13H11N5O3, MWT: 285.2581, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: Keap1-Nrf2, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| KJ Pyr 9, Alternative-names: , CAS# 581073-80-5, Formula: C22H15N3O4, MWT: 385.3722, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: c-Myc, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| TY-52156, Alternative-names: , CAS# 934369-14-9, Formula: C18H19Cl2N3O, MWT: 364.269, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| DG172 (dihydrochloride), Alternative-names: , CAS# 1361504-77-9, Formula: C20H22BrCl2N3, MWT: 455.2188, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| JW74, Alternative-names: , CAS# 863405-60-1, Formula: C24H20N6O2S, MWT: 456.5196, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Stem Cell/Wnt;NF-κB, Target: PPAR;Wnt;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BET-IN-1, Alternative-names: , CAS# 1422554-34-4, Formula: C25H30N4O4, MWT: 450.5301, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Danirixin, Alternative-names: GSK1325756, CAS# 954126-98-8, Formula: C19H21ClFN3O4S, MWT: 441.9041432, Solubility: DMSO: 8 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ansamitocin P 3', Alternative-names: Antibiotic C 15003P3';Maytansinol butyrate, CAS# 66547-09-9, Formula: C32H43ClN2O9, MWT: 635.14482, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Hematoporphyrin (dihydrochloride), Alternative-names: Hematoporphyrin IX dihydrochloride, CAS# 17696-69-4, Formula: C34H40Cl2N4O6, MWT: 671.6106, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Naquotinib (mesylate), Alternative-names: ASP8273, CAS# 1448237-05-5, Formula: C31H46N8O6S, MWT: 658.812, Solubility: DMSO: 12.5 mg/mL, Clinical_Information: Phase 3, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Naquotinib, Alternative-names: ASP8273, CAS# 1448232-80-1, Formula: C30H42N8O3, MWT: 562.7063, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| BMS-191095, Alternative-names: , CAS# 166095-21-2, Formula: C22H21ClN4O2, MWT: 408.88074, Solubility: DMSO: ≥ 50 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ALS-8112, Alternative-names: , CAS# 1445379-92-9, Formula: C10H13ClFN3O4, MWT: 293.6793, Solubility: DMSO: ≥ 47 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: RSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NAN-190 (hydrobromide), Alternative-names: , CAS# 115338-32-4, Formula: C23H28BrN3O3, MWT: 474.3907, Solubility: DMSO: 36.23 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| DAA-1106, Alternative-names: , CAS# 220551-92-8, Formula: C23H22FNO4, MWT: 395.4235, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Pleconaril, Alternative-names: VP 63843;Win 63843, CAS# 153168-05-9, Formula: C18H18F3N3O3, MWT: 381.349, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Enterovirus, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| BCTC, Alternative-names: , CAS# 393514-24-4, Formula: C20H25ClN4O, MWT: 372.8917, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| JNJ-63533054, Alternative-names: , CAS# 1802326-66-4, Formula: C17H17ClN2O2, MWT: 316.7821, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPR139, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Endoxifen (E-isomer hydrochloride), Alternative-names: E-Endoxifen hydrochloride, CAS# 1197194-61-8, Formula: C25H28ClNO2, MWT: 409.9483, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Dimethylenastron, Alternative-names: , CAS# 863774-58-7, Formula: C16H18N2O2S, MWT: 302.3913, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: Kinesin;Kinesin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MS023, Alternative-names: , CAS# 1831110-54-3, Formula: C17H25N3O, MWT: 287.3999, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| XEN907, Alternative-names: , CAS# 912656-34-9, Formula: C21H21NO4, MWT: 351.3958, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tangeretin, Alternative-names: Tangeritin;NSC53909;NSC618905;Ponkanetin, CAS# 481-53-8, Formula: C20H20O7, MWT: 372.3686, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Notch, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Halofuginone, Alternative-names: Tempostatin;RU-19110, CAS# 55837-20-2, Formula: C16H17BrClN3O3, MWT: 414.6815, Solubility: DMSO: 9 mg/mL, Clinical_Information: Phase 2, Pathway: Stem Cell/Wnt;TGF-beta/Smad, Target: TGF-beta/Smad;TGF-beta/Smad, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| GTS-21 (dihydrochloride), Alternative-names: DMXB-A;DMBX-anabaseine, CAS# 156223-05-1, Formula: C19H22Cl2N2O2, MWT: 381.2962, Solubility: DMSO: 16.5 mg/mL, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Antibiotic-202, Alternative-names: , CAS# 1616113-45-1, Formula: C35H39NO11, MWT: 649.6843, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| (-)-DHMEQ, Alternative-names: Dehydroxymethylepoxyquinomicin, CAS# 287194-40-5, Formula: C13H11NO5, MWT: 261.2301, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Seco Rapamycin (sodium salt), Alternative-names: Secorapamycin A monosodium, CAS# 148554-65-8, Formula: C51H78NNaO13, MWT: 936.1537, Solubility: DMSO: ≥ 46 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MLN1117, Alternative-names: Serabelisib;INK1117, CAS# 1268454-23-4, Formula: C19H17N5O3, MWT: 363.37, Solubility: DMSO: 6.4 mg/mL (Need ultrasonic or warming), Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 3PO, Alternative-names: 3PO (inhibitor of glucose metabolism), CAS# 18550-98-6, Formula: C13H10N2O, MWT: 210.2313, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Thiazole Orange, Alternative-names: , CAS# 107091-89-4, Formula: C26H24N2O3S2, MWT: 476.6104, Solubility: DMSO: 14.6 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg |
| (+)-Bicuculline, Alternative-names: d-Bicuculline, CAS# 485-49-4, Formula: C20H17NO6, MWT: 367.3521, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| PF-04929113 (Mesylate), Alternative-names: SNX-5422 Mesylate, CAS# 1173111-67-5, Formula: C26H34F3N5O7S, MWT: 617.6377, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| RN-1734, Alternative-names: , CAS# 946387-07-1, Formula: C14H22Cl2N2O2S, MWT: 353.3077, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| K858, Alternative-names: , CAS# 72926-24-0, Formula: C13H15N3O2S, MWT: 277.3421, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: Kinesin;Kinesin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Mirin, Alternative-names: , CAS# 1198097-97-0, Formula: C10H8N2O2S, MWT: 220.2477, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| YM-90709, Alternative-names: , CAS# 163769-88-8, Formula: C22H21N3O2, MWT: 359.4211, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Interleukin Related, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| KM11060, Alternative-names: , CAS# 774549-97-2, Formula: C19H17Cl2N3O2S, MWT: 422.3282, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: CFTR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NSC 601980 (analog), Alternative-names: , CAS# 91757-46-9, Formula: C15H14N4, MWT: 250.2985, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Digitoxin, Alternative-names: , CAS# 71-63-6, Formula: C41H64O13, MWT: 764.9391, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Na+/K+ ATPase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SNG-1153, Alternative-names: , CAS# 1446712-19-1, Formula: C21H17F3O5, MWT: 406.3519, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| CH5183284, Alternative-names: Debio 1347, CAS# 1265229-25-1, Formula: C20H16N6O, MWT: 356.3806, Solubility: DMSO: ≥ 31mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Oleandrin, Alternative-names: , CAS# 465-16-7, Formula: C32H48O9, MWT: 576.7181, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;NF-κB, Target: β-catenin;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Neuromedin N, Alternative-names: Lys-Ile-Pro-Tyr-Ile-Leu;Neuromedin N (rat, mouse, porcine, canine), CAS# 92169-45-4, Formula: C38H63N7O8, MWT: 745.9489, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Rapastinel, Alternative-names: GLYX-13;Thr-Pro-Pro-Thr-NH2, CAS# 117928-94-6, Formula: C18H31N5O6, MWT: 413.4686, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TRAP-6, Alternative-names: Ser-Phe-Leu-Leu-Arg-Asn;Thrombin Receptor Activator Peptide 6, CAS# 141136-83-6, Formula: C34H56N10O9, MWT: 748.87004, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Protease-Activated Receptor (PAR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bax inhibitor peptide V5, Alternative-names: Val-Pro-Met-Leu-Lys;BIP-V5;BAX Inhibiting Peptide V5, CAS# 579492-81-2, Formula: C27H50N6O6S, MWT: 586.7875, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Sodium lauryl polyoxyethylene ether sulfate, Alternative-names: Sodium laureth sulfate, CAS# 9004-82-4, Formula: (C2H4O)n C12H26O4S . Na, MWT: 1000, Solubility: H<sub>2</sub>O: ≥ 31 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g |
| Tasimelteon, Alternative-names: BMS-214778;VEC-162, CAS# 609799-22-6, Formula: C15H19NO2, MWT: 245.3169, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Melatonin Receptor;Melatonin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| JWH-133, Alternative-names: , CAS# 259869-55-1, Formula: C22H32O, MWT: 312.4889, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;GPCR/G Protein, Target: Autophagy;Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| FIIN-3, Alternative-names: , CAS# 1637735-84-2, Formula: C34H36Cl2N8O4, MWT: 691.6068, Solubility: DMSO: 10 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR;FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ABT-639, Alternative-names: , CAS# 1235560-28-7, Formula: C20H20ClF2N3O3S, MWT: 455.9059, Solubility: DMSO: 10 mg/mL, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BML-284, Alternative-names: , CAS# 853220-52-7, Formula: C19H18N4O3, MWT: 350.3712, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| 3-Bromopyruvic acid, Alternative-names: Bromopyruvic acid;Hexokinase II Inhibitor II, 3-BP, CAS# 1113-59-3, Formula: C3H3BrO3, MWT: 166.9581, Solubility: H<sub>2</sub>O: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Hexokinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| Nobiletin, Alternative-names: , CAS# 478-01-3, Formula: C21H22O8, MWT: 402.3946, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tenacissoside H, Alternative-names: Tenacissimoside C, CAS# 191729-45-0, Formula: C42H66O14, MWT: 794.965, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| alpha-Asarone, Alternative-names: α-Asarone;trans-Asarone, CAS# 2883-98-9, Formula: C12H16O3, MWT: 208.2536, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| CCT-251921, Alternative-names: , CAS# 1607837-31-9, Formula: C21H23ClN6O, MWT: 410.8999, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Elafibranor, Alternative-names: GFT505, CAS# 923978-27-2, Formula: C22H24O4S, MWT: 384.4886, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BMS-687453, Alternative-names: , CAS# 1000998-59-3, Formula: C22H21ClN2O6, MWT: 444.8649, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LJH685, Alternative-names: , CAS# 1627710-50-2, Formula: C22H21F2N3O, MWT: 381.4185, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: Ribosomal S6 Kinase (RSK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MK-571 (sodium salt), Alternative-names: L-660711 sodium salt, CAS# 115103-85-0, Formula: C26H26ClN2NaO3S2, MWT: 537.069, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| MI-136, Alternative-names: , CAS# 1628316-74-4, Formula: C23H21F3N6S, MWT: 470.5132, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Vorapaxar, Alternative-names: SCH 530348, CAS# 618385-01-6, Formula: C29H33FN2O4, MWT: 492.5817, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Protease-Activated Receptor (PAR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ZM241385, Alternative-names: , CAS# 139180-30-6, Formula: C16H15N7O2, MWT: 337.336, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Peretinoin, Alternative-names: NIK333, CAS# 81485-25-8, Formula: C20H30O2, MWT: 302.451, Solubility: DMSO: ≥ 100 mg/mL;<br/>In vivo: Peretinoin is dissolved in DMSO (3 mg/mL) and then diluted with water (DMSO: water=1:1)., Clinical_Information: Phase 3, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Glesatinib (hydrochloride), Alternative-names: MGCD265 hydrochloride, CAS# 1123838-51-6, Formula: C31H28ClF2N5O3S2, MWT: 656.1655264, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR;TAM Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NT157, Alternative-names: Tyrphostin NT157, CAS# 1384426-12-3, Formula: C16H14BrNO5S, MWT: 412.2551, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Insulin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| UNC1079, Alternative-names: , CAS# 1418741-86-2, Formula: C28H42N4O2, MWT: 466.6587, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Propyphenazone, Alternative-names: 4-Isopropylantipyrine;Isopropylphenazone, CAS# 479-92-5, Formula: C14H18N2O, MWT: 230.3055, Solubility: DMSO: ≥ 2.6 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg |
| Ebselen, Alternative-names: SPI-1005;PZ-51;CCG-39161, CAS# 60940-34-3, Formula: C13H9NOSe, MWT: 274.1767, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Autophagy;Anti-infection, Target: Autophagy;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Fexinidazole, Alternative-names: HOE 239, CAS# 59729-37-2, Formula: C12H13N3O3S, MWT: 279.3149, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ufenamate, Alternative-names: Flufenamic acid butyl ester;Butyl flufenamate, CAS# 67330-25-0, Formula: C18H18F3NO2, MWT: 337.3362, Solubility: DMSO: ≥ 44 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| MK-2461, Alternative-names: , CAS# 917879-39-1, Formula: C24H25N5O5S, MWT: 495.5508, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Trovirdine, Alternative-names: LY300046, CAS# 149488-17-5, Formula: C13H13BrN4S, MWT: 337.2381, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| F 11440, Alternative-names: Eptapirone free base, CAS# 179756-58-2, Formula: C16H23N7O2, MWT: 345.3995, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| lumateperone (Tosylate), Alternative-names: ITI-007, CAS# 1187020-80-9, Formula: C31H36FN3O4S, MWT: 565.6987, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling;GPCR/G Protein, Target: Dopamine Receptor;Dopamine Receptor;5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| C-DIM12, Alternative-names: , CAS# 178946-89-9, Formula: C23H17ClN2, MWT: 356.8475, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| NKL 22, Alternative-names: , CAS# 537034-15-4, Formula: C19H23N3O2, MWT: 325.4048, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GSK583, Alternative-names: , CAS# 1346547-00-9, Formula: C20H19FN4O2S, MWT: 398.4539, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: RIP kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| HIF-2α-IN-1, Alternative-names: , CAS# 1799948-06-3, Formula: C16H8F5NO4S, MWT: 405.2961, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PD1-PDL1 inhibitor 1, Alternative-names: PD-1/PD-L1 inhibitor 1, CAS# 1675201-83-8, Formula: C29H33NO5, MWT: 475.576, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: PD-1/PD-L1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PF-CBP1 (hydrochloride), Alternative-names: , CAS# 2070014-93-4, Formula: C29H37ClN4O3, MWT: 525.0821, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| NSC5844, Alternative-names: RE-640, CAS# 140926-75-6, Formula: C20H16Cl2N4, MWT: 383.2738, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PD 117519, Alternative-names: CI947, CAS# 96392-15-3, Formula: C19H21N5O4, MWT: 383.4012, Solubility: DMSO: ≥ 3.9 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| GSK137647A, Alternative-names: GSK 137647, CAS# 349085-82-1, Formula: C16H19NO3S, MWT: 305.392, Solubility: DMSO: ≥ 32 mg/mL; H<sub>2</sub>O: < 0.06 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPR120, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Flumatinib, Alternative-names: , CAS# 895519-90-1, Formula: C29H29F3N8O, MWT: 562.5887, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: Bcr-Abl;PDGFR;c-Kit, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GNF-7, Alternative-names: , CAS# 839706-07-9, Formula: C28H24F3N7O2, MWT: 547.5311, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Bcr-Abl, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BIBS 39, Alternative-names: , CAS# 133085-33-3, Formula: C32H36N4O3, MWT: 524.6533, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Leucomethylene blue (Mesylate), Alternative-names: Methylene blue leuco base mesylate salt, CAS# 1236208-20-0, Formula: C18H27N3O6S3, MWT: 477.6185, Solubility: H<sub>2</sub>O: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Amezinium (methylsulfate), Alternative-names: Amezinium metilsulfate;Lu-1631, CAS# 30578-37-1, Formula: C12H15N3O5S, MWT: 313.3296, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| TAK-438 (free base), Alternative-names: Vonoprazan, CAS# 881681-00-1, Formula: C17H16FN3O2S, MWT: 345.3912, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Acalisib, Alternative-names: GS-9820;CAL-120, CAS# 870281-34-8, Formula: C21H16FN7O, MWT: 401.3965, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Phase 1, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Finafloxacin, Alternative-names: , CAS# 209342-40-5, Formula: C20H19FN4O4, MWT: 398.3877, Solubility: DMSO: 6.4 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Fruquintinib, Alternative-names: HMPL-013, CAS# 1194506-26-7, Formula: C21H19N3O5, MWT: 393.3927, Solubility: DMSO: 7.75 mg/mL, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PF-915275, Alternative-names: , CAS# 857290-04-1, Formula: C18H14N4O2S, MWT: 350.3943, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GW0742, Alternative-names: GW610742, CAS# 317318-84-6, Formula: C21H17F4NO3S2, MWT: 471.4882, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Artemotil, Alternative-names: β-Arteether;(+)-Arteether;Arteether, CAS# 75887-54-6, Formula: C17H28O5, MWT: 312.4012, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| KDM5A-IN-1, Alternative-names: , CAS# 1905481-36-8, Formula: C15H22N4O2, MWT: 290.3608, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| THZ1-R, Alternative-names: , CAS# 1621523-07-6, Formula: C31H30ClN7O2, MWT: 568.0686, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NSC348884, Alternative-names: , CAS# 81624-55-7, Formula: C38H40N10, MWT: 636.7912, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| A-1331852, Alternative-names: , CAS# 1430844-80-6, Formula: C38H38N6O3S, MWT: 658.8117, Solubility: DMSO: ≥ 12 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Talarozole (R enantiomer), Alternative-names: (R)-Talarozole, CAS# 870093-23-5, Formula: C21H23N5S, MWT: 377.5058, Solubility: DMSO: ≥ 51 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| K 01-162, Alternative-names: K162, CAS# 677746-25-7, Formula: C15H14BrN, MWT: 288.1824, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Amyloid-β, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Sutezolid, Alternative-names: PNU-100480;U-100480;PF-02341272, CAS# 168828-58-8, Formula: C16H20FN3O3S, MWT: 353.4117, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| WEHI-345 analog, Alternative-names: , CAS# 1354825-62-9, Formula: C23H25N7O, MWT: 415.4909, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ON123300, Alternative-names: , CAS# 1357470-29-1, Formula: C24H27N7O, MWT: 429.5175, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Evatanepag, Alternative-names: CP-533536 free acid, CAS# 223488-57-1, Formula: C25H28N2O5S, MWT: 468.5652, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Rutin, Alternative-names: Rutoside;Quercetin 3-O-rutinoside, CAS# 153-18-4, Formula: C27H30O16, MWT: 610.5175, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| Disperse Blue 148, Alternative-names: C.I. Disperse Blue 148;C.I. 11124, CAS# 52239-04-0, Formula: C19H19N5O4S, MWT: 413.45026, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL; DMSO: 20 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| TA-02, Alternative-names: , CAS# 1784751-19-4, Formula: C20H13F2N3, MWT: 333.3341, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SCR-1481B1, Alternative-names: c-Met inhibitor 2, CAS# 1174161-86-4, Formula: C28H29ClF2N5O10P, MWT: 699.981, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR;VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
Tubercidin, Alternative-names: 7-Deazaadenosine, CAS# 69-33-0, Formula: C11H14N4O4, MWT: 266.2533, Solubility: DMSO: ≥ 30 mg/mL
, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TAK-220, Alternative-names: , CAS# 333994-00-6, Formula: C31H41ClN4O3, MWT: 553.1353, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 4-IBP, Alternative-names: , CAS# 155798-08-6, Formula: C19H21IN2O, MWT: 420.2873, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Sigma Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tenovin-3, Alternative-names: , CAS# 1011301-27-1, Formula: C18H21N3OS, MWT: 327.4438, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| YYA-021, Alternative-names: , CAS# 144217-65-2, Formula: C18H27N3O2, MWT: 317.4259, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| OT-R antagonist 1, Alternative-names: Oxytocin receptor antagonist 1, CAS# 364071-17-0, Formula: C28H29N3O4, MWT: 471.5475, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Oxytocin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| OT-R antagonist 2, Alternative-names: Oxytocin receptor antagonist 2, CAS# 364071-16-9, Formula: C28H29N3O4, MWT: 471.5475, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Oxytocin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| FRAX1036, Alternative-names: , CAS# 1432908-05-8, Formula: C28H32ClN7O, MWT: 518.053, Solubility: DMSO: 5.3 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: PAK;PAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Iloprost, Alternative-names: Ciloprost;ZK 36374, CAS# 78919-13-8, Formula: C22H32O4, MWT: 360.4871, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| I-BRD9, Alternative-names: , CAS# 1714146-59-4, Formula: C22H22F3N3O3S2, MWT: 497.5536, Solubility: DMSO: 15.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| TA-01, Alternative-names: , CAS# 1784751-18-3, Formula: C20H12F3N3, MWT: 351.3246, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway;Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: p38 MAPK;Casein Kinase;Casein Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Briciclib, Alternative-names: ON 014185, CAS# 865783-99-9, Formula: C19H23O10PS, MWT: 474.4187, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage, Target: Eukaryotic Initiation Factor (eIF), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Taprenepag, Alternative-names: CP-544326, CAS# 752187-80-7, Formula: C24H22N4O5S, MWT: 478.5203, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ro 41-1049 (hydrochloride), Alternative-names: , CAS# 127917-66-2, Formula: C12H13ClFN3OS, MWT: 301.7675, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Itacitinib, Alternative-names: INCB039110, CAS# 1334298-90-6, Formula: C26H23F4N9O, MWT: 553.5142, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 3, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| 1-Deoxynojirimycin, Alternative-names: Duvoglustat, CAS# 19130-96-2, Formula: C6H13NO4, MWT: 163.1717, Solubility: H<sub>2</sub>O: ≥ 34 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Dihydroartemisinin, Alternative-names: β-Dihydroartemisinin;DHA;Dihydroqinghaosu, CAS# 71939-50-9, Formula: C15H24O5, MWT: 284.3481, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: MAPK/ERK Pathway;NF-κB, Target: JNK;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| Scutellarein, Alternative-names: 6-Hydroxyapigenin;4',5,6,7-Tetrahydroxyflavone, CAS# 529-53-3, Formula: C15H10O6, MWT: 286.2363, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Autophagy, Target: Src;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Pluripotin, Alternative-names: SC1, CAS# 839707-37-8, Formula: C27H25F3N8O2, MWT: 550.535, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 3, Pathway: MAPK/ERK Pathway, Target: Ribosomal S6 Kinase (RSK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| SKI II, Alternative-names: , CAS# 312636-16-1, Formula: C15H11ClN2OS, MWT: 302.7786, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: SPHK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Methoxatin (disodium salt), Alternative-names: Pyrroloquinolinequinone disodium salt, CAS# 122628-50-6, Formula: C14H4N2Na2O8, MWT: 374.1697, Solubility: H<sub>2</sub>O: 6.16 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| HLCL-61 (hydrochloride), Alternative-names: , CAS# 1158279-20-9, Formula: C23H25ClN2O, MWT: 380.9104, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| PI4KIIIbeta-IN-10, Alternative-names: , CAS# 1881233-39-1, Formula: C22H25N3O5S2, MWT: 475.581, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI4K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Sancycline, Alternative-names: Bonomycin;6-Demethyl-6-deoxytetracycline, CAS# 808-26-4, Formula: C21H22N2O7, MWT: 414.4086, Solubility: DMSO: 10 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Licochalcone A, Alternative-names: Licochalcone-A, CAS# 58749-22-7, Formula: C21H22O4, MWT: 338.397, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 1, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| D,L-3-Indolylglycine, Alternative-names: α-Amino-1H-indole-3-acetic acid, CAS# 6747-15-5, Formula: C10H10N2O2, MWT: 190.1986, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Synaptamide, Alternative-names: Docosahexaenoyl ethanolamide, CAS# 162758-94-3, Formula: C24H37NO2, MWT: 371.5561, Solubility: 10 mM in DMSO; Ethanol: 25 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Protein Tyrosine Kinase/RTK, Target: PKA;PKA, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| N-[(4-Aminophenyl)methyl]adenosine, Alternative-names: , CAS# 95523-13-0, Formula: C17H20N6O4, MWT: 372.3785, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SGI-7079, Alternative-names: , CAS# 1239875-86-5, Formula: C26H26FN7, MWT: 455.5299, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: TAM Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| G-5555, Alternative-names: , CAS# 1648863-90-4, Formula: C25H25ClN6O3, MWT: 492.9574, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: PAK;PAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| AZ6102, Alternative-names: , CAS# 1645286-75-4, Formula: C25H28N6O, MWT: 428.5294, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| JNJ-17203212, Alternative-names: , CAS# 821768-06-3, Formula: C17H15F6N5O, MWT: 419.3243, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Regadenoson, Alternative-names: CVT-3146, CAS# 313348-27-5, Formula: C15H18N8O5, MWT: 390.354, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Danshensu, Alternative-names: Dan shen suan A;Salvianic acid A, CAS# 76822-21-4, Formula: C9H10O5, MWT: 198.1727, Solubility: H<sub>2</sub>O: 6.2 mg/mL (Need ultrasonic or warming), Clinical_Information: No Development Reported, Pathway: Autophagy;NF-κB, Target: Autophagy;Keap1-Nrf2, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Salvianolic acid B, Alternative-names: Dan Shen Suan B;Lithospermic acid B, CAS# 121521-90-2, Formula: C36H30O16, MWT: 718.6138, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| BMS-3, Alternative-names: , CAS# 1338247-30-5, Formula: C17H12Cl2F2N4OS, MWT: 429.2712, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: LIM Kinase (LIMK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BMS-5, Alternative-names: LIMKI 3, CAS# 1338247-35-0, Formula: C17H14Cl2F2N4OS, MWT: 431.2871, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: LIM Kinase (LIMK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| R-268712, Alternative-names: , CAS# 879487-87-3, Formula: C20H18FN5O, MWT: 363.3882, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad, Target: TGF-β Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Galangin, Alternative-names: Norizalpinin;3,5,7-Trihydroxyflavone, CAS# 548-83-4, Formula: C15H10O5, MWT: 270.2369, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Metabolic Enzyme/Protease, Target: Autophagy;Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PI4KIIIbeta-IN-9, Alternative-names: , CAS# 1429624-84-9, Formula: C23H25N3O5S2, MWT: 487.5917, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI4K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| BMS-582949 (hydrochloride), Alternative-names: , CAS# 912806-16-7, Formula: C22H27ClN6O2, MWT: 442.9418, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Phase 2, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Emixustat (hydrochloride), Alternative-names: ACU-4429 hydrochloride, CAS# 1141934-97-5, Formula: C16H26ClNO2, MWT: 299.8362, Solubility: DMSO: ≥ 44 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Cetilistat, Alternative-names: ATL-962, CAS# 282526-98-1, Formula: C25H39NO3, MWT: 401.5821, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Compound 401, Alternative-names: , CAS# 168425-64-7, Formula: C16H15N3O2, MWT: 281.3092, Solubility: DMSO: 6 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;Cell Cycle/DNA Damage, Target: DNA-PK;DNA-PK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Duvelisib (R enantiomer), Alternative-names: IPI-145 R enantiomer;INK1197 R enantiomer, CAS# 1261590-48-0, Formula: C22H17ClN6O, MWT: 416.863, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TMS, Alternative-names: (E)-2,3',4,5'-tetramethoxystilbene, CAS# 24144-92-1, Formula: C18H20O4, MWT: 300.349, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Methyl linolenate, Alternative-names: Linolenic acid methyl ester, CAS# 301-00-8, Formula: C19H32O2, MWT: 292.4562, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| ML264, Alternative-names: , CAS# 1550008-55-3, Formula: C17H21ClN2O4S, MWT: 384.8777, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: KLF, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Fumarate hydratase-IN-1, Alternative-names: , CAS# 1644060-37-6, Formula: C27H30N2O4, MWT: 446.5381, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Debio 0932, Alternative-names: CUDC-305, CAS# 1061318-81-7, Formula: C22H30N6O2S, MWT: 442.5776, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Hesperidin, Alternative-names: Hesperetin 7-rutinoside, CAS# 520-26-3, Formula: C28H34O15, MWT: 610.5605, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Naringin, Alternative-names: Naringoside, CAS# 10236-47-2, Formula: C27H32O14, MWT: 580.5346, Solubility: DMSO: 6.2 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Autophagy;Metabolic Enzyme/Protease, Target: Autophagy;Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Castanospermine, Alternative-names: , CAS# 79831-76-8, Formula: C8H15NO4, MWT: 189.209, Solubility: H<sub>2</sub>O: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Celgosivir, Alternative-names: MDL 28574, CAS# 121104-96-9, Formula: C12H21NO5, MWT: 259.2988, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| BTZ043, Alternative-names: , CAS# 1161233-85-7, Formula: C17H16F3N3O5S, MWT: 431.3862496, Solubility: DMSO: 13.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| JI-101, Alternative-names: , CAS# 900573-88-8, Formula: C22H20BrN5O2, MWT: 466.3305, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: VEGFR;PDGFR;Ephrin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ONO-4059 (hydrochloride), Alternative-names: Tirabrutinib hydrochloride;GS-4059 hydrochloride, CAS# 1439901-97-9, Formula: C25H23ClN6O3, MWT: 490.9415, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| GDC-0084, Alternative-names: RG7666, CAS# 1382979-44-3, Formula: C18H22N8O2, MWT: 382.4197, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: Phase 1, Pathway: PI3K/Akt/mTOR;PI3K/Akt/mTOR, Target: PI3K;mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SCH 58261, Alternative-names: , CAS# 160098-96-4, Formula: C18H15N7O, MWT: 345.358, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| EL-102, Alternative-names: , CAS# 1233948-61-2, Formula: C19H16N2O3S2, MWT: 384.472, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| RS-1, Alternative-names: , CAS# 312756-74-4, Formula: C20H16Br2N2O3S, MWT: 524.2256, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CRISPR/Cas9, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| EPZ015866, Alternative-names: GSK591;GSK3203591, CAS# 1616391-87-7, Formula: C22H28N4O2, MWT: 380.4833, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Moxisylyte (hydrochloride), Alternative-names: Thymoxamine hydrochloride, CAS# 964-52-3, Formula: C16H26ClNO3, MWT: 315.8355, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| SCIO-469, Alternative-names: Talmapimod, CAS# 309913-83-5, Formula: C27H30ClFN4O3, MWT: 513.0035, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Apocynin, Alternative-names: Acetovanillone, CAS# 498-02-2, Formula: C9H10O3, MWT: 166.1739, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| CBR-5884, Alternative-names: , CAS# 681159-27-3, Formula: C14H12N2O4S2, MWT: 336.3861, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SPDP, Alternative-names: SPDP Crosslinker, CAS# 68181-17-9, Formula: C12H12N2O4S2, MWT: 312.3647, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| RSL3 (1S,3R-), Alternative-names: 1S,3R-RSL3, CAS# 1219810-16-8, Formula: C23H21ClN2O5, MWT: 440.8763, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Madrasin, Alternative-names: DDD00107587, CAS# 374913-63-0, Formula: C16H17N5O2, MWT: 311.3385, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Sitravatinib, Alternative-names: MGCD516;MG516, CAS# 1123837-84-2, Formula: C33H29F2N5O4S, MWT: 629.6763, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: c-Kit, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ML240, Alternative-names: , CAS# 1346527-98-7, Formula: C23H20N6O, MWT: 396.4445, Solubility: DMSO: 16.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: p97, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Oglufanide, Alternative-names: H-Glu-Trp-OH;L-Glutamyl-L-tryptophan, CAS# 38101-59-6, Formula: C16H19N3O5, MWT: 333.3392, Solubility: DMSO: 15.5 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Oxyresveratrol, Alternative-names: trans-Oxyresveratrol, CAS# 29700-22-9, Formula: C14H12O4, MWT: 244.2427, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Metabolic Enzyme/Protease, Target: Autophagy;Tyrosinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| HUHS015, Alternative-names: , CAS# 1453097-13-6, Formula: C19H18N4O, MWT: 318.3724, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Piceatannol, Alternative-names: Astringenin;trans-Piceatannol, CAS# 10083-24-6, Formula: C14H12O4, MWT: 244.2427, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Protein Tyrosine Kinase/RTK, Target: Autophagy;Syk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SB-366791, Alternative-names: , CAS# 472981-92-3, Formula: C16H14ClNO2, MWT: 287.7409, Solubility: DMSO: ≥ 39 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| KNK437, Alternative-names: , CAS# 218924-25-5, Formula: C13H11NO4, MWT: 245.2307, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| GSK1016790A, Alternative-names: , CAS# 942206-85-1, Formula: C28H32Cl2N4O6S2, MWT: 655.6129, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| IQ-1S (free acid), Alternative-names: , CAS# 23146-22-7, Formula: C15H9N3O, MWT: 247.2515, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: JNK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CAY10505, Alternative-names: , CAS# 1218777-13-9, Formula: C14H8FNO3S, MWT: 289.2816, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| SKF-96365 (hydrochloride), Alternative-names: , CAS# 130495-35-1, Formula: C22H27ClN2O3, MWT: 402.9144, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Autophagy, Target: TRP Channel;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MK-8745, Alternative-names: , CAS# 885325-71-3, Formula: C20H19ClFN5OS, MWT: 431.9142, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Epigenetics, Target: Aurora Kinase;Aurora Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Glucagon receptor antagonists-4, Alternative-names: , CAS# 1393124-08-7, Formula: C26H28F3N3O4, MWT: 503.5134, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Pentagastrin, Alternative-names: ICI-50123, CAS# 5534-95-2, Formula: C37H49N7O9S, MWT: 767.8915, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PK14105, Alternative-names: , CAS# 107257-28-3, Formula: C21H20FN3O3, MWT: 381.4002, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| M2I-1, Alternative-names: , CAS# 312271-03-7, Formula: C19H24N4O4S, MWT: 404.4832, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| CASIN, Alternative-names: , CAS# 425399-05-9, Formula: C20H22N2O, MWT: 306.4015, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Ras, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SR-3029, Alternative-names: , CAS# 1454585-06-8, Formula: C23H19F3N8O, MWT: 480.4452, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Cell Cycle/DNA Damage, Target: Casein Kinase;Casein Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Protirelin (Acetate), Alternative-names: TRF Acetate;TRH Acetate;TSH-RF Acetate, CAS# 120876-23-5, Formula: C16H22N6O4, MWT: 362.3837, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| CP21R7, Alternative-names: CP21, CAS# 125314-13-8, Formula: C19H15N3O2, MWT: 317.3413, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;PI3K/Akt/mTOR, Target: GSK-3;GSK-3, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Butein, Alternative-names: 2’,3,4,4’-tetrahydroxy Chalcone, CAS# 487-52-5, Formula: C15H12O5, MWT: 272.2528, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK;Autophagy, Target: EGFR;EGFR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| ONO-4059, Alternative-names: Tirabrutinib;GS-4059, CAS# 1351636-18-4, Formula: C25H22N6O3, MWT: 454.4806, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SPDB, Alternative-names: , CAS# 115088-06-7, Formula: C13H14N2O4S2, MWT: 326.3913, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Danshensu (sodium salt), Alternative-names: Sodium Danshensu;(±)-DanShenSu sodium sal, CAS# 67920-52-9, Formula: C9H9NaO5, MWT: 220.1545, Solubility: H<sub>2</sub>O: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| EW-7197, Alternative-names: Vactosertib, CAS# 1352608-82-2, Formula: C22H18FN7, MWT: 399.4236, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: TGF-beta/Smad, Target: TGF-β Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Oxaceprol, Alternative-names: N-Acetyl-L-hydroxyproline, CAS# 33996-33-7, Formula: C7H11NO4, MWT: 173.1665, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| MP-A08, Alternative-names: , CAS# 219832-49-2, Formula: C27H25N3O4S2, MWT: 519.6351, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: SPHK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| ML281, Alternative-names: , CAS# 1404437-62-2, Formula: C22H19N3O2S, MWT: 389.4702, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| GSK2269557 (free base), Alternative-names: Nemiralisib, CAS# 1254036-71-9, Formula: C26H28N6O, MWT: 440.5401, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 2, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SHP099, Alternative-names: , CAS# 1801747-42-1, Formula: C16H19Cl2N5, MWT: 352.2616, Solubility: DMSO: 6.4 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Discoidin Domain Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| SHP099 (hydrochloride), Alternative-names: , CAS# 1801747-11-4, Formula: C16H20Cl3N5, MWT: 388.7225, Solubility: DMSO: 4.1 mg/mL; H<sub>2</sub>O: 7.69 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Discoidin Domain Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 23-Hydroxybetulinic acid, Alternative-names: Anemosapogenin, CAS# 85999-40-2, Formula: C30H48O4, MWT: 472.6997, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Hypericin, Alternative-names: , CAS# 548-04-9, Formula: C30H16O8, MWT: 504.4432, Solubility: DMSO: 6.2 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Brevianamide F, Alternative-names: Cyclo(L-Pro-L-Trp), CAS# 38136-70-8, Formula: C16H17N3O2, MWT: 283.3251, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| 2,3,5,4'-Tetrahydroxystilbene 2-O-β-D-glucoside, Alternative-names: 2,3,4',5-Tetrahydroxystilbene 2-O-D-glucoside, CAS# 82373-94-2, Formula: C20H22O9, MWT: 406.38328, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| alpha-Hederin, Alternative-names: α-Hederin, CAS# 27013-91-8, Formula: C41H66O12, MWT: 750.95554, Solubility: 10 mM in DMSO; H<sub>2</sub>O: < 0.1 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Hederacoside C, Alternative-names: Kalopanaxsaponin B, CAS# 14216-03-6, Formula: C59H96O26, MWT: 1221.378, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Pulchinenoside A, Alternative-names: Anemoside A3, CAS# 129724-84-1, Formula: C41H66O12, MWT: 750.95554, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Pulchinenoside C, Alternative-names: Anemoside B4, CAS# 129741-57-7, Formula: C59H96O26, MWT: 1221.378, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BQ-123, Alternative-names: , CAS# 136553-81-6, Formula: C31H42N6O7, MWT: 610.7012, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Endothelin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Avasimibe, Alternative-names: CI-1011;PD-148515, CAS# 166518-60-1, Formula: C29H43NO4S, MWT: 501.72102, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| PF-04979064, Alternative-names: , CAS# 1220699-06-8, Formula: C24H26N6O3, MWT: 446.5016, Solubility: DMSO: 11 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;PI3K/Akt/mTOR, Target: PI3K;mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MRK-016, Alternative-names: , CAS# 342652-67-9, Formula: C17H20N8O2, MWT: 368.3931, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ALS-8176, Alternative-names: ALS-008176;Lumicitabine, CAS# 1445385-02-3, Formula: C18H25ClFN3O6, MWT: 433.859, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Anti-infection, Target: RSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tetrabenazine (Racemate), Alternative-names: Ro 1-9569 Racemate, CAS# 718635-93-9, Formula: C19H27NO3, MWT: 317.4226, Solubility: DMSO: ≥ 3.1 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Monoamine Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| HC-067047, Alternative-names: , CAS# 883031-03-6, Formula: C26H28F3N3O2, MWT: 471.5146, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bexagliflozin, Alternative-names: EGT1442;EGT0001442;THR-1442, CAS# 1118567-05-7, Formula: C24H29ClO7, MWT: 464.9359, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: SGLT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| E4CPG, Alternative-names: , CAS# 170846-89-6, Formula: C11H13NO4, MWT: 223.2252, Solubility: DMSO: < 5.8 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DMCM (hydrochloride), Alternative-names: , CAS# 1215833-62-7, Formula: C17H19ClN2O4, MWT: 350.7968, Solubility: H<sub>2</sub>O: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Phillygenin, Alternative-names: Phillygenol;Epipinoresinol methyl ether;Forsythigenol;(+)-Phillygenin, CAS# 487-39-8, Formula: C21H24O6, MWT: 372.4117, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GNF-6231, Alternative-names: , CAS# 1243245-18-2, Formula: C24H25FN6O2, MWT: 448.4927, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Porcupine, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| F16, Alternative-names: , CAS# 36098-33-6, Formula: C16H15IN2, MWT: 362.2082, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| (RS)-MCPG, Alternative-names: (¡À)-MCP, CAS# 146669-29-6, Formula: C10H11NO4, MWT: 209.1986, Solubility: DMSO: 6 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| GSK'481, Alternative-names: GSK481, CAS# 1622849-58-4, Formula: C21H19N3O4, MWT: 377.3932, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: RIP kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Ezutromid, Alternative-names: SMT C1100;BMN 195;VOX-C1100, CAS# 945531-77-1, Formula: C19H15NO3S, MWT: 337.3923, Solubility: DMSO: 10 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| TPO agonist 1, Alternative-names: , CAS# 1033040-23-1, Formula: C25H22N8O2, MWT: 466.4946, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Thrombopoietin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Cynaroside, Alternative-names: Luteolin 7-glucoside;Luteolin 7-O-β-D-glucoside, CAS# 5373-11-5, Formula: C21H20O11, MWT: 448.3769, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tosufloxacin (tosylate hydrate), Alternative-names: A-61827 tosylate hydrate, CAS# 1400591-39-0, Formula: C26H25F3N4O7S, MWT: 594.5595, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Biotin NHS, Alternative-names: Biotin-NHS;Biotin N-hydroxysuccinimide ester;NHS-Biotin, CAS# 35013-72-0, Formula: C14H19N3O5S, MWT: 341.3828, Solubility: DMSO: ≥ 3.4 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Zotarolimus, Alternative-names: ABT-578;A 179578, CAS# 221877-54-9, Formula: C52H79N5O12, MWT: 966.21, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Homatropine (methylbromide), Alternative-names: Homatropine methobromide, CAS# 80-49-9, Formula: C17H24BrNO3, MWT: 370.2814, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Nigericin (sodium salt), Alternative-names: Sodium Nigericin, CAS# 28643-80-3, Formula: C40H67NaO11, MWT: 746.9432, Solubility: 10 mM in ethanol; DMSO: < 0.3 mg/mL; H<sub>2</sub>O: < 0.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| BI-78D3, Alternative-names: , CAS# 883065-90-5, Formula: C13H9N5O5S2, MWT: 379.37106, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: JNK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PHCCC, Alternative-names: , CAS# 179068-02-1, Formula: C17H14N2O3, MWT: 294.3047, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Dapiprazole (hydrochloride), Alternative-names: , CAS# 72822-13-0, Formula: C19H28ClN5, MWT: 361.9121, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| IQ-1, Alternative-names: , CAS# 331001-62-8, Formula: C21H22N4O2, MWT: 362.42498, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| LOXO-101, Alternative-names: ARRY-470;Larotrectinib, CAS# 1223403-58-4, Formula: C21H22F2N6O2, MWT: 428.4352, Solubility: DMSO: ≥ 4.6 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Trk Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PD168393, Alternative-names: , CAS# 194423-15-9, Formula: C17H13BrN4O, MWT: 369.2153, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK;Autophagy, Target: EGFR;EGFR;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| AZ876, Alternative-names: , CAS# 898800-26-5, Formula: C24H29N3O3S, MWT: 439.5704, Solubility: DMSO: ≥ 2.6 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: LXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| AZD0865, Alternative-names: Linaprazan, CAS# 248919-64-4, Formula: C21H26N4O2, MWT: 366.4567, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: Proton Pump, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| UKI-1, Alternative-names: UKI-1C, CAS# 220355-63-5, Formula: C32H47N5O5S, MWT: 613.8111, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Bretylium (tosylate), Alternative-names: , CAS# 61-75-6, Formula: C18H24BrNO3S, MWT: 414.3571, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Adomeglivant, Alternative-names: LY2409021, CAS# 1488363-78-5, Formula: C32H36F3NO4, MWT: 555.6277, Solubility: DMSO: ≥ 5.3 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BH3I-1, Alternative-names: BHI1;BH 3I1, CAS# 300817-68-9, Formula: C15H14BrNO3S2, MWT: 400.3105, Solubility: DMSO: ≥ 3.9 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Bcl-2 Family, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| SMER28, Alternative-names: , CAS# 307538-42-7, Formula: C11H10BrN3, MWT: 264.1212, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| FCCP, Alternative-names: Carbonyl cyanide 4-(trifluoromethoxy)phenylhydrazone, CAS# 370-86-5, Formula: C10H5F3N4O, MWT: 254.1681, Solubility: DMSO: ≥ 2.6 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| N-Acetylneuraminic acid, Alternative-names: NANA;Lactaminic acid, CAS# 131-48-6, Formula: C11H19NO9, MWT: 309.2699, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Alprenolol, Alternative-names: (RS)-Alprenolol;dl-Alprenolol, CAS# 13655-52-2, Formula: C15H23NO2, MWT: 249.3486, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Alprenolol (hydrochloride), Alternative-names: (RS)-Alprenolol hydrochloride;dl-Alprenolol hydrochloride, CAS# 13707-88-5, Formula: C15H24ClNO2, MWT: 285.8096, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| GSK-2881078, Alternative-names: , CAS# 1539314-06-1, Formula: C14H13F3N2O2S, MWT: 330.3254, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Bromfenac (sodium hydrate), Alternative-names: Bromfenac monosodium salt sesquihydrate, CAS# 120638-55-3, Formula: C15H15BrNNaO4.5+, MWT: 384.1768207, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tubacin, Alternative-names: , CAS# 537049-40-4, Formula: C41H43N3O7S, MWT: 721.86102, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TCV-309 (chloride), Alternative-names: , CAS# 121494-09-5, Formula: C30H34BrClN4O4, MWT: 629.9724, Solubility: DMSO: ≥ 6.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Sapropterin (dihydrochloride), Alternative-names: 6R-BH4 dihydrochloride;6R-Tetrahydro-L-biopterin dihydrochloride, CAS# 69056-38-8, Formula: C9H17Cl2N5O3, MWT: 314.169, Solubility: H<sub>2</sub>O: ≥ 34 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tramiprosate, Alternative-names: Homotaurine;3-Amino-1-propanesulfonic acid, CAS# 3687-18-1, Formula: C3H9NO3S, MWT: 139.1735, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Neuronal Signaling, Target: Amyloid-β, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
Argipressin, Alternative-names: Vasopressin;Arg8-vasopressin;AVP, CAS# 113-79-1, Formula: C46H65N15O12S2, MWT: 1084.232, Solubility: H<sub>2</sub>O: ≥ 360 mg/mL
, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
Cyclic somatostatin, Alternative-names: SRIF-14;Somatostatin-14, CAS# 38916-34-6, Formula: C76H104N18O19S2, MWT: 1637.878, Solubility: H<sub>2</sub>O: 71.3 mg/mL (Need ultrasonic and warming)
, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NVP-BAW2881, Alternative-names: BAW2881, CAS# 861875-60-7, Formula: C22H15F3N4O2, MWT: 424.3753, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Triptorelin, Alternative-names: [DTrp6]-LH-RH, CAS# 57773-63-4, Formula: C64H82N18O13, MWT: 1311.44868, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Deslorelin, Alternative-names: H 4065, CAS# 57773-65-6, Formula: C64H83N17O12, MWT: 1282.45052, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
Nafarelin, Alternative-names: , CAS# 76932-56-4, Formula: C66H83N17O13, MWT: 1322.471, Solubility: H<sub>2</sub>O: ≥ 330 mg/mL
, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| CGP 25454A, Alternative-names: , CAS# 104391-26-6, Formula: C15H21Cl2N3O2, MWT: 346.2521, Solubility: DMSO: ≥ 3.5 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Dopamine Receptor;Dopamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| MK-4101, Alternative-names: , CAS# 935273-79-3, Formula: C24H24F5N5O, MWT: 493.4723, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Smo, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Epetraborole (hydrochloride), Alternative-names: GSK2251052 hydrochloride;GSK-2251052 hydrochloride;GSK 2251052 hydrochloride, CAS# 1234563-16-6, Formula: C11H17BClNO4, MWT: 273.521, Solubility: H<sub>2</sub>O: ≥ 28 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ro 67-7476, Alternative-names: , CAS# 298690-60-5, Formula: C17H18FNO2S, MWT: 319.3937, Solubility: DMSO: ≥ 40 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| IMR-1A, Alternative-names: , CAS# 331862-41-0, Formula: C13H11NO5S2, MWT: 325.3601, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Notch, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| IMR-1, Alternative-names: , CAS# 310456-65-6, Formula: C15H15NO5S2, MWT: 353.4133, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Notch, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| FPTQ, Alternative-names: , CAS# 864863-72-9, Formula: C17H12FN5, MWT: 305.3091, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MK-886, Alternative-names: L 663536, CAS# 118414-82-7, Formula: C27H34ClNO2S, MWT: 472.08236, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: FLAP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SAR405, Alternative-names: , CAS# 1523406-39-4, Formula: C19H21ClF3N5O2, MWT: 443.8506, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;Autophagy, Target: PI3K;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| CFMTI, Alternative-names: , CAS# 864864-17-5, Formula: C19H16FN5O, MWT: 349.3616, Solubility: DMSO: 6.2 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| P7C3-A20, Alternative-names: , CAS# 1235481-90-9, Formula: C22H19Br2FN2O, MWT: 506.2055, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| P7C3, Alternative-names: , CAS# 301353-96-8, Formula: C21H18Br2N2O, MWT: 474.1884, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Nampt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| A-804598, Alternative-names: , CAS# 1125758-85-1, Formula: C19H17N5, MWT: 315.37178, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: P2X Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TCS-OX2-29, Alternative-names: , CAS# 372523-75-6, Formula: C23H31N3O3, MWT: 397.5105, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Orexin Receptor (OX Receptor), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Isoginkgetin, Alternative-names: , CAS# 548-19-6, Formula: C32H22O10, MWT: 566.5111, Solubility: DMSO: ≥83.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Podocarpusflavone A, Alternative-names: , CAS# 22136-74-9, Formula: C31H20O10, MWT: 552.4845, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Sotetsuflavone, Alternative-names: , CAS# 2608-21-1, Formula: C31H20O10, MWT: 552.4845, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BTTAA, Alternative-names: , CAS# 1334179-85-9, Formula: C19H30N10O2, MWT: 430.5073, Solubility: H<sub>2</sub>O: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Calcitonin (salmon), Alternative-names: Salmon calcitonin, CAS# 47931-85-1, Formula: C145H240N44O48S2, MWT: 3431.853, Solubility: H<sub>2</sub>O: ≥ 50 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SIS3, Alternative-names: , CAS# 521984-48-5, Formula: C28H28ClN3O3, MWT: 489.9932, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;TGF-beta/Smad, Target: TGF-beta/Smad;TGF-beta/Smad, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Terlipressin, Alternative-names: , CAS# 14636-12-5, Formula: C52H74N16O15S2, MWT: 1227.372, Solubility: DMSO: ≥ 12.3 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Vasopressin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Teriparatide, Alternative-names: PTH 1-34;hPTH (1-34);Human parathyroid hormone-(1-34), CAS# 52232-67-4, Formula: C181H291N55O51S2, MWT: 4117.72, Solubility: H<sub>2</sub>O: ≥ 50 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Latrepirdine (dihydrochloride), Alternative-names: Dimebolin dihydrochloride, CAS# 97657-92-6, Formula: C21H27Cl2N3, MWT: 392.3652, Solubility: DMSO: 6.4 mg/mL (Need warming), Clinical_Information: Launched, Pathway: Autophagy;Epigenetics;PI3K/Akt/mTOR, Target: Autophagy;AMPK;AMPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Sermorelin, Alternative-names: GHRH (1-29);Growth Hormone Releasing Factor Fragment 1-29 amide human, CAS# 86168-78-7, Formula: C149H246N44O42S, MWT: 3357.88214, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Tetracosactide, Alternative-names: Tetracosactrin, CAS# 16960-16-0, Formula: C136H210N40O31S, MWT: 2933.437, Solubility: H<sub>2</sub>O: ≥ 50 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TBHQ, Alternative-names: tert-Butylhydroquinone, CAS# 1948-33-0, Formula: C10H14O2, MWT: 166.217, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| EPZ031686, Alternative-names: , CAS# 1808011-22-4, Formula: C26H34ClF3N4O4S, MWT: 591.0858, Solubility: DMSO: ≥ 5.9 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| OICR-9429, Alternative-names: , CAS# 1801787-56-3, Formula: C29H32F3N5O3, MWT: 555.5913, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| PBTZ169, Alternative-names: , CAS# 1377239-83-2, Formula: C20H23F3N4O3S, MWT: 456.4818296, Solubility: DMSO: 6.4 mg/mL (Need ultrasonic), Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| HO-3867, Alternative-names: , CAS# 1172133-28-6, Formula: C28H30F2N2O2, MWT: 464.5468, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tunicamycin, Alternative-names: , CAS# 11089-65-9, Formula: C39H64N4O16 (n=10), MWT: 1000, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Val-Cit-PAB-MMAE, Alternative-names: , CAS# 644981-35-1, Formula: C58H94N10O12, MWT: 1123.427, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| EMA401, Alternative-names: Olodanrigan, CAS# 1316755-16-4, Formula: C32H29NO5, MWT: 507.5764, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| CCF642, Alternative-names: , CAS# 346640-08-2, Formula: C15H10N2O4S3, MWT: 378.4459, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Imazamox, Alternative-names: CL29926;(±)-Imazamox, CAS# 114311-32-9, Formula: C15H19N3O4, MWT: 305.3291, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NS-018 (maleate), Alternative-names: , CAS# 1354799-87-3, Formula: C25H24FN7O4, MWT: 505.501, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 2, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Lecirelin, Alternative-names: , CAS# 61012-19-9, Formula: C59H84N16O12, MWT: 1209.398, Solubility: DMSO: 12.1 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
Angiotensin II 5-valine, Alternative-names: Valine angiotensin II;5-L-Valine angiotensin II, CAS# 58-49-1, Formula: C49H69N13O12, MWT: 1032.152, Solubility: H<sub>2</sub>O: ≥ 257.5 mg/mL
, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Angiotensin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
Eledoisin, Alternative-names: Eledone peptide, CAS# 69-25-0, Formula: C54H85N13O15S, MWT: 1188.396, Solubility: H<sub>2</sub>O: 18.15 mg/mL (Need ultrasonic and warming)
, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Lixisenatide, Alternative-names: , CAS# 320367-13-3, Formula: C215H347N61O65S, MWT: 4858.49, Solubility: H<sub>2</sub>O, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Histamine (phosphate), Alternative-names: Histamine diphosphate, CAS# 51-74-1, Formula: C5H15N3O8P2, MWT: 307.1354, Solubility: H<sub>2</sub>O: ≥ 42 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Scopoletin, Alternative-names: Gelseminic acid;Chrysatropic acid, CAS# 92-61-5, Formula: C10H8O4, MWT: 192.1681, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway;NF-κB, Target: p38 MAPK;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Gracillin, Alternative-names: , CAS# 19083-00-2, Formula: C45H72O17, MWT: 885.043, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Rebaudioside A, Alternative-names: , CAS# 58543-16-1, Formula: C44H70O23, MWT: 967.0128, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
Betulonic acid, Alternative-names: Betunolic acid;Liquidambaric acid;(+)-Betulonic acid, CAS# 4481-62-3, Formula: C30H46O3, MWT: 454.6844, Solubility: 10 mM in DMSO
, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Oleanonic acid, Alternative-names: 3-Oxooleanolic acid, CAS# 17990-42-0, Formula: C30H46O3, MWT: 454.6844, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
Ursonic acid, Alternative-names: 3-Ketoursolic acid, CAS# 6246-46-4, Formula: C30H46O3, MWT: 454.6844, Solubility: DMSO: 10 mg/mL
, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| trans-Trimethoxyresveratrol, Alternative-names: trans-trismethoxy Resveratrol;E-Resveratrol Trimethyl Ether;Tri-O-methylresveratrol, CAS# 22255-22-7, Formula: C17H18O3, MWT: 270.323, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| 7,4'-Di-O-methylapigenin, Alternative-names: 4',7-Dimethoxy-5-Hydroxyflavone, CAS# 5128-44-9, Formula: C17H14O5, MWT: 298.2901, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 4',7-Dimethoxyisoflavone, Alternative-names: Dimethoxydaidzein, CAS# 1157-39-7, Formula: C17H14O4, MWT: 282.2906, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Imperatorin, Alternative-names: Ammidin, CAS# 482-44-0, Formula: C16H14O4, MWT: 270.28, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: TRP Channel;AChE, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Isoimperatorin, Alternative-names: , CAS# 482-45-1, Formula: C16H14O4, MWT: 270.28, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: AChE, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Lasmiditan (hydrochloride), Alternative-names: LY 573144 hydrochloride;COL-144 hydrochloride, CAS# 613677-28-4, Formula: C19H19ClF3N3O2, MWT: 413.8213, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 3, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Lenampicillin (hydrochloride), Alternative-names: KBT 1585 hydrochloride, CAS# 80734-02-7, Formula: C21H24ClN3O7S, MWT: 497.9492, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Mertansine, Alternative-names: DM1;Maytansinoid DM1, CAS# 139504-50-0, Formula: C35H48ClN3O10S, MWT: 738.28772, Solubility: DMSO: ≥ 83.33 mg/mL, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;Cytoskeleton;Antibody-drug Conjugate/ADC Related, Target: Microtubule/Tubulin;Microtubule/Tubulin;Drug-Linker Conjugates for ADC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Rubusoside, Alternative-names: , CAS# 64849-39-4, Formula: C32H50O13, MWT: 642.7316, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bay 59-3074, Alternative-names: , CAS# 406205-74-1, Formula: C18H13F6NO4S, MWT: 453.3555, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| LY3039478, Alternative-names: Crenigacestat, CAS# 1421438-81-4, Formula: C22H23F3N4O4, MWT: 464.4376, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 2, Pathway: Stem Cell/Wnt, Target: Notch, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tat-NR2B9c, Alternative-names: , CAS# 500992-11-0, Formula: C105H188N42O30, MWT: 2518.88, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BAY-876, Alternative-names: , CAS# 1799753-84-6, Formula: C24H16F4N6O2, MWT: 496.4164, Solubility: DMSO: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Fatostatin A, Alternative-names: 125B11, CAS# 125256-00-0, Formula: C18H18N2S, MWT: 294.4139, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Benzenepentacarboxylic Acid, Alternative-names: Pentacarboxybenzene, CAS# 1585-40-6, Formula: C11H6O10, MWT: 298.1593, Solubility: DMSO: ≥ 48 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| CL-82198, Alternative-names: , CAS# 307002-71-7, Formula: C17H22N2O3, MWT: 302.3682, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Pleuromutilin, Alternative-names: Drosophilin B;Mutilin 14-glycolate, CAS# 125-65-5, Formula: C22H34O5, MWT: 378.5023, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Hexaconazole, Alternative-names: (-)-Hexaconazol, CAS# 79983-71-4, Formula: C14H17Cl2N3O, MWT: 314.2103, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| Mivebresib, Alternative-names: ABBV-075, CAS# 1445993-26-9, Formula: C22H19F2N3O4S, MWT: 459.4658, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: Phase 1, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Benzophenonetetracarboxylic acid, Alternative-names: 3,3',4,4'-Benzophenonetetracarboxylic acid, CAS# 2479-49-4, Formula: C17H10O9, MWT: 358.2559, Solubility: H<sub>2</sub>O: 7.2 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| (+)-DHMEQ, Alternative-names: (1R,2R,6R)-Dehydroxymethylepoxyquinomicin;(1R,2R,6R)-DHMEQ, CAS# 287194-41-6, Formula: C13H11NO5, MWT: 261.2301, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| XMU-MP-1, Alternative-names: , CAS# 2061980-01-4, Formula: C17H16N6O3S2, MWT: 416.4773, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Hippo (MST), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Chebulinic acid, Alternative-names: , CAS# 18942-26-2, Formula: C41H32O27, MWT: 956.67658, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Stem Cell/Wnt;TGF-beta/Smad;Cell Cycle/DNA Damage, Target: Proton Pump;TGF-beta/Smad;TGF-beta/Smad;DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Chebulagic acid, Alternative-names: , CAS# 23094-71-5, Formula: C41H30O27, MWT: 954.6607, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
Tomatidine, Alternative-names: , CAS# 77-59-8, Formula: C27H45NO2, MWT: 415.6517, Solubility: 10 mM in DMSO
, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway;NF-κB, Target: JNK;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| K03861, Alternative-names: , CAS# 853299-07-7, Formula: C24H26F3N7O2, MWT: 501.5041496, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Verubecestat, Alternative-names: MK-8931, CAS# 1286770-55-5, Formula: C17H17F2N5O3S, MWT: 409.4104, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Phase 3, Pathway: Neuronal Signaling, Target: Beta-secretase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SZL P1-41, Alternative-names: , CAS# 222716-34-9, Formula: C24H24N2O3S, MWT: 420.524, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: E1/E2/E3 Enzyme, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| HA15, Alternative-names: , CAS# 1609402-14-3, Formula: C23H22N4O3S2, MWT: 466.5758, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Tetrabenazine ((+)-), Alternative-names: (+)-Tetrabenazine;(+)-TBZ;(3R,11bR)-TBZ;(3R,11bR)-Tetrabenazine, CAS# 1026016-83-0, Formula: C19H27NO3, MWT: 317.4226, Solubility: DMSO: ≥ 3.2 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Monoamine Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Eleclazine (hydrochloride), Alternative-names: GS 6615 hydrochloride, CAS# 1448754-43-5, Formula: C21H17ClF3N3O3, MWT: 451.8262, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| LY2365109 (hydrochloride), Alternative-names: , CAS# 1779796-27-8, Formula: C22H28ClNO5, MWT: 421.9144, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GlyT;GlyT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BEC (hydrochloride), Alternative-names: , CAS# 222638-67-7, Formula: C5H13BClNO4S, MWT: 229.49, Solubility: H<sub>2</sub>O: ≥ 35 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Madecassoside, Alternative-names: Asiaticoside A, CAS# 34540-22-2, Formula: C48H78O20, MWT: 975.1209, Solubility: DMSO: ≥ 9.8 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Cyproconazole, Alternative-names: , CAS# 94361-06-5, Formula: C15H18ClN3O, MWT: 291.7759, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| DprE1-IN-2, Alternative-names: , CAS# 1615713-87-5, Formula: C19H24N6O2, MWT: 368.4329, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| EAI045, Alternative-names: , CAS# 1942114-09-1, Formula: C19H14FN3O3S, MWT: 383.3961, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Fertirelin, Alternative-names: , CAS# 38234-21-8, Formula: C55H76N16O12, MWT: 1153.292, Solubility: DMSO: ≥ 11.5 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Felypressin, Alternative-names: Octapressin;PLV-2, CAS# 56-59-7, Formula: C46H65N13O11S2, MWT: 1040.219, Solubility: DMSO: ≥ 10.4 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
Lysipressin, Alternative-names: Lypressin;Lysine vasopressin;[Lys8]-Vasopressin, CAS# 50-57-7, Formula: C46H65N13O12S2, MWT: 1056.218, Solubility: H<sub>2</sub>O: 353.33 mg/mL
, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Ornipressin, Alternative-names: POR-8, CAS# 3397-23-7, Formula: C45H63N13O12S2, MWT: 1042.192, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Ruboxistaurin (hydrochloride), Alternative-names: LY 333531 hydrochloride, CAS# 169939-93-9, Formula: C28H29ClN4O3, MWT: 505.0079, Solubility: DMSO: 6.8 mg/mL (Need ultrasonic and warming), Clinical_Information: Phase 3, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| eFT508, Alternative-names: , CAS# 1849590-01-7, Formula: C17H20N6O2, MWT: 340.3797, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: Phase 2, Pathway: MAPK/ERK Pathway, Target: MNK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| FT011, Alternative-names: , CAS# 1001288-58-9, Formula: C20H17NO5, MWT: 351.3527, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Cetrorelix (Acetate), Alternative-names: SB-075 acetate;NS-75A, CAS# 145672-81-7, Formula: C72H96ClN17O16, MWT: 1491.09, Solubility: H<sub>2</sub>O: 5 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BMS-986020, Alternative-names: AM152, CAS# 1257213-50-5, Formula: C29H26N2O5, MWT: 482.5271, Solubility: DMSO: ≥ 64 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Inosine, Alternative-names: , CAS# 58-63-9, Formula: C10H12N4O5, MWT: 268.2261, Solubility: DMSO: 9.66 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| GSK6853, Alternative-names: , CAS# 1910124-24-1, Formula: C22H27N5O3, MWT: 409.4815, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Neferine, Alternative-names: (-)-Neferine, CAS# 2292-16-2, Formula: C38H44N2O6, MWT: 624.7657, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy;NF-κB, Target: Autophagy;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| DFMTI, Alternative-names: MK5435, CAS# 864864-86-8, Formula: C20H18F2N4O, MWT: 368.3799, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pristinamycin IA, Alternative-names: Mikamycin B;Mikamycin IA, CAS# 3131-03-1, Formula: C45H54N8O10, MWT: 866.9579, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Necrosulfonamide, Alternative-names: , CAS# 1360614-48-7, Formula: C18H15N5O6S2, MWT: 461.4716, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: Mixed Lineage Kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GNE-3511, Alternative-names: , CAS# 1496581-76-0, Formula: C23H26F2N6O, MWT: 440.489, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| trans-ACPD, Alternative-names: Trans-(±)-ACP, CAS# 67684-64-4, Formula: C7H11NO4, MWT: 173.16654, Solubility: H<sub>2</sub>O: 6.2 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| ITSA-1, Alternative-names: , CAS# 200626-61-5, Formula: C13H7Cl2N3O, MWT: 292.1202, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Nanchangmycin, Alternative-names: Nanchangmycin A, CAS# 65101-87-3, Formula: C47H77NaO14, MWT: 889.0956, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Ganoderic acid A, Alternative-names: , CAS# 81907-62-2, Formula: C30H44O7, MWT: 516.6661, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Revizinone, Alternative-names: R80122, CAS# 133718-29-3, Formula: C26H29N5O3, MWT: 459.5402, Solubility: DMSO: ≥ 4.6 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| R 80123, Alternative-names: , CAS# 133718-30-6, Formula: C26H29N5O3, MWT: 459.5402, Solubility: 10 mM in H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Triethanolamine, Alternative-names: Trolamine;TEA;TEOA, CAS# 102-71-6, Formula: C6H15NO3, MWT: 149.1882, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| R1487 (Hydrochloride), Alternative-names: R-1487 Hydrochloride;R 1487 Hydrochloride, CAS# 449808-64-4, Formula: C19H19ClF2N4O3, MWT: 424.829, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| MS049, Alternative-names: , CAS# 1502816-23-0, Formula: C15H24N2O, MWT: 248.3639, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BRD9539, Alternative-names: , CAS# 1374601-41-8, Formula: C24H21N3O3, MWT: 399.4418, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| CCT245737, Alternative-names: , CAS# 1489389-18-5, Formula: C16H16F3N7O, MWT: 379.3397496, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Checkpoint Kinase (Chk), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| o-Dianisidine (dihydrochloride), Alternative-names: 3,3'-Dimethoxybenzidine dihydrochloride;C.I. Disperse Black 6 dihydrochloride, CAS# 20325-40-0, Formula: C14H18Cl2N2O2, MWT: 317.2109, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25g |
| Stibogluconate (sodium), Alternative-names: Sodium stibogluconate, CAS# 16037-91-5, Formula: C12H38Na3O26Sb2 3+, MWT: 910.9021821, Solubility: H<sub>2</sub>O: 550 mg/mL (Need warming); DMSO: < 9.1 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| Delamanid, Alternative-names: OPC-67683, CAS# 681492-22-8, Formula: C25H25F3N4O6, MWT: 534.4844, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| PSI-697, Alternative-names: P-Selectin Inhibitor, CAS# 851546-61-7, Formula: C21H18ClNO3, MWT: 367.8255, Solubility: DMSO: ≥ 45.8 mg/mL, Clinical_Information: Phase 1, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| WST-8, Alternative-names: , CAS# 193149-74-5, Formula: C20H14N6NaO11S2+, MWT: 601.478, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| APS-2-79, Alternative-names: , CAS# 2002381-25-9, Formula: C23H21N3O3, MWT: 387.4312, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| CCG215022, Alternative-names: , CAS# 1813527-81-9, Formula: C26H22FN7O3, MWT: 499.4964, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Protein Tyrosine Kinase/RTK, Target: PKA;PKA, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| HMN-176, Alternative-names: , CAS# 173529-10-7, Formula: C20H18N2O4S, MWT: 382.4329, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Beclometasone, Alternative-names: Beclomethasone, CAS# 4419-39-0, Formula: C22H29ClO5, MWT: 408.9156, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Glucocorticoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Abarelix, Alternative-names: R3827;PPI 149, CAS# 183552-38-7, Formula: C72H95ClN14O14, MWT: 1416.0631, Solubility: DMSO: ≥ 14.2 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| JNJ16259685, Alternative-names: , CAS# 409345-29-5, Formula: C20H23NO3, MWT: 325.4015, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| IC87201, Alternative-names: , CAS# 866927-10-8, Formula: C13H10Cl2N4O, MWT: 309.1507, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ceruletide, Alternative-names: Caerulein;Cerulein, CAS# 17650-98-5, Formula: C58H73N13O21S2, MWT: 1352.405, Solubility: H<sub>2</sub>O: ≥ 100 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Oxantel (pamoate), Alternative-names: Oxantel embonate, CAS# 68813-55-8, Formula: C36H32N2O7, MWT: 604.6485, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Fondaparinux (sodium), Alternative-names: Fondaparin sodium;SR-90107A, CAS# 114870-03-0, Formula: C31H44N3Na10O49S8+, MWT: 1729.08890422, Solubility: H<sub>2</sub>O: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease, Target: Factor Xa, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Stattic, Alternative-names: , CAS# 19983-44-9, Formula: C8H5NO4S, MWT: 211.1946, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| ZL006, Alternative-names: , CAS# 1181226-02-7, Formula: C14H11Cl2NO4, MWT: 328.1474, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Hemin, Alternative-names: Hemin chloride, CAS# 16009-13-5, Formula: C34H32ClFeN4O4, MWT: 651.9403, Solubility: DMSO: 6.6 mg/mL, Clinical_Information: Phase 2, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| TCS 401, Alternative-names: , CAS# 243966-09-8, Formula: C10H11ClN2O5S, MWT: 306.7227, Solubility: DMSO: 11 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Sinapine (thiocyanate), Alternative-names: , CAS# 7431-77-8, Formula: C17H24N2O5S, MWT: 368.4478, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Theaflavin, Alternative-names: , CAS# 4670-05-7, Formula: C29H24O12, MWT: 564.4937, Solubility: H<sub>2</sub>O: 2 mg/mL (Need ultrasonic and warming); DMSO: 1.42 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Influenza Virus, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| PRIMA-1, Alternative-names: , CAS# 5608-24-2, Formula: C9H15NO3, MWT: 185.2203, Solubility: DMSO: ≥ 44 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Apoptosis, Target: Autophagy;MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BI-7273, Alternative-names: , CAS# 1883429-21-7, Formula: C20H23N3O3, MWT: 353.4149, Solubility: DMSO: 10 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BI-9564, Alternative-names: , CAS# 1883429-22-8, Formula: C20H23N3O3, MWT: 353.4149, Solubility: DMSO: 7.2 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| AZD0156, Alternative-names: , CAS# 1821428-35-6, Formula: C26H31N5O3, MWT: 461.556, Solubility: DMSO: 6.2 mg/mL (Need ultrasonic and warming), Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage;PI3K/Akt/mTOR, Target: ATM/ATR;ATM/ATR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Sulconazole (nitrate), Alternative-names: (¡À)-Sulconazole nitrat, CAS# 82382-23-8, Formula: C18H16Cl3N3O3S, MWT: 460.76194, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| D-3263 (hydrochloride), Alternative-names: , CAS# 1008763-54-9, Formula: C21H32ClN3O3, MWT: 409.9501, Solubility: DMSO: ≥ 40 mg/mL, Clinical_Information: Phase 1, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Porcine dynorphin A(1-13), Alternative-names: Dynorphin A Porcine Fragment 1-13, CAS# 72957-38-1, Formula: C75H126N24O15, MWT: 1603.955, Solubility: H<sub>2</sub>O: ≥ 60 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Procyclidine (hydrochloride), Alternative-names: (¡À)-Procyclidine hydrochlorid, CAS# 1508-76-5, Formula: C19H30ClNO, MWT: 323.9006, Solubility: DMSO: 10.66 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Corticotropin-releasing factor (human), Alternative-names: Human CRF;Human corticotropin-releasing factor, CAS# 86784-80-7, Formula: C208H344N60O63S2, MWT: 4757.45, Solubility: H<sub>2</sub>O: 16.66 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Tipiracil, Alternative-names: , CAS# 183204-74-2, Formula: C9H11ClN4O2, MWT: 242.6622, Solubility: DMSO: < 0.05 mg/mL, Clinical_Information: Launched, Pathway: Apoptosis;Cell Cycle/DNA Damage, Target: Thymidylate Synthase;Nucleoside Antimetabolite/Analog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Corticotropin-releasing factor (ovine), Alternative-names: Ovine CRF;Ovine corticotropin-releasing factor;Corticorelin, CAS# 79804-71-0, Formula: C205H339N59O63S, MWT: 4670.31, Solubility: H<sub>2</sub>O: 16.66 mg/mL, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| FGFR4-IN-1, Alternative-names: , CAS# 1708971-72-5, Formula: C24H27N7O5, MWT: 493.5151, Solubility: DMSO: 6.4 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Thymosin beta 4, Alternative-names: Thymosin β4, CAS# 77591-33-4, Formula: C212H350N56O78S, MWT: 4963.44, Solubility: H<sub>2</sub>O: 40 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| RO9021, Alternative-names: , CAS# 1446790-62-0, Formula: C18H25N7O, MWT: 355.4374, Solubility: DMSO: < 3.6 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Syk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Thymalfasin, Alternative-names: Thymosin α1, CAS# 62304-98-7, Formula: C129H215N33O55, MWT: 3108.275, Solubility: H<sub>2</sub>O: 0.3 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| Human growth hormone-releasing factor, Alternative-names: Growth Hormone Releasing Factor human, CAS# 83930-13-6, Formula: C215H358N72O66S, MWT: 5039.65, Solubility: H<sub>2</sub>O: 25 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| Cecropin B, Alternative-names: , CAS# 80451-05-4, Formula: C176H302N52O41S, MWT: 3834.67, Solubility: H<sub>2</sub>O: 20 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Pymetrozine, Alternative-names: CGA 215944, CAS# 123312-89-0, Formula: C10H11N5O, MWT: 217.2272, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg |
| ABT-239, Alternative-names: , CAS# 460746-46-7, Formula: C22H22N2O, MWT: 330.4229, Solubility: DMSO: ≥ 3.3 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein;Membrane Transporter/Ion Channel, Target: Histamine Receptor;Histamine Receptor;TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| [D-Ala2]leucine-enkephalin, Alternative-names: Tyr-D-Ala-Gly-Phe-Leu, CAS# 64963-01-5, Formula: C29H39N5O7, MWT: 569.6492, Solubility: H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Shikonin, Alternative-names: C.I. 75535;Isoarnebin 4, CAS# 517-89-5, Formula: C16H16O5, MWT: 288.2952, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Chloride Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Sinensetin, Alternative-names: Pedalitin permethyl ether, CAS# 2306-27-6, Formula: C20H20O7, MWT: 372.3686, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;Apoptosis, Target: PGE synthase;TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Valbenazine, Alternative-names: NBI-98854, CAS# 1025504-45-3, Formula: C24H38N2O4, MWT: 418.5695, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Midecamycin, Alternative-names: SF-837;Antibiotic SF-837, CAS# 35457-80-8, Formula: C41H67NO15, MWT: 813.9684, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| RIP2 kinase inhibitor 2, Alternative-names: , CAS# 1581270-11-2, Formula: C21H28N4O4S, MWT: 432.5364, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: RIP kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Leukadherin-1, Alternative-names: , CAS# 344897-95-6, Formula: C22H15NO4S2, MWT: 421.4888, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Complement System, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| RIP2 kinase inhibitor 1, Alternative-names: , CAS# 1423186-80-4, Formula: C21H22N4O4S2, MWT: 458.5538, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: RIP kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Endoxifen (E-isomer), Alternative-names: E-Endoxifen, CAS# 114828-90-9, Formula: C25H27NO2, MWT: 373.4874, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SCD inhibitor 1, Alternative-names: , CAS# 1150701-66-8, Formula: C18H16Cl2N4O2, MWT: 391.2513, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Stearoyl-CoA Desaturase (SCD), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Endoxifen (hydrochloride), Alternative-names: , CAS# 1197194-41-4, Formula: C25H28ClNO2, MWT: 409.9483, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| amyloid P-IN-1, Alternative-names: , CAS# 1819986-22-5, Formula: C30H44N2O14, MWT: 656.6754, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Amyloid-β, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Relugolix, Alternative-names: TAK-385, CAS# 737789-87-6, Formula: C29H27F2N7O5S, MWT: 623.6304, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Lp-PLA2 -IN-1, Alternative-names: , CAS# 1420367-28-7, Formula: C21H17F5N4O3, MWT: 468.3767, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CCT244747, Alternative-names: , CAS# 1404095-34-6, Formula: C20H24N8O2, MWT: 408.457, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Checkpoint Kinase (Chk), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| beta-lactamase-IN-1, Alternative-names: , CAS# 1075237-97-6, Formula: C11H13N3O4, MWT: 251.2386, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| WNK463, Alternative-names: , CAS# 2012607-27-9, Formula: C21H24F3N7O2, MWT: 463.4562, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tenofovir (Disoproxil), Alternative-names: Bis(POC)-PMPA;GS 4331, CAS# 201341-05-1, Formula: C19H30N5O10P, MWT: 519.4427, Solubility: DMSO: ≥ 38 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection;Anti-infection, Target: HBV;Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SPQ, Alternative-names: , CAS# 83907-40-8, Formula: C13H15NO4S, MWT: 281.3275, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
Doravirine, Alternative-names: MK-1439, CAS# 1338225-97-0, Formula: C17H11ClF3N5O3, MWT: 425.7491, Solubility: DMSO: ≥ 30 mg/mL
, Clinical_Information: Phase 3, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Methoxy-PMS, Alternative-names: 1-Methoxy PMS;1-Methoxyphenazine methosulfate, CAS# 65162-13-2, Formula: C15H16N2O5S, MWT: 336.3629, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| SCH00013, Alternative-names: , CAS# 217963-18-3, Formula: C18H20N4O2, MWT: 324.377, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| GDC-0853, Alternative-names: Fenebrutinib, CAS# 1434048-34-6, Formula: C37H44N8O4, MWT: 664.7964, Solubility: DMSO: ≥ 23 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| MK-0812 (Succinate), Alternative-names: , CAS# 851916-42-2, Formula: C28H40F3N3O7, MWT: 587.6283, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PIM447, Alternative-names: LGH447, CAS# 1210608-43-7, Formula: C24H23F3N4O, MWT: 440.4608, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Lasalocid (sodium), Alternative-names: Sodium lasalocid, CAS# 25999-20-6, Formula: C34H53NaO8, MWT: 612.7696, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection;Autophagy, Target: Bacterial;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Apigenin 7-glucoside, Alternative-names: Apigenin-7-O-β-D-glucopyranoside;Apigetrin;Cosmosiin, CAS# 578-74-5, Formula: C21H20O10, MWT: 432.3775, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| 2-Cl-IB-MECA, Alternative-names: Chloro-IB-MECA;CF-102;CI-IB-MECA;Namodenoson, CAS# 163042-96-4, Formula: C18H18ClIN6O4, MWT: 544.7308, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| AZD3839 (free base), Alternative-names: , CAS# 1227163-84-9, Formula: C24H16F3N5, MWT: 431.4125, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Neuronal Signaling, Target: Beta-secretase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NAMI-A, Alternative-names: , CAS# 201653-76-1, Formula: C5H10Cl4N2ORuS . C3H4N2 . H, MWT: 458.18, Solubility: H<sub>2</sub>O: 8.28 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: FAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| DNQX, Alternative-names: , CAS# 2379-57-9, Formula: C8H4N4O6, MWT: 252.14056, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Glucagon, Alternative-names: Porcine glucagon, CAS# 16941-32-5, Formula: C153H225N43O49S, MWT: 3482.747, Solubility: DMSO: ≥ 43.33 mg/mL; H<sub>2</sub>O: < 1.3 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| GLP-1(7-36), Alternative-names: Human GLP-1-(7-36)-amide;Insulinotropin;MKC253;Glucagon-like Peptide 1 (7-36) amide;GLP-1 (7-36) amide, CAS# 107444-51-9, Formula: C149H226N40O45, MWT: 3297.63, Solubility: H<sub>2</sub>O: 16.66 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| Aviptadil, Alternative-names: Vasoactive Intestinal Peptide (human, rat, mouse, rabbit, canine, porcine), CAS# 40077-57-4, Formula: C147H238N44O42S, MWT: 3325.797, Solubility: H<sub>2</sub>O: ≥ 65 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CFI-400945 (free base), Alternative-names: , CAS# 1338806-73-7, Formula: C33H34N4O3, MWT: 534.6481, Solubility: DMSO: ≥ 166.66 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Polo-like Kinase (PLK), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Vapreotide, Alternative-names: RC160;BMY 41606, CAS# 103222-11-3, Formula: C57H70N12O9S2, MWT: 1131.371, Solubility: H<sub>2</sub>O: ≥ 60 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| PIM-447 (dihydrochloride), Alternative-names: LGH447 dihydrochloride, CAS# 1820565-69-2, Formula: C24H25Cl2F3N4O, MWT: 513.3827, Solubility: DMSO: ≥ 46.7 mg/mL, Clinical_Information: Phase 2, Pathway: JAK/STAT Signaling, Target: Pim, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Polymyxin B (Sulfate), Alternative-names: , CAS# 1405-20-5, Formula: C55H96N16O13.H2SO4 (Polymyxin B2 Sulfate), MWT: 1000, Solubility: H<sub>2</sub>O, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| PP58, Alternative-names: , CAS# 212391-58-7, Formula: C22H19Cl2N5O2, MWT: 456.3246, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: Src;PDGFR;FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| (S)-MCPG, Alternative-names: (+)-MCPG, CAS# 150145-89-4, Formula: C10H11NO4, MWT: 209.1986, Solubility: DMSO: 6.2 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Isorhamnetin, Alternative-names: 3'-Methylquercetin, CAS# 480-19-3, Formula: C16H12O7, MWT: 316.2623, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;PI3K/Akt/mTOR;MAPK/ERK Pathway, Target: PI3K;Akt;MEK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CPI-637, Alternative-names: , CAS# 1884712-47-3, Formula: C22H22N6O, MWT: 386.4497, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Epigenetic Reader Domain, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| KPT-8602, Alternative-names: Eltanexor, CAS# 1642300-52-4, Formula: C17H10F6N6O, MWT: 428.2913, Solubility: DMSO: 4.72 mg/mL, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: CRM1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Sulfatinib, Alternative-names: HMPL-012, CAS# 1308672-74-3, Formula: C24H28N6O3S, MWT: 480.5825, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: VEGFR;FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| STF-62247, Alternative-names: STF62247;STF 62247, CAS# 315702-99-9, Formula: C15H13N3S, MWT: 267.3488, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| T0901317, Alternative-names: , CAS# 293754-55-9, Formula: C17H12F9NO3S, MWT: 481.3327, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Metabolic Enzyme/Protease, Target: FXR;LXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| PD150606, Alternative-names: , CAS# 179528-45-1, Formula: C9H7IO2S, MWT: 306.1201, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Proteasome, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BM212, Alternative-names: , CAS# 146204-42-4, Formula: C23H25Cl2N3, MWT: 414.3707, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Lycorine (hydrochloride), Alternative-names: , CAS# 2188-68-3, Formula: C16H18ClNO4, MWT: 323.7714, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Procyanidin B1, Alternative-names: , CAS# 20315-25-7, Formula: C30H26O12, MWT: 578.5203, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: Toll-like Receptor (TLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Fevipiprant, Alternative-names: NVP-QAW039;QAW039, CAS# 872365-14-5, Formula: C19H17F3N2O4S, MWT: 426.4095, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CRTH2 (GPR44);CRTH2 (GPR44), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| GNE-495, Alternative-names: , CAS# 1449277-10-4, Formula: C22H20FN5O2, MWT: 405.4249, Solubility: DMSO: 10 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| GNE-140 (racemate), Alternative-names: GNE 140 racemate;GNE140 racemate, CAS# 1802977-61-2, Formula: C25H23ClN2O3S2, MWT: 499.0447, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Lactate Dehydrogenase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Histone Acetyltransferase Inhibitor II, Alternative-names: , CAS# 932749-62-7, Formula: C20H16Br2O3, MWT: 464.1472, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Acetyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| N-563, Alternative-names: , CAS# 140686-92-6, Formula: C15H29N5O5, MWT: 359.4213, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ospemifene, Alternative-names: FC-1271a, CAS# 128607-22-7, Formula: C24H23ClO2, MWT: 378.8912, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Buserelin (Acetate), Alternative-names: , CAS# 68630-75-1, Formula: C62H90N16O15, MWT: 1299.4762, Solubility: 10 mM in DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: GNRH Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Sincalide, Alternative-names: CCK-8;SQ19844;Cholecystokinin octapeptide, CAS# 25126-32-3, Formula: C49H62N10O16S3, MWT: 1143.269, Solubility: H<sub>2</sub>O: < 0.05 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| HDAC-IN-4, Alternative-names: , CAS# 934828-12-3, Formula: C24H29N5O, MWT: 403.52, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: HDAC;HDAC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Pamapimod, Alternative-names: Ro4402257;R1503, CAS# 449811-01-2, Formula: C19H20F2N4O4, MWT: 406.3833, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Oxidopamine (hydrobromide), Alternative-names: 6-Hydroxydopamine hydrobromide;6-OHDA hydrobromide, CAS# 636-00-0, Formula: C8H12BrNO3, MWT: 250.0898, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;Autophagy, Target: Dopamine Receptor;Dopamine Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| alpha-Cyperone, Alternative-names: α-Cyperone;(+)-α-Cyperone, CAS# 473-08-5, Formula: C15H22O, MWT: 218.3346, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
MK-1064, Alternative-names: , CAS# 1207253-08-4, Formula: C24H20ClN5O3, MWT: 461.9003, Solubility: 10 mM in DMSO
, Clinical_Information: Phase 1, Pathway: GPCR/G Protein, Target: Orexin Receptor (OX Receptor), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CHIR-99021 (monohydrochloride), Alternative-names: CT99021 monohydrochloride, CAS# 1797989-42-4, Formula: C22H19Cl3N8, MWT: 501.7989, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;PI3K/Akt/mTOR;Autophagy, Target: GSK-3;GSK-3;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CHIR-99021 (trihydrochloride), Alternative-names: CT99021 trihydrochloride, CAS# 1782235-14-6, Formula: C22H21Cl5N8, MWT: 574.7208, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;PI3K/Akt/mTOR;Autophagy, Target: GSK-3;GSK-3;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Amcasertib, Alternative-names: BBI503, CAS# 1129403-56-0, Formula: C31H33N5O2S, MWT: 539.691, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Amiselimod (hydrochloride), Alternative-names: MT-1303 hydrochloride, CAS# 942398-84-7, Formula: C19H31ClF3NO3, MWT: 413.9026, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NOD-IN-1, Alternative-names: , CAS# 132819-92-2, Formula: C18H17NO4S, MWT: 343.3969, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: NOD-like Receptor (NLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 4-Hydroxytamoxifen, Alternative-names: (Z)-4-Hydroxytamoxifen;trans-4-Hydroxytamoxifen, CAS# 68047-06-3, Formula: C26H29NO2, MWT: 387.51396, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Cell Cycle/DNA Damage, Target: Autophagy;CRISPR/Cas9, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| GLP-1(7-37), Alternative-names: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, CAS# 106612-94-6, Formula: C151H228N40O47, MWT: 3355.666, Solubility: H<sub>2</sub>O: 30 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Nesiritide, Alternative-names: Brain Natriuretic Peptide-32 human;BNP-32, CAS# 124584-08-3, Formula: C143H244N50O42S4, MWT: 3464.037, Solubility: H<sub>2</sub>O: ≥ 40 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Velpatasvir, Alternative-names: GS-5816, CAS# 1377049-84-7, Formula: C49H54N8O8, MWT: 883.0018, Solubility: DMSO: 146.66 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| HTHQ, Alternative-names: , CAS# 148081-72-5, Formula: C15H24O2, MWT: 236.3499, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| YL0919, Alternative-names: , CAS# 1339058-04-6, Formula: C18H23ClN2O2, MWT: 334.8404, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| U93631, Alternative-names: , CAS# 152273-12-6, Formula: C17H21N3O2, MWT: 299.3676, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Procyanidin B2, Alternative-names: Proanthocyanidin B2, CAS# 29106-49-8, Formula: C30H26O12, MWT: 578.5203, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| KPT-8602 (Z-isomer), Alternative-names: Eltanexor Z-isomer, CAS# 1642300-78-4, Formula: C17H10F6N6O, MWT: 428.2913, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: CRM1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Nelotanserin, Alternative-names: APD125, CAS# 839713-36-9, Formula: C18H15BrF2N4O2, MWT: 437.2381, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Norverapamil (hydrochloride), Alternative-names: (±)-Norverapamil hydrochloride;D591 hydrochlorid, CAS# 67812-42-4, Formula: C26H37ClN2O4, MWT: 477.036, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| BLU-554, Alternative-names: , CAS# 1707289-21-1, Formula: C24H24Cl2N4O4, MWT: 503.3777, Solubility: DMSO: ≥ 25 mg/mL, Clinical_Information: Phase 1, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| GSK2795039, Alternative-names: , CAS# 1415925-18-6, Formula: C23H26N6O2S, MWT: 450.5565, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Disitertide, Alternative-names: P144;P144 Peptide, CAS# 272105-42-7, Formula: C68H109N17O22S2, MWT: 1580.824, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Stem Cell/Wnt;TGF-beta/Smad, Target: TGF-beta/Smad;TGF-beta/Smad, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Apoptozole, Alternative-names: , CAS# 1054543-47-3, Formula: C33H25F6N3O3, MWT: 625.5603, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Cefamandole (sodium), Alternative-names: Cephamandole sodium, CAS# 30034-03-8, Formula: C18H17N6NaO5S2, MWT: 484.4846, Solubility: H<sub>2</sub>O: ≥ 29 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Pranlukast (hemihydrate), Alternative-names: , CAS# 150821-03-7, Formula: C27H23N5O4 .1/2H2O, MWT: 490.51, Solubility: DMSO: 17.5 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Leukotriene Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| ML348, Alternative-names: , CAS# 899713-86-1, Formula: C18H17ClF3N3O3, MWT: 415.7941, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phospholipase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Emetine (dihydrochloride hydrate), Alternative-names: , CAS# 7083-71-8, Formula: C29H40N2O4 . 2 HCl . H2O, MWT: 571.58, Solubility: DMSO: 16.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Anti-infection, Target: Autophagy;Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| CC122, Alternative-names: Avadomide, CAS# 1015474-32-4, Formula: C14H14N4O3, MWT: 286.2859, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: E1/E2/E3 Enzyme, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Aloxistatin, Alternative-names: E64d;E64c ethyl ester, CAS# 88321-09-9, Formula: C17H30N2O5, MWT: 342.4305, Solubility: DMSO: ≥ 23 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cathepsin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| KN-93 (phosphate), Alternative-names: , CAS# 1913269-12-1, Formula: C26H32ClN2O8PS, MWT: 599.0327, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: CaMK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| RR6, Alternative-names: , CAS# 1351758-37-6, Formula: C16H23NO4, MWT: 293.3581, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Acebilustat, Alternative-names: , CAS# 943764-99-6, Formula: C29H27N3O4, MWT: 481.5424, Solubility: 10 mM in DMSO; Methanol: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| KX2-391 (Mesylate), Alternative-names: KX01 Mesylate, CAS# 1080645-95-9, Formula: C27H33N3O6S, MWT: 527.6324, Solubility: DMSO: ≥ 57 mg/mL, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK;Cell Cycle/DNA Damage;Cytoskeleton, Target: Src;Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| 8-Nitrotryptanthrin, Alternative-names: , CAS# 77603-42-0, Formula: C15H7N3O4, MWT: 293.23378, Solubility: DMSO: 6.4 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Indoleamine 2,3-Dioxygenase (IDO), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| MKC3946, Alternative-names: , CAS# 1093119-54-0, Formula: C21H20N2O3S, MWT: 380.4601, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: IRE1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Norisoboldine, Alternative-names: (+)-Laurelliptine, CAS# 23599-69-1, Formula: C18H19NO4, MWT: 313.3477, Solubility: DMSO: ≥62.5 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenosine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| OABK (hydrochloride), Alternative-names: , CAS# 1984862-48-7, Formula: C14H20ClN5O4, MWT: 357.7927, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TN1, Alternative-names: , CAS# 289479-94-3, Formula: C29H31N7O2, MWT: 509.6021, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| GRA Ex-25, Alternative-names: , CAS# 307983-31-9, Formula: C29H36F3N3O5, MWT: 563.6085, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Pirmenol (hydrochloride), Alternative-names: Cl-845;(¡À)-Pirmenol hydrochlorid, CAS# 61477-94-9, Formula: C22H31ClN2O, MWT: 374.9473, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling;GPCR/G Protein;Membrane Transporter/Ion Channel, Target: mAChR;mAChR;Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Mirogabalin, Alternative-names: DS5565, CAS# 1138245-13-2, Formula: C12H19NO2, MWT: 209.2848, Solubility: DMSO: 10 mM; Methanol: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Beta-Sitosterol, Alternative-names: β-Sitosterol;22,23-Dihydrostigmasterol, CAS# 83-46-5, Formula: C29H50O, MWT: 414.7067, Solubility: 10 mM in Ethanol, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Mogrol, Alternative-names: , CAS# 88930-15-8, Formula: C30H52O4, MWT: 476.7315, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway;JAK/STAT Signaling;Stem Cell/Wnt, Target: ERK;ERK;STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 11-oxo-mogroside V, Alternative-names: , CAS# 126105-11-1, Formula: C60H100O29, MWT: 1285.419, Solubility: 10 mM in H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Siamenoside I, Alternative-names: , CAS# 126105-12-2, Formula: C54H92O24, MWT: 1125.294, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Cinaciguat (hydrochloride), Alternative-names: BAY 58-2667 hydrochloride, CAS# 646995-35-9, Formula: C36H40ClNO5, MWT: 602.1595, Solubility: DMSO: ≥ 85.71 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Guanylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| NSC632839, Alternative-names: , CAS# 157654-67-6, Formula: C21H22ClNO, MWT: 339.8585, Solubility: DMSO: 6.2 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Deubiquitinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| HS-173, Alternative-names: , CAS# 1276110-06-5, Formula: C21H18N4O4S, MWT: 422.457, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ciliobrevin A, Alternative-names: HPI-4, CAS# 302803-72-1, Formula: C17H9Cl2N3O2, MWT: 358.1783, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Hedgehog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Sugammadex (sodium), Alternative-names: Org25969, CAS# 343306-79-6, Formula: C72H104Na8O48S8, MWT: 2178.006, Solubility: H<sub>2</sub>O: ≥ 34 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| MQAE, Alternative-names: , CAS# 162558-52-3, Formula: C14H16BrNO3, MWT: 326.1857, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Ibrutinib-biotin, Alternative-names: , CAS# 1599432-18-4, Formula: C56H80N12O9S, MWT: 1097.374, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MMAF-OMe, Alternative-names: Monomethyl auristatin F methyl ester, CAS# 863971-12-4, Formula: C40H67N5O8, MWT: 745.9887, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Antibody-drug Conjugate/ADC Related, Target: ADC Cytotoxin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Pemafibrate (racemate), Alternative-names: , CAS# 848258-31-1, Formula: C28H30N2O6, MWT: 490.5476, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Auristatin PE, Alternative-names: Soblidotin;TZT-1027, CAS# 149606-27-9, Formula: C39H67N5O6, MWT: 701.97918, Solubility: DMSO; Methanol: ≥ 44 mg/mL, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Combretastatin A4, Alternative-names: CRC 87-09, CAS# 117048-59-6, Formula: C18H20O5, MWT: 316.3484, Solubility: 10 mM in DMSO, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Microtubule/Tubulin;Microtubule/Tubulin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Xanthohumol, Alternative-names: , CAS# 6754-58-1, Formula: C21H22O5, MWT: 354.3964, Solubility: DMSO: ≥ 150 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease;Immunology/Inflammation, Target: DGAT;COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Dipsacoside B, Alternative-names: , CAS# 33289-85-9, Formula: C53H86O22, MWT: 1075.237, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Lathyrol, Alternative-names: , CAS# 34420-19-4, Formula: C20H30O4, MWT: 334.4498, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 7beta-Hydroxylathyrol, Alternative-names: , CAS# 34208-98-5, Formula: C20H30O5, MWT: 350.4492, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 5,15-Diacetyl-3-benzoyllathyrol, Alternative-names: Euphorbia factor L3, CAS# 218916-52-0, Formula: C31H38O7, MWT: 522.6292, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| D-Glutamine, Alternative-names: , CAS# 5959-95-5, Formula: C5H10N2O3, MWT: 146.1445, Solubility: H<sub>2</sub>O: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| D-alpha-Hydroxyglutaric acid (disodium salt), Alternative-names: Disodium (R)-2-hydroxyglutarate, CAS# 103404-90-6, Formula: C5H6Na2O5, MWT: 192.08, Solubility: H<sub>2</sub>O: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| FGFR-IN-1, Alternative-names: , CAS# 1448169-71-8, Formula: C22H22N6O3, MWT: 418.4485, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Fosfluconazole, Alternative-names: , CAS# 194798-83-9, Formula: C13H13F2N6O4P, MWT: 386.2507, Solubility: DMSO: 6.2 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: Anti-infection, Target: Fungal, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Sophoflavescenol, Alternative-names: , CAS# 216450-65-6, Formula: C21H20O6, MWT: 368.3799, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Neuronal Signaling;Neuronal Signaling, Target: Phosphodiesterase (PDE);Beta-secretase;AChE, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tempol, Alternative-names: 4-Hydroxy-TEMPO, CAS# 2226-96-2, Formula: C9H18NO2*, MWT: 172.2447, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Asaraldehyde, Alternative-names: Asaronaldehyde;Asaraldehyde;2,4,5-trimethoxy-Benzaldehyde, CAS# 4460-86-0, Formula: C10H12O4, MWT: 196.1999, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Biotin Hydrazide, Alternative-names: , CAS# 66640-86-6, Formula: C10H18N4O2S, MWT: 258.3405, Solubility: DMSO: 6.6 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| LM22A-4, Alternative-names: , CAS# 37988-18-4, Formula: C15H21N3O6, MWT: 339.3438, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Trk Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SR12813, Alternative-names: GW 485801, CAS# 126411-39-0, Formula: C24H42O7P2, MWT: 504.5336, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HMG-CoA Reductase (HMGCR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ZSET1446, Alternative-names: ST-101, CAS# 887603-94-3, Formula: C15H12N2O, MWT: 236.2686, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel;Membrane Transporter/Ion Channel, Target: nAChR;nAChR;Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| SKF89976A (hydrochloride), Alternative-names: d,l-SKF89976A hydrochloride, CAS# 85375-15-1, Formula: C22H26ClNO2, MWT: 371.9003, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Beclabuvir, Alternative-names: BMS-791325, CAS# 958002-33-0, Formula: C36H45N5O5S, MWT: 659.838, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 3, Pathway: Metabolic Enzyme/Protease;Anti-infection, Target: HCV Protease;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TPEN, Alternative-names: TPEDA, CAS# 16858-02-9, Formula: C26H28N6, MWT: 424.5407, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Ribitol, Alternative-names: Adonitol;Adonite, CAS# 488-81-3, Formula: C5H12O5, MWT: 152.1458, Solubility: H<sub>2</sub>O: 6.2 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| BFH772, Alternative-names: , CAS# 890128-81-1, Formula: C23H16F3N3O3, MWT: 439.3867, Solubility: DMSO: 7.75 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: VEGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BGP-15, Alternative-names: , CAS# 66611-37-8, Formula: C14H24Cl2N4O2, MWT: 351.272, Solubility: DMSO: 11.33 mg/mL, Clinical_Information: Phase 2, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Basmisanil, Alternative-names: RG1662;RO5186582, CAS# 1159600-41-5, Formula: C21H20FN3O5S, MWT: 445.464, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: GABA Receptor;GABA Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| YM-58483, Alternative-names: BTP2, CAS# 223499-30-7, Formula: C15H9F6N5OS, MWT: 421.3203, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: CRAC Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Bromocriptine (mesylate), Alternative-names: CB-154, CAS# 22260-51-1, Formula: C33H44BrN5O8S, MWT: 750.70016, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein;Neuronal Signaling;Autophagy, Target: Dopamine Receptor;Dopamine Receptor;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Hederacoside D, Alternative-names: , CAS# 760961-03-3, Formula: C53H86O22, MWT: 1075.237, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Protodioscin, Alternative-names: , CAS# 55056-80-9, Formula: C51H84O22, MWT: 1049.199, Solubility: 10 mM in H<sub>2</sub>O, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Epoxymicheliolide, Alternative-names: 1β,10β-Epoxymicheliolide, CAS# 1343403-10-0, Formula: C15H20O4, MWT: 264.3169, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Phorbol, Alternative-names: 4β-Phorbol, CAS# 17673-25-5, Formula: C20H28O6, MWT: 364.4327, Solubility: H<sub>2</sub>O: ≥ 20 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Phorbol 12-myristate 13-acetate, Alternative-names: PMA, CAS# 16561-29-8, Formula: C36H56O8, MWT: 616.825, Solubility: DMSO: ≥ 62 mg/mL, Clinical_Information: No Development Reported, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Monepantel, Alternative-names: AAD1566, CAS# 887148-69-8, Formula: C20H13F6N3O2S, MWT: 473.3915392, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Ketanserin, Alternative-names: R41468, CAS# 74050-98-9, Formula: C22H22FN3O3, MWT: 395.4268, Solubility: DMSO: 8 mg/mL, Clinical_Information: Launched, Pathway: Autophagy;Neuronal Signaling;GPCR/G Protein;Membrane Transporter/Ion Channel, Target: Autophagy;5-HT Receptor;5-HT Receptor;Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| (R)-Flurbiprofen, Alternative-names: E7869;Tarenflurbil;MPC7869, CAS# 51543-40-9, Formula: C15H13FO2, MWT: 244.2609, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| URB602, Alternative-names: , CAS# 565460-15-3, Formula: C19H21NO2, MWT: 295.3755, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| NSC23005 (sodium), Alternative-names: , CAS# 1796596-46-7, Formula: C13H16NNaO4S, MWT: 305.33, Solubility: DMSO: 6.4 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Menadione bisulfite (sodium), Alternative-names: Menadione sodium bisulfite;Vitamin K3 sodium bisulfite, CAS# 130-37-0, Formula: C11H9NaO5S, MWT: 276.24, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Epiberberine (chloride), Alternative-names: , CAS# 889665-86-5, Formula: C20H18ClNO4, MWT: 371.8142, Solubility: DMSO: 7.4 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling;Neuronal Signaling, Target: Adrenergic Receptor;Beta-secretase;AChE, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Dehydrocorydaline (chloride), Alternative-names: 13-Methylpalmatine chloride, CAS# 10605-03-5, Formula: C22H24ClNO4, MWT: 401.88326, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ASK1-IN-1, Alternative-names: , CAS# 1262041-49-5, Formula: C23H21N7O, MWT: 411.45914, Solubility: DMSO: 15.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Caspase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| L-Ascorbic acid (sodium), Alternative-names: (+)-Sodium L-ascorbate;Vitamin C sodium salt;Sodium L-ascorbate, CAS# 134-03-2, Formula: C6H7NaO6, MWT: 198.11, Solubility: H<sub>2</sub>O: ≥ 41 mg/mL, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| ARS-853, Alternative-names: , CAS# 1629268-00-3, Formula: C22H29ClN4O3, MWT: 432.9437, Solubility: DMSO: ≥ 71 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Ras, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| BX517, Alternative-names: , CAS# 850717-64-5, Formula: C15H14N4O2, MWT: 282.2973, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PDK-1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Rotenone, Alternative-names: , CAS# 83-79-4, Formula: C23H22O6, MWT: 394.4172, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| Rbin-1, Alternative-names: Ribozinoindole-1, CAS# 328023-11-6, Formula: C13H12N4S, MWT: 256.3262, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: Kinesin;Kinesin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| BAPTA, Alternative-names: , CAS# 85233-19-8, Formula: C22H24N2O10, MWT: 476.4333, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Piperoxan (hydrochloride), Alternative-names: dl-Piperoxan hydrochloride, CAS# 135-87-5, Formula: C14H20ClNO2, MWT: 269.7671, Solubility: DMSO: ≥ 31mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Leonurine, Alternative-names: SCM-198, CAS# 24697-74-3, Formula: C14H21N3O5, MWT: 311.3336, Solubility: DMSO: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Autophagy;Immunology/Inflammation, Target: Autophagy;Toll-like Receptor (TLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| VU0364770, Alternative-names: , CAS# 61350-00-3, Formula: C12H9ClN2O, MWT: 232.6657, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Leonurine (hydrochloride), Alternative-names: SCM-198 hydrochloride, CAS# 24735-18-0, Formula: C14H22ClN3O5, MWT: 347.79458, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Autophagy;Immunology/Inflammation, Target: Autophagy;Toll-like Receptor (TLR), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| RAF709, Alternative-names: , CAS# 1628838-42-5, Formula: C28H29F3N4O4, MWT: 542.5495, Solubility: DMSO: 100 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: Raf, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| E7820, Alternative-names: ER68203-00, CAS# 289483-69-8, Formula: C17H12N4O2S, MWT: 336.36778, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 2, Pathway: Cytoskeleton, Target: Integrin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Erythromycin Cyclocarbonate, Alternative-names: Erythromycin cyclic carbonate;Erythromycin A 11,12-carbonate, CAS# 55224-05-0, Formula: C38H65NO14, MWT: 759.921, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Ensartinib, Alternative-names: X-396, CAS# 1365267-27-1, Formula: C25H25Cl2FN6O3, MWT: 547.4088032, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: Phase 3, Pathway: Protein Tyrosine Kinase/RTK, Target: ALK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| PF06650833, Alternative-names: , CAS# 1817626-54-2, Formula: C18H20FN3O4, MWT: 361.3675, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Phase 2, Pathway: Immunology/Inflammation;Protein Tyrosine Kinase/RTK, Target: IRAK;IRAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AM-2394, Alternative-names: , CAS# 1442684-77-6, Formula: C22H25N5O4, MWT: 423.465, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Glucokinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| JK184, Alternative-names: , CAS# 315703-52-7, Formula: C19H18N4OS, MWT: 350.43742, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt, Target: Hedgehog, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ketanserin (tartrate), Alternative-names: R41468 tartrate, CAS# 83846-83-7, Formula: C26H28FN3O9, MWT: 545.5136, Solubility: H<sub>2</sub>O: 30 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: Autophagy;Neuronal Signaling;GPCR/G Protein;Membrane Transporter/Ion Channel, Target: Autophagy;5-HT Receptor;5-HT Receptor;Potassium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Dehydroisoandrosterone 3-acetate, Alternative-names: Dehydroepiandrosterone 3-acetate;DHEA acetate, CAS# 853-23-6, Formula: C21H30O3, MWT: 330.4611, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Androgen Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| GSK2256098, Alternative-names: , CAS# 1224887-10-8, Formula: C20H23ClN6O2, MWT: 414.8886, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Phase 2, Pathway: Protein Tyrosine Kinase/RTK, Target: FAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Pemafibrate, Alternative-names: (R)-K-13675, CAS# 848259-27-8, Formula: C28H30N2O6, MWT: 490.5476, Solubility: DMSO, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| DG051, Alternative-names: , CAS# 929915-58-2, Formula: C21H25Cl2NO4, MWT: 426.3335, Solubility: DMSO: ≥ 325 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Aminopeptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| CA-074 methyl ester, Alternative-names: CA-074Me, CAS# 147859-80-1, Formula: C19H31N3O6, MWT: 397.4659, Solubility: DMSO: ≥ 215 mg/mL; H<sub>2</sub>O: 26.66 mg/mL (Need warming), Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cathepsin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Niraparib metabolite M1, Alternative-names: Niraparib carboxylic acid metabolite M1;M1 metabolite of niraparib, CAS# 1476777-06-6, Formula: C19H19N3O2, MWT: 321.37306, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Nicainoprol, Alternative-names: , CAS# 76252-06-7, Formula: C21H27N3O3, MWT: 369.4574, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| L-Praziquanamine, Alternative-names: (+)-Praziquanamine, CAS# 99746-73-3, Formula: C12H14N2O, MWT: 202.2524, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Oleanolic acid derivative 1, Alternative-names: , CAS# 1724-18-1, Formula: C31H48O2, MWT: 452.7116, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Oleanolic acid derivative 2, Alternative-names: , CAS# 211516-63-1, Formula: C28H42O3, MWT: 426.6313, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Protocatechuic acid, Alternative-names: 3,4-Dihydroxybenzoic acid, CAS# 99-50-3, Formula: C7H6O4, MWT: 154.1201, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| ML RR-S2 CDA (ammonium salt), Alternative-names: STING-Inducer-1 ammonium salt, CAS# 1638750-96-5, Formula: C20H30N12O10P2S2, MWT: 724.604124, Solubility: DMSO: 15 mg/mL; H<sub>2</sub>O: 12.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: STING, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| HT-2157, Alternative-names: SNAP 37889, CAS# 303149-14-6, Formula: C21H13F3N2O, MWT: 366.3359, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: Neuropeptide Y Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PF-06282999, Alternative-names: , CAS# 1435467-37-0, Formula: C13H12ClN3O3S, MWT: 325.7707, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Phase 1, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PF-1355, Alternative-names: PF-06281355, CAS# 1435467-38-1, Formula: C14H15N3O4S, MWT: 321.3516, Solubility: DMSO: 8.75 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ONO-7300243, Alternative-names: , CAS# 638132-34-0, Formula: C28H31NO5, MWT: 461.54944, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GGTI298, Alternative-names: , CAS# 180977-44-0, Formula: C27H33N3O3S, MWT: 479.63422, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500ug |
| AS1517499, Alternative-names: , CAS# 919486-40-1, Formula: C20H20ClN5O2, MWT: 397.8581, Solubility: DMSO: ≥ 35 mg/mL; for introperitoneal injection, AS1517499 was formulated with DMSO/ethanol/Tween 80/distilled water (20/10/1/69%)., Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BBT594, Alternative-names: NVP-BBT594, CAS# 882405-89-2, Formula: C28H30F3N7O3, MWT: 569.5781, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| UNC3866, Alternative-names: , CAS# 1872382-47-2, Formula: C43H66N6O8, MWT: 795.0195, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DREADD agonist 21, Alternative-names: , CAS# 56296-18-5, Formula: C17H18N4, MWT: 278.3516, Solubility: DMSO: ≥ 78 mg/mL, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: mAChR;mAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| N-Desmethylclozapine, Alternative-names: Norclozapine;Desmethylclozapine;Normethylclozapine, CAS# 6104-71-8, Formula: C17H17ClN4, MWT: 312.7967, Solubility: 10 mM in DMSO; DCM: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MRE-269, Alternative-names: ACT-333679, CAS# 475085-57-5, Formula: C25H29N3O3, MWT: 419.5161, Solubility: DMSO: ≥ 51 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Antibiotic-5d, Alternative-names: , CAS# 251349-54-9, Formula: C13H18N2O4S, MWT: 298.358, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| IPI549, Alternative-names: , CAS# 1693758-51-8, Formula: C30H24N8O2, MWT: 528.564, Solubility: DMSO: 15 mg/mL, Clinical_Information: Phase 1, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Conduritol B epoxide, Alternative-names: , CAS# 6090-95-5, Formula: C6H10O5, MWT: 162.1406, Solubility: H<sub>2</sub>O: ≥ 22 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SYP-5, Alternative-names: , CAS# 1384268-04-5, Formula: C18H16O3S, MWT: 312.3828, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: HIF/HIF Prolyl-Hydroxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MX69, Alternative-names: , CAS# 1005264-47-0, Formula: C27H26N2O4S, MWT: 474.57134, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis;Apoptosis, Target: IAP;MDM-2/p53, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| IDE1, Alternative-names: , CAS# 1160927-48-9, Formula: C15H18N2O5, MWT: 306.3138, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| KRIBB11, Alternative-names: , CAS# 342639-96-7, Formula: C13H12N6O2, MWT: 284.27338, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease;Cell Cycle/DNA Damage, Target: HSP;HSP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| GS-7340 (hemifumarate), Alternative-names: Tenofovir alafenamide hemifumarate, CAS# 1392275-56-7, Formula: C21H29N6O5P.1/2 C4H4O4, MWT: 534.5, Solubility: DMSO, Clinical_Information: Launched, Pathway: Anti-infection;Anti-infection, Target: Reverse Transcriptase;HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bavachin, Alternative-names: Corylifolin, CAS# 19879-32-4, Formula: C20H20O4, MWT: 324.3704, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Estrogen Receptor/ERR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Podocarpic acid, Alternative-names: , CAS# 5947-49-9, Formula: C17H22O3, MWT: 274.35478, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| SF1670, Alternative-names: , CAS# 345630-40-2, Formula: C19H17NO3, MWT: 307.3432, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;Metabolic Enzyme/Protease, Target: PTEN;Phosphatase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Taranabant ((1R,2R)stereoisomer), Alternative-names: MK0364 (1R,2R)stereoisomer, CAS# 701977-08-4, Formula: C27H25ClF3N3O2, MWT: 515.9545, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Cannabinoid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
TGR-1202 (R-enantiomer), Alternative-names: RP5264 R-enantiomer, CAS# 1532533-69-9, Formula: C31H24F3N5O3, MWT: 571.5492, Solubility: DMSO
, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: PI3K, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| PNU-282987 (S enantiomer free base), Alternative-names: , CAS# 737727-12-7, Formula: C14H17ClN2O, MWT: 264.7506, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Membrane Transporter/Ion Channel, Target: nAChR;nAChR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| EGF816 (S-enantiomer), Alternative-names: Nazartinib S-enantiomer, CAS# 1508256-20-9, Formula: C26H31ClN6O2, MWT: 495.0163, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Protein Tyrosine Kinase/RTK, Target: EGFR;EGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| RSV604 (racemate), Alternative-names: , CAS# 676128-62-4, Formula: C22H17FN4O2, MWT: 388.3944, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: RSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RSV604 (R enantiomer), Alternative-names: , CAS# 932108-20-8, Formula: C22H17FN4O2, MWT: 388.3944, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: RSV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| LY 344864 (S-enantiomer), Alternative-names: , CAS# 186544-27-4, Formula: C21H22FN3O, MWT: 351.4173, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;GPCR/G Protein, Target: 5-HT Receptor;5-HT Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DHMEQ (racemate), Alternative-names: rel-DHMEQ, CAS# 287194-38-1, Formula: C13H11NO5, MWT: 261.2301, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
Litronesib (Racemate), Alternative-names: LY-2523355 Racemate;KF-89617 Racemate, CAS# 546111-97-1, Formula: C23H37N5O4S2, MWT: 511.701, Solubility: 10 mM in DMSO
, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: Kinesin;Kinesin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Mavoglurant (racemate), Alternative-names: AFQ-056 racemate, CAS# 1636881-61-2, Formula: C19H23NO3, MWT: 313.3908, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: mGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| AMG 487 (S-enantiomer), Alternative-names: , CAS# 473720-30-8, Formula: C32H28F3N5O4, MWT: 603.591, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
GDC-0834 (S-enantiomer), Alternative-names: , CAS# 1133432-50-4, Formula: C33H36N6O3S, MWT: 596.7423, Solubility: 10 mM in DMSO
, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Btk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Cebranopadol ((1α,4α)stereoisomer), Alternative-names: GRT6005 (1α,4α)stereoisomer, CAS# 863513-93-3, Formula: C24H27FN2O, MWT: 378.4823832, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein;Neuronal Signaling, Target: Opioid Receptor;Opioid Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
INT-777 (R-enantiomer), Alternative-names: S-EMCA R enantiomer, CAS# 1198786-98-9, Formula: C27H46O5, MWT: 450.6512, Solubility: 10 mM in DMSO
, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPCR19, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| CZ415, Alternative-names: , CAS# 1429639-50-8, Formula: C22H29N5O4S, MWT: 459.5618, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR, Target: mTOR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
Bisantrene, Alternative-names: CL216942, CAS# 78186-34-2, Formula: C22H22N8, MWT: 398.46368, Solubility: DMSO: ≥ 133.33 mg/mL
, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| CPI-455, Alternative-names: , CAS# 1628208-23-0, Formula: C16H14N4O, MWT: 278.3086, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CDD3505, Alternative-names: , CAS# 173865-33-3, Formula: C22H17N3O2, MWT: 355.38928, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| CDD3506, Alternative-names: , CAS# 197913-15-8, Formula: C22H19N3, MWT: 325.40636, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SQ22536, Alternative-names: , CAS# 17318-31-9, Formula: C9H11N5O, MWT: 205.2165, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Adenylate Cyclase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Lusutrombopag, Alternative-names: S-888711, CAS# 1110766-97-6, Formula: C29H32Cl2N2O5S, MWT: 591.5458, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation, Target: Thrombopoietin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| TUG-891, Alternative-names: , CAS# 1374516-07-0, Formula: C23H21FO3, MWT: 364.4094432, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| ARA290, Alternative-names: Cibinetide, CAS# 1208243-50-8, Formula: C51H84N16O21, MWT: 1257.30726, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Alexamorelin, Alternative-names: , CAS# 196808-85-2, Formula: C50H63N13O7, MWT: 958.11812, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GHSR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Beaucage reagent, Alternative-names: , CAS# 66304-01-6, Formula: C7H4O3S2, MWT: 200.23486, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 250mg |
| Dalfopristin, Alternative-names: RP54476, CAS# 112362-50-2, Formula: C34H50N4O9S, MWT: 690.8472, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TAPI-2, Alternative-names: , CAS# 187034-31-7, Formula: C19H37N5O5, MWT: 415.5276, Solubility: DMSO: ≥ 22 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: MMP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| NMS-P118, Alternative-names: , CAS# 1262417-51-5, Formula: C20H24F3N3O2, MWT: 395.4187, Solubility: DMSO: 16 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Polydatin, Alternative-names: Piceid, CAS# 27208-80-6, Formula: C20H22O8, MWT: 390.3839, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Phase 2, Pathway: Autophagy;NF-κB, Target: Autophagy;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| I-CBP112, Alternative-names: , CAS# 1640282-31-0, Formula: C27H36N2O5, MWT: 468.5851, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Acetyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Acelarin, Alternative-names: NUC-1031, CAS# 840506-29-8, Formula: C25H27F2N4O8P, MWT: 580.4744484, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: Phase 2, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Cenicriviroc, Alternative-names: TAK-652;TBR-652, CAS# 497223-25-3, Formula: C41H52N4O4S, MWT: 696.941, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: CCR;CCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Saroglitazar, Alternative-names: , CAS# 495399-09-2, Formula: C25H29NO4S, MWT: 439.567, Solubility: DMSO: 10 mM, Clinical_Information: Phase 3, Pathway: Cell Cycle/DNA Damage;NF-κB, Target: PPAR;PPAR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Upadacitinib, Alternative-names: ABT-494, CAS# 1310726-60-3, Formula: C17H19F3N6O, MWT: 380.3676, Solubility: DMSO: ≥ 22 mg/mL, Clinical_Information: Phase 3, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| APS-2-79 (hydrochloride), Alternative-names: , CAS# 2002381-31-7, Formula: C23H22ClN3O3, MWT: 423.89208, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;MAPK/ERK Pathway, Target: ERK;ERK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SGC2085, Alternative-names: , CAS# 1821908-48-8, Formula: C19H24N2O2, MWT: 312.4061, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| COH29, Alternative-names: , CAS# 1190932-38-7, Formula: C22H16N2O5S, MWT: 420.4378, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Bisindolylmaleimide I, Alternative-names: GF109203X;Go 6850, CAS# 133052-90-1, Formula: C25H24N4O2, MWT: 412.4837, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: Launched, Pathway: TGF-beta/Smad;Epigenetics, Target: PKC;PKC, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Piperine, Alternative-names: Bioperine;1-Piperoylpiperidine, CAS# 94-62-2, Formula: C17H19NO3, MWT: 285.3376, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel;Autophagy, Target: P-glycoprotein;Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Betulin, Alternative-names: Trochol, CAS# 473-98-3, Formula: C30H50O2, MWT: 442.7168, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Oxymatrine, Alternative-names: , CAS# 16837-52-8, Formula: C15H24N2O2, MWT: 264.3633, Solubility: DMSO: ≥ 10 mM, Clinical_Information: Phase 4, Pathway: Stem Cell/Wnt;TGF-beta/Smad, Target: TGF-beta/Smad;TGF-beta/Smad, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Puerarin, Alternative-names: , CAS# 3681-99-0, Formula: C21H20O9, MWT: 416.3781, Solubility: DMSO, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein;NF-κB, Target: 5-HT Receptor;5-HT Receptor;NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Baicalein, Alternative-names: 5,6,7-Trihydroxyflavone, CAS# 491-67-8, Formula: C15H10O5, MWT: 270.2369, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Xanthine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Rutaecarpine, Alternative-names: Rutecarpine, CAS# 84-26-4, Formula: C18H13N3O, MWT: 287.3153, Solubility: DMSO: ≥ 10 mM, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Evodiamine, Alternative-names: (+)-Evodiamine;d-Evodiamine, CAS# 518-17-2, Formula: C19H17N3O, MWT: 303.3578, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Amygdalin, Alternative-names: , CAS# 29883-15-6, Formula: C20H27NO11, MWT: 457.42848, Solubility: DMSO: ≥ 75 mg/mL, Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Heptamethine cyanine dye-1, Alternative-names: ADS 815EI, CAS# 162411-29-2, Formula: C42H44ClIN2, MWT: 739.1696, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Monocrotaline, Alternative-names: Crotaline, CAS# 315-22-0, Formula: C16H23NO6, MWT: 325.3569, Solubility: DMSO: ≥ 25 mg/mL, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| IDO-IN-2, Alternative-names: , CAS# 1668565-74-9, Formula: C29H35N7O, MWT: 497.6345, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Indoleamine 2,3-Dioxygenase (IDO), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Fluorescein-5-maleimide, Alternative-names: N-(5-Fluoresceinyl)maleimide, CAS# 75350-46-8, Formula: C24H13NO7, MWT: 427.3625, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| BMS-779788, Alternative-names: EXEL04286652;XL-652;BMS-788, CAS# 918348-67-1, Formula: C28H29ClN2O3S, MWT: 509.0594, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: LXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TB5, Alternative-names: , CAS# 948841-07-4, Formula: C15H14BrNOS, MWT: 336.24676, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: Monoamine Oxidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Treprostinil (sodium), Alternative-names: UT-15, CAS# 289480-64-4, Formula: C23H33NaO5, MWT: 412.4949, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Prostaglandin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Roflumilast Impurity E, Alternative-names: , CAS# 1391052-76-8, Formula: C13H8Cl2F2N2O3, MWT: 349.117, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| AZD9056 (hydrochloride), Alternative-names: , CAS# 345303-91-5, Formula: C24H36Cl2N2O2, MWT: 455.46084, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: P2X Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BKT140, Alternative-names: BL-8040;TF14016;4F-Benzoyl-TN14003, CAS# 664334-36-5, Formula: C97H144FN33O19S2, MWT: 2159.5193632, Solubility: DMSO: ≥ 36 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein;Immunology/Inflammation, Target: CXCR;CXCR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Taspoglutide, Alternative-names: ITM077;R1583;BIM51077, CAS# 275371-94-3, Formula: C152H232N40O45, MWT: 3339.709, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 3, Pathway: GPCR/G Protein, Target: Glucagon Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Shogaol, Alternative-names: [6]-Shogaol;6-Shogaol, CAS# 555-66-8, Formula: C17H24O3, MWT: 276.3707, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Emixustat, Alternative-names: ACU-4429, CAS# 1141777-14-1, Formula: C16H25NO2, MWT: 263.3752, Solubility: DMSO: ≥ 43 mg/mL, Clinical_Information: Phase 3, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Src Inhibitor 1, Alternative-names: Src Kinase Inhibitor 1;Src-l1, CAS# 179248-59-0, Formula: C22H19N3O3, MWT: 373.40456, Solubility: DMSO: 6.2 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Src, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| MGL-3196, Alternative-names: VIA-3196, CAS# 920509-32-6, Formula: C17H12Cl2N6O4, MWT: 435.221, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Imipramine (hydrochloride), Alternative-names: , CAS# 113-52-0, Formula: C19H25ClN2, MWT: 316.8682, Solubility: H<sub>2</sub>O: ≥ 34 mg/mL, Clinical_Information: Launched, Pathway: Neuronal Signaling, Target: Serotonin Transporter, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Etrasimod, Alternative-names: APD334, CAS# 1206123-37-6, Formula: C26H26F3NO3, MWT: 457.4847, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 2, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BAY1217389, Alternative-names: , CAS# 1554458-53-5, Formula: C27H24F5N5O3, MWT: 561.5032, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 1, Pathway: Cell Cycle/DNA Damage;Cytoskeleton, Target: Mps1;Mps1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Monastrol, Alternative-names: (¡À)-Monastro, CAS# 329689-23-8, Formula: C14H16N2O3S, MWT: 292.35344, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: Kinesin;Kinesin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| 6"-O-Apiosyl-5-O-Methylvisammioside, Alternative-names: , CAS# 139446-82-5, Formula: C27H36O14, MWT: 584.5663, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PF-04957325, Alternative-names: , CAS# 1305115-80-3, Formula: C14H15F3N8OS, MWT: 400.3821, Solubility: DMSO: 9.9 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Phosphodiesterase (PDE), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| PF-06840003, Alternative-names: , CAS# 198474-05-4, Formula: C12H9FN2O2, MWT: 232.2104632, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 1, Pathway: Metabolic Enzyme/Protease, Target: Indoleamine 2,3-Dioxygenase (IDO), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| (R)-(-)-Phenylephrine, Alternative-names: Phenylephrine, CAS# 59-42-7, Formula: C9H13NO2, MWT: 167.205, Solubility: DMSO, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| DDP-38003 (dihydrochloride), Alternative-names: , CAS# 1831167-98-6, Formula: C21H28Cl2N4O, MWT: 423.37922, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Demethylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Importazole, Alternative-names: , CAS# 662163-81-7, Formula: C20H22N4, MWT: 318.41548, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| DiI, Alternative-names: DiIC18(3), CAS# 41085-99-8, Formula: C59H97ClN2O4, MWT: 933.8655, Solubility: DMSO: ≥80 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| S49076, Alternative-names: , CAS# 1265965-22-7, Formula: C22H22N4O4S, MWT: 438.4995, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK;Protein Tyrosine Kinase/RTK, Target: c-Met/HGFR;FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| AS1842856, Alternative-names: , CAS# 836620-48-5, Formula: C18H22FN3O3, MWT: 347.384, Solubility: DMSO: 7.6 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| NQ301, Alternative-names: , CAS# 130089-98-4, Formula: C18H12ClNO3, MWT: 325.74578, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Thrombin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| HM30181, Alternative-names: HM30181A, CAS# 849675-66-7, Formula: C38H36N6O7, MWT: 688.7285, Solubility: DMSO: 6.6 mg/mL (Need ultrasonic), Clinical_Information: Phase 1, Pathway: Membrane Transporter/Ion Channel, Target: P-glycoprotein, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Acumapimod, Alternative-names: , CAS# 836683-15-9, Formula: C22H19N5O2, MWT: 385.4185, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: p38 MAPK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AX20017, Alternative-names: , CAS# 329221-38-7, Formula: C13H16N2O2S, MWT: 264.3434, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ML364, Alternative-names: , CAS# 1991986-30-1, Formula: C24H18F3N3O3S2, MWT: 517.5432296, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Deubiquitinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| MK-8998, Alternative-names: , CAS# 953778-58-0, Formula: C20H23F3N2O2, MWT: 380.4040296, Solubility: 10 mM in DMSO, Clinical_Information: Phase 2, Pathway: Membrane Transporter/Ion Channel, Target: Calcium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Ellipticine (hydrochloride), Alternative-names: , CAS# 5081-48-1, Formula: C17H15ClN2, MWT: 282.7674, Solubility: DMSO: 5.8 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Topoisomerase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SP-13786, Alternative-names: , CAS# 1448440-52-5, Formula: C17H14F2N4O2, MWT: 344.3155, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| C 87, Alternative-names: , CAS# 332420-90-3, Formula: C24H15ClN6O3S, MWT: 502.9323, Solubility: DMSO: 9.33 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: TNF-alpha, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 2-PMPA, Alternative-names: 2-(Phosphonomethyl)pentanedioic acid, CAS# 173039-10-6, Formula: C6H11O7P, MWT: 226.1211, Solubility: H<sub>2</sub>O: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Carboxypeptidase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Salermide, Alternative-names: , CAS# 1105698-15-4, Formula: C26H22N2O2, MWT: 394.46508, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: Sirtuin;Sirtuin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 4E2RCat, Alternative-names: , CAS# 432499-63-3, Formula: C22H14ClNO4S2, MWT: 455.9339, Solubility: DMSO: 15.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: Eukaryotic Initiation Factor (eIF), HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| BP-1-102, Alternative-names: , CAS# 1334493-07-0, Formula: C29H27F5N2O6S, MWT: 626.5915, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| GSK189254A, Alternative-names: , CAS# 720690-73-3, Formula: C21H25N3O2, MWT: 351.4421, Solubility: DMSO: 6 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Glaucocalyxin B, Alternative-names: , CAS# 80508-81-2, Formula: C22H30O5, MWT: 374.4706, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: Autophagy, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AZ960, Alternative-names: , CAS# 905586-69-8, Formula: C18H16F2N6, MWT: 354.3566464, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Stem Cell/Wnt;JAK/STAT Signaling, Target: JAK;JAK;JAK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| LY3177833, Alternative-names: , CAS# 1627696-51-8, Formula: C16H12FN5O, MWT: 309.2978, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: CDK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| PNU-74654, Alternative-names: , CAS# 113906-27-7, Formula: C19H16N2O3, MWT: 320.34194, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Stem Cell/Wnt, Target: β-catenin;Wnt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| BAY1125976, Alternative-names: , CAS# 1402608-02-9, Formula: C23H21N5O, MWT: 383.4457, Solubility: DMSO: 10.33 mg/mL, Clinical_Information: Phase 1, Pathway: PI3K/Akt/mTOR, Target: Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| MI-503, Alternative-names: , CAS# 1857417-13-0, Formula: C28H27F3N8S, MWT: 564.6278, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| BIA 10-2474, Alternative-names: , CAS# 1233855-46-3, Formula: C16H20N4O2, MWT: 300.3556, Solubility: DMSO: 6.4 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Neuronal Signaling;Metabolic Enzyme/Protease, Target: FAAH;FAAH, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| MI-463, Alternative-names: , CAS# 1628317-18-9, Formula: C24H23F3N6S, MWT: 484.5398, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Mutagenic Impurity of Tenofovir Disoproxil, Alternative-names: , CAS# 1446486-33-4, Formula: C8H9N5, MWT: 175.1906, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Myricetin, Alternative-names: Cannabiscetin, CAS# 529-44-2, Formula: C15H10O8, MWT: 318.2351, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Mequitazine, Alternative-names: , CAS# 29216-28-2, Formula: C20H22N2S, MWT: 322.46708, Solubility: DMSO: 16 mg/mL, Clinical_Information: Launched, Pathway: Immunology/Inflammation;GPCR/G Protein, Target: Histamine Receptor;Histamine Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Octenidine (dihydrochloride), Alternative-names: , CAS# 70775-75-6, Formula: C36H64Cl2N4, MWT: 623.82616, Solubility: DMSO: 8.2 mg/mL (Need ultrasonic and warming), Clinical_Information: Launched, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 200mg |
| Bay 41-4109 (racemate), Alternative-names: , CAS# 298708-79-9, Formula: C18H13ClF3N3O2, MWT: 395.7629296, Solubility: DMSO: ≥ 37 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HBV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
Imisopasem manganese, Alternative-names: M40403, CAS# 218791-21-0, Formula: C21H35Cl2Mn2N5-, MWT: 538.31873858, Solubility: H<sub>2</sub>O: 16 mg/mL (Need ultrasonic and warming)
, Clinical_Information: Phase 2, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| MRT68921, Alternative-names: , CAS# 1190379-70-4, Formula: C25H34N6O, MWT: 434.5771, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Autophagy, Target: ULK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Chitosan, Alternative-names: Deacetylated chitin;Poly(D-glucosamine), CAS# 9012-76-4, Formula: C12H24N2O8, MWT: 324.32756, Solubility: DMSO: < 1 mg/mL; H<sub>2</sub>O: < 1 mg/mL, Clinical_Information: Phase 4, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10g |
| CCT196969, Alternative-names: , CAS# 1163719-56-9, Formula: C27H24FN7O3, MWT: 513.5229, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: MAPK/ERK Pathway, Target: Raf, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Dovitinib (lactate), Alternative-names: CHIR-258 lactate;TKI-258 lactate, CAS# 692737-80-7, Formula: C24H27FN6O4, MWT: 482.5073832, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: Launched, Pathway: Protein Tyrosine Kinase/RTK, Target: FGFR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| R121919, Alternative-names: NBI30775, CAS# 195055-03-9, Formula: C22H32N6, MWT: 380.5297, Solubility: DMSO: 6.2 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| SH5-07, Alternative-names: , CAS# 1456632-41-9, Formula: C29H28F5N3O5S, MWT: 625.6068, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: JAK/STAT Signaling;Stem Cell/Wnt, Target: STAT;STAT, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Isosilybin, Alternative-names: Isosilybinin, CAS# 72581-71-6, Formula: C25H22O10, MWT: 482.4362, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Cytochrome P450, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Proguanil, Alternative-names: , CAS# 500-92-5, Formula: C11H16ClN5, MWT: 253.7312, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: Parasite , HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 25mg |
| Columbin, Alternative-names: , CAS# 546-97-4, Formula: C20H22O6, MWT: 358.3851, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: COX, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Ecteinascidin 770, Alternative-names: Ecteinascidine 770;Et-770, CAS# 114899-80-8, Formula: C40H42N4O10S, MWT: 770.84728, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Apoptosis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Hyaluronic acid, Alternative-names: , CAS# 9004-61-9, Formula: (C14H21NO11)n, MWT: 1000, Solubility: H<sub>2</sub>O: 6.8 mg/mL (Need ultrasonic), Clinical_Information: Launched, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| PAC-14028, Alternative-names: Asivatrep, CAS# 1005168-10-4, Formula: C21H22F5N3O3S, MWT: 491.4747, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: TRP Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| PD-1-IN-1, Alternative-names: , CAS# 1673534-76-3, Formula: C12H20N6O7, MWT: 360.3232, Solubility: DMSO: 28.5 mg/mL, Clinical_Information: No Development Reported, Pathway: Immunology/Inflammation, Target: PD-1/PD-L1, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| STO-609, Alternative-names: , CAS# 52029-86-4, Formula: C19H10N2O3, MWT: 314.2943, Solubility: DMSO: 5.6 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Neuronal Signaling, Target: CaMK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Osalmid, Alternative-names: Oxaphenamide;4'-Hydroxysalicylanilide, CAS# 526-18-1, Formula: C13H11NO3, MWT: 229.2313, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: Launched, Pathway: Anti-infection, Target: HBV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1g |
| AMG-3969, Alternative-names: , CAS# 1361224-53-4, Formula: C21H20F6N4O3S, MWT: 522.4639, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: Glucokinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| YO-01027, Alternative-names: Dibenzazepine;DBZ, CAS# 209984-56-5, Formula: C26H23F2N3O3, MWT: 463.4759, Solubility: DMSO: ≥ 33 mg/mL, Clinical_Information: No Development Reported, Pathway: Stem Cell/Wnt;Neuronal Signaling;Stem Cell/Wnt, Target: γ-secretase;γ-secretase;Notch, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 2mg |
| Chaetocin, Alternative-names: , CAS# 28097-03-2, Formula: C30H28N6O6S4, MWT: 696.8399, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics, Target: Histone Methyltransferase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TMB (monosulfate), Alternative-names: BM blue monosulfate;Sure Blue TMB monosulfate, CAS# 54827-18-8, Formula: C16H22N2O4S, MWT: 338.4219, Solubility: DMSO: ≥ 28 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| (Z)-Mutagenic Impurity of Tenofovir Disoproxil, Alternative-names: , CAS# 1464851-21-5, Formula: C8H9N5, MWT: 175.19056, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: HIV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| S107, Alternative-names: , CAS# 927871-76-9, Formula: C11H15NOS, MWT: 209.3079, Solubility: DMSO: ≥ 38 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| AR7, Alternative-names: , CAS# 80306-38-3, Formula: C15H12ClNO, MWT: 257.71488, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Metabolic Enzyme/Protease, Target: RAR/RXR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Org-26576, Alternative-names: , CAS# 1026791-61-6, Formula: C11H12N2O2, MWT: 204.22518, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Stachydrine, Alternative-names: , CAS# 471-87-4, Formula: C7H13NO2, MWT: 143.1836, Solubility: H<sub>2</sub>O: ≥ 32 mg/mL; DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: NF-κB, Target: NF-κB, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Q-VD-OPh, Alternative-names: QVD-OPH;Quinoline-Val-Asp-Difluorophenoxymethylketone, CAS# 1135695-98-5, Formula: C26H25F2N3O6, MWT: 513.4900064, Solubility: DMSO: ≥ 25 mg/mL, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: Caspase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Bicyclomycin benzoate, Alternative-names: FR2054, CAS# 37134-40-0, Formula: C19H22N2O8, MWT: 406.38658, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| S1p receptor agonist 1, Alternative-names: , CAS# 1514888-56-2, Formula: C23H24FN3O3, MWT: 409.4533632, Solubility: DMSO: 6.8 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: LPL Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| D-Glutamic acid, Alternative-names: (R)-Glutamic acid, CAS# 6893-26-1, Formula: C5H9NO4, MWT: 147.1293, Solubility: H<sub>2</sub>O: 6 mg/mL (Need ultrasonic), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| Sodium ionophore III, Alternative-names: ETH2120, CAS# 81686-22-8, Formula: C34H52N2O4, MWT: 552.78768, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| Pristimerin, Alternative-names: Celastrol methyl ester, CAS# 1258-84-0, Formula: C30H40O4, MWT: 464.6362, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Anti-infection, Target: Bacterial, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| Thiomyristoyl, Alternative-names: , CAS# 1429749-41-6, Formula: C34H51N3O3S, MWT: 581.85204, Solubility: DMSO: ≥ 32 mg/mL, Clinical_Information: No Development Reported, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: Sirtuin;Sirtuin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Saroglitazar Magnesium, Alternative-names: , CAS# 1639792-20-3, Formula: C50H56N2O8S2Mg, MWT: 901.42, Solubility: 10 mM in DMSO, Clinical_Information: Phase 3, Pathway: Epigenetics;Cell Cycle/DNA Damage, Target: PARP;PARP, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| GSK682753A, Alternative-names: , CAS# 1334294-76-6, Formula: C23H21Cl3N2O3, MWT: 479.78344, Solubility: DMSO: ≥ 27 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: EBI2/GPR183, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Docosahexaenoic Acid, Alternative-names: DHA;Cervonic Acid, CAS# 6217-54-5, Formula: C22H32O2, MWT: 328.48828, Solubility: 10 mM in DMSO, Clinical_Information: Phase 4, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Solvent Blue 35, Alternative-names: Sudan Blue II;Oil Blue 35, CAS# 17354-14-2, Formula: C22H26N2O2, MWT: 350.454, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| KR-33493, Alternative-names: , CAS# 1021497-97-1, Formula: C20H18BrN3O3S, MWT: 460.3442, Solubility: DMSO: ≥ 31 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Lifitegrast, Alternative-names: SAR 1118, CAS# 1025967-78-5, Formula: C29H24Cl2N2O7S, MWT: 615.4811, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: Launched, Pathway: Cytoskeleton, Target: Integrin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| TD139, Alternative-names: , CAS# 1450824-22-2, Formula: C28H30F2N6O8S, MWT: 648.635, Solubility: DMSO: 1 mg/mL (Need ultrasonic); H<sub>2</sub>O: < 5 mg/mL; Ethanol: 0.1 mg/mL (Need ultrasonic and warming), Clinical_Information: Phase 2, Pathway: Stem Cell/Wnt, Target: β-catenin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| RIPA-56, Alternative-names: , CAS# 1956370-21-0, Formula: C13H19NO2, MWT: 221.29546, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Apoptosis, Target: RIP kinase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| ML-098, Alternative-names: CID-7345532, CAS# 878978-76-8, Formula: C19H19NO3, MWT: 309.3591, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: Ras, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 1,3-Dicaffeoylquinic acid, Alternative-names: 1,3-O-Dicaffeoylquinic acid;1,5-Dicaffeoylquinic acid, CAS# 19870-46-3, Formula: C25H24O12, MWT: 516.4509, Solubility: DMSO: ≥ 23 mg/mL, Clinical_Information: No Development Reported, Pathway: PI3K/Akt/mTOR;PI3K/Akt/mTOR, Target: PI3K;Akt, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
Guanine, Alternative-names: , CAS# 73-40-5, Formula: C5H5N5O, MWT: 151.1261, Solubility: DMSO: 0.15 mg/mL (Need ultrasonic and warming)
, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage, Target: DNA/RNA Synthesis, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| EC330, Alternative-names: , CAS# 2016795-77-8, Formula: C30H32F2O2, MWT: 462.5706864, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BPO-27 (racemate), Alternative-names: , CAS# 1314873-02-3, Formula: C26H18BrN3O6, MWT: 548.34162, Solubility: DMSO: 6 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: CFTR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| (R)-BPO-27, Alternative-names: , CAS# 1415390-47-4, Formula: C26H18BrN3O6, MWT: 548.3416, Solubility: DMSO, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel, Target: CFTR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Tenapanor, Alternative-names: AZD1722;RDX5791, CAS# 1234423-95-0, Formula: C50H66Cl4N8O10S2, MWT: 1145.049, Solubility: DMSO: 10 mM, Clinical_Information: Phase 3, Pathway: Membrane Transporter/Ion Channel, Target: Sodium Channel, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Bathophenanthroline, Alternative-names: , CAS# 1662-01-7, Formula: C24H16N2, MWT: 332.3972, Solubility: DMSO: 6 mg/mL (Need ultrasonic and warming), Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| Olodaterol, Alternative-names: BI1744, CAS# 868049-49-4, Formula: C21H26N2O5, MWT: 386.4415, Solubility: H<sub>2</sub>O: 6.2 mg/mL, Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 100mg |
| Forchlorfenuron, Alternative-names: , CAS# 68157-60-8, Formula: C12H10ClN3O, MWT: 247.6803, Solubility: DMSO: ≥ 29 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 500mg |
| BAR501, Alternative-names: , CAS# 1632118-69-4, Formula: C26H46O3, MWT: 406.64164, Solubility: DMSO: 10 mM, Clinical_Information: No Development Reported, Pathway: GPCR/G Protein, Target: GPCR19, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| EMD534085, Alternative-names: , CAS# 858668-07-2, Formula: C25H31F3N4O2, MWT: 476.5345, Solubility: DMSO: ≥ 26 mg/mL, Clinical_Information: No Development Reported, Pathway: Cytoskeleton;Cell Cycle/DNA Damage, Target: Kinesin;Kinesin, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Cynarin, Alternative-names: Cynarine, CAS# 30964-13-7, Formula: C25H24O12, MWT: 516.4509, Solubility: DMSO: ≥ 23 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Celgosivir (hydrochloride), Alternative-names: MDL 28574A, CAS# 141117-12-6, Formula: C12H22ClNO5, MWT: 295.7598, Solubility: H<sub>2</sub>O: ≥ 200 mg/mL, Clinical_Information: Phase 2, Pathway: Anti-infection;Anti-infection, Target: HIV;HCV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| Batefenterol, Alternative-names: GSK961081;TD-5959, CAS# 743461-65-6, Formula: C40H42ClN5O7, MWT: 740.2438, Solubility: DMSO: 10 mM, Clinical_Information: Phase 2, Pathway: Neuronal Signaling;GPCR/G Protein;GPCR/G Protein, Target: mAChR;mAChR;Adrenergic Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 50mg |
| PRT-060318, Alternative-names: PRT318, CAS# 1194961-19-7, Formula: C18H24N6O, MWT: 340.4228, Solubility: H<sub>2</sub>O: 5.6 mg/mL, Clinical_Information: No Development Reported, Pathway: Protein Tyrosine Kinase/RTK, Target: Syk, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| Farampator, Alternative-names: CX-691;Org24448, CAS# 211735-76-1, Formula: C12H13N3O2, MWT: 231.2505, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Membrane Transporter/Ion Channel;Neuronal Signaling, Target: iGluR;iGluR, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| 1-Naphthaleneacetic acid, Alternative-names: 1-Naphthylacetic acid, CAS# 86-87-3, Formula: C12H10O2, MWT: 186.2066, Solubility: 10 mM in DMSO, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| Mozavaptan, Alternative-names: OPC-31260;OPC31260l, CAS# 137975-06-5, Formula: C27H29N3O2, MWT: 427.5381, Solubility: DMSO: 6.2 mg/mL (Need warming), Clinical_Information: Launched, Pathway: GPCR/G Protein, Target: Vasopressin Receptor, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
| 3-Indoleacetic acid, Alternative-names: Indole-3-acetic acid;3-IAA, CAS# 87-51-4, Formula: C10H9NO2, MWT: 175.184, Solubility: DMSO: ≥ 30 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| Indole-3-butyric acid, Alternative-names: 3-indolebutyric acid, CAS# 133-32-4, Formula: C12H13NO2, MWT: 203.2371, Solubility: DMSO: ≥ 35 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5g |
| GJ103 (sodium salt), Alternative-names: , CAS# 1459687-96-7, Formula: C16H13N4NaO3S, MWT: 364.35418928, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: No Development Reported, Pathway: Others, Target: Others, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 1mg |
| TOFA, Alternative-names: RMI14514;MDL14514, CAS# 54857-86-2, Formula: C19H32O4, MWT: 324.45498, Solubility: DMSO: ≥ 34 mg/mL, Clinical_Information: Phase 2, Pathway: Metabolic Enzyme/Protease, Target: Acetyl-CoA Carboxylase, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
| BI-847325, Alternative-names: , CAS# 1207293-36-4, Formula: C29H28N4O2, MWT: 464.5582, Solubility: DMSO: ≥36 mg/mL, Clinical_Information: No Development Reported, Pathway: Cell Cycle/DNA Damage;Epigenetics;MAPK/ERK Pathway, Target: Aurora Kinase;Aurora Kinase;MEK, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 5mg |
Brivudine, Alternative-names: Bromovinyldeoxyuridine;BVDU, CAS# 69304-47-8, Formula: C11H13BrN2O5, MWT: 333.1353, Solubility: DMSO: ≥ 330 mg/mL
, Clinical_Information: Launched, Pathway: Anti-infection, Target: CMV, HPLC>98%, NMR, LCMS, MSDS, COA is ok, stock more than 10mg |
