EOS-Peptide-3

EOS med chem is the only manufacturer that provides excellent quality chemistry products and services at affordable rates. The experts working here are highly trained to handle these chemicals used in the creation of medicines used for treating various life-threatening diseases. We are into the manufacturing of chemical products after doing a deep research for the same.

EOS team of experts holds the work experience of more than ten years, and therefore we can assure you about the quality and superiority of the products and services we offer to all our valued clients around the globe. At present, this organization is listed among the most leading pharmaceutical suppliers around the world. We always supply products keeping the affordability in mind.

(β-Asp3)-GRF (human), CAS# 142985-02-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

(β-Asp3)-GRF (huMan) (β-Asp3)-GHRH (huMan)， (β-Asp3)-Growth HorMone-Releasing Factor (huMan)， (β-Asp3)-Growth HorMone-Releasing HorMone (huMan)， (β-Asp3)-SoMatocrinin (huMan)， (β-Asp3)-SoMatoliberin (huMan)， (β-Asp3)-SoMatorelin, CAS# 142985-02-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

(β-Asp3)-VIP (human， bovine， porcine， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

(β-Asp5)-Delta-Sleep Inducing Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

(β-Asp5)-Delta-Sleep Inducing Peptide (β-Asp5)-Delta-Sleep Inducing Peptide (rabbit)， (β-Asp5)-DSIP (rabbit), CAS# 82602-88-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

.-Amyloid (1-24), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

.-Amyloid (1-46), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

/L-Glutamic acid γ-(3-carboxy-4-nitroanilide) ammonium salt, CAS# 63699-78-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

? I probe;SREWEDGFGGRWLSR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

? II probe;SSLDLSQFPMTASFLRESR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

? III probe;SSEACVGRWMLCEQLGVSR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

?-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

?Amyloid BRI Peptide (1-34), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

?-Amyloid Peptide (1-42)， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

?-Amyloid Precursor Protein: 732-751, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

?-Bag Cell Peptide;RLRFH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

?-Neuroprotectin;aDLIAYL-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[(1S)-(1'-(S)-N-Boc-Amino-2-cyclohexyl-ethyl)oxirane, CAS# 107202-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[(2R，4R，5S)-2-Benzyl-5-(Boc-amino)-4-hydroxy-6-phenyl-hexanoyl]-Leu-Phe-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[(2R，4R，5S)-2-Benzyl-5-(Boc-amino)-4-hydroxy-6-phenyl-hexanoyl]-Leu-Phe-NH2, CAS# 292632-98-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[(RS)-2-Carboxy-3-phenylpropionyl]-Leu-OH, CAS# 209127-97-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[?-Ala8]-Neurokinin A (4-10);DSFV-(?-A)-LM-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[[p-(2-methoxyethyl)phenoxy]methyl]oxirane, CAS# 56718-70-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[1(S)-Methyl-2(S)，3-epoxypropyl]-carbamic acid tert-Butyl ester, CAS# 165683-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[1，2，4]Triazolo[1，5-a]pyridin-7-ylboronic acid pinacol ester.HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[1，2，4]triazolo[1，5-a]pyridine-6-boronic acid pinacol ester, CAS# 1160790-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[1，2，5]Oxadiazolo[3，4-b]pyridin-6-ylboronic acid, CAS# 1447847-99-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[1S，2R，5R]-3-Aza-bicyclo[3.1.0]-hexane-2，3-dicarboxylic acid 3-tert-Butyl ester, CAS# 400720-05-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[2，6-Dimethyl-4-(3-[2-(Z-amino)-ethylcarbamoyl]-propoxy)-benzenesulfonyl]-Dap(Boc)-OMe, CAS# 277316-24-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[2-[2-(Fmoc-amino)ethoxy]ethoxy]acetic acid, CAS# 166108-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[2-Me-Ala2] b-Endorphin， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[2-Methoxy-4-[4-(4-methylpiperazin-1-yl)piperidin-1-yl]phenyl]amine, CAS# 761440-75-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[3，3'-Bipyridin]-5-ylboronic acid, CAS# 1034541-67-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[3，4-Dehydro-Pro]3-Thyrotropin Releasing Hormone， [ΔPro3]-TRH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[3-Me-His2] TRH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[4-(1H-Pyrazol-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl]methyl pivalate, CAS# 1146629-77-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[4-Benzoyl-Phe]8-Substance P;RPKPQQF-F(4-Bz)-GLM-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[4-Chloro-Phe]7，8-Substance P;RPKPQQ-F(4-Cl-F)-GLM-NH2, CAS# 73646-81-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[4ClDPhe6，Leu17] VIP, CAS# 102805-45-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Aba5-14] BTD-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ac-Cys4， D-Phe7， Cys10]-α-MSH (4-13)， amide;Ac-CEHfRWCKPV-NH2, CAS# 91050-39-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ac-Cys4，DPhe7，Cys10] a-MSH (4-13)， amide, CAS# 91050-39-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala 353， 367]Presenilin 1 (349-361), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala1，3，11，16]-Endothelin 1， human;ASASSLMDKEAVYFAHLDIIW, CAS# 121204-87-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala1]-PAR-4 (1-6) (mouse), CAS# 380900-00-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala1]-PAR-4 (1-6) amide (mouse), CAS# 352017-71-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala10]-beta-Amyloid (1-10), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala11，22，28]-VIP (human， bovine， porcine， rat), CAS# 291524-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala11，D-Leu15]-Orexin B (human), CAS# 532932-99-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala127] Hepatitis B Virus Pre-S Region (120-131), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala13] - Apelin - 13, CAS# 568565-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala13]-Apelin-13;H-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Ala-OH, CAS# 568565-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala144] - PLP (139 - 151) A144 - PLP(139 - 151), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala144]-PLP (139-151) A144-PLP(139-151);HSLGKALGHPDKF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala16，17，20]-beta-Amyloid (1-28), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala18] Beta Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala18] Endothelin-1， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala2] Endothelin-3， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala2] Met-Enkephalin， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala20]-beta-Amyloid (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala26， Leu27]-Melan-A (26-35);ALAGIGILTV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala26]-Melan-A/MART-1 (26-35);AAAGIGILTV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala28]-beta-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302)), CAS# 141055-85-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala3，11，18， Nle7] Endothelin-1， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala31，Aib32]-Neuropeptide Y (porcine), CAS# 313988-59-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala4] - MBP (1 - 11), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala4]-MBP (1-11);Ac-ASQARPSQRHG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala5， ?-Ala8]-Neurokinin A (4-10);DAFV-(?-A)-LM-NH2, CAS# 127633-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala5， β-Ala8]-Neurokinin A (4-10), CAS# 127633-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala6，D-Trp8]-Galanin (1-15)-ol;GWTLNAAwYLLGPHA-ol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala8] - Humanin， [Ala8] - HN， Shna, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala8]-Humanin， [Ala8]-HN， sHNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala8]-Humanin， [Ala8]-HN， sHNA;MAPRGFSALLLLTSEIDLPVKRRA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala81] - MBP (74 - 85), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala81]-MBP (74-85);QKSQRSQAENPV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala9，10， Lys11，12] Glycogen Synthase (1-12), CAS# 105802-84-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala9] Autocamtide 2: Autocamtide-2-Related Inhibitory Peptide, CAS# 167114-91-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ala9] Autocamtide 2; Autocamtide-2-Related Inhibitory Peptide, CAS# 167114-91-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[APLILSR]pPSA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg0] Met-Enkephalin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg13] b-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg14，20，21， Leu16]-PACAP (1-27)-Gly-Lys-Arg， amide， human， ovine， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg14，20，21， Leu16]-PACAP (1-27)-Gly-Lys-Arg， amide， human， ovine， rat;HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg15，20，21， Leu17] VIP-Gly-Lys-Arg-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg15，Asp16，25，Pro18，21，23，Val22，Ile24]-Amyloid β-Protein (15-25), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg22] b-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg22] b-Amyloid: 1-40?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg3，14]CTX IV (3-14), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg3] Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg3]-Amyloid β-Protein (1-40), CAS# 1802084-01-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg6]-beta-Amyloid (1-40)， England Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg6]-beta-Amyloid (1-42)， English Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8，des-Gly-NH29]-Vasopressin, CAS# 37552-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8] Deamino Vasopressin Desglycinamide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8] GTP-Binding Protein Fragment， Gs alpha, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8] Vasopressin Desglycinamide, CAS# 37552-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8]-a-Neo-Endorphin (1-8), CAS# 75106-72-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8]-Conopressin G, CAS# 130836-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8]-Vasopressin, CAS# 113-79-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8]-Vasopressin (4-9), CAS# 96027-30-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8]-Vasopressin (free acid), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8]-Vasopressin， free acid;CYFQNCPRG(Disulfidebridge:1-6), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg8]-Vasotocin, CAS# 113-80-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg91， Ala96] - MBP (87 - 99)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Arg91， Ala96]-MBP (87-99)， human;VHFFRNIVTARTP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn1， Val5， Asn9] Angiotensin I， salmon, CAS# 86879-15-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn1，Val5]-Angiotensin II, CAS# 53-73-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn10，Leu11，D-Trp12]-pTH-Related Protein (7-34) amide (human， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn18] Endothelin-1， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn23]-beta-Amyloid (1-40)， Iowa Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn23]-beta-amyloid (1-42)， Iowa Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn370] tyrosinase (368–376), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn5]-Delta-Sleep Inducing Peptide, CAS# 80064-67-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn6，13，14]-beta-Amyloid (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn670，Leu671]-Amyloid β/A4 Protein Precursor770 (667-675), CAS# 150234-52-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn670，Leu671]-Amyloid β/A4 Protein Precursor770 (667-676), CAS# 186142-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn7]-beta-Amyloid (1-40)， Tottori-Japan Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn7]-beta-Amyloid (1-42)， Tottori-Japanese Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn76] PTH (64-84)， human, CAS# 129449-07-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asn8， Leu18] Parathyroid Hormone (1-34)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asp22] b-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asp37]-beta-Amyloid (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asp370]-Tyrosinase (368-376)??;YMDGTMSQV, CAS# 168650-46-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asp371] Tyrosinase(369-377)， human, CAS# 168650-46-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asp5，6，Me-Phe8] Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Asu 1，6] Oxytocin, CAS# 14317-68-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cit5]-TRAP-5, CAS# 287184-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys(Acm)2，7]-a-CGRP (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys(Acm)2，7]-a-CGRP(human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys(Acm)20，31]-EGF (20-31), CAS# 89991-90-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys: Acm20，31] Epidermal Growth Factor: 20-31, CAS# 89991-90-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys: Bzl84] CD: 81-92, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys0]-GTP-Binding Protein Gsa (28-42); GTP-Binding Protein Fragment， Gs alpha, CAS# 101038-78-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys18]-Atrial Natriuretic Factor (4-18) amide (rat), CAS# 111863-73-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys2， Tyr3， Orn5， Pen7]-Somatostatin 14 (7-14)， amide;fCYw(Orn)T(Pen)T-NH2(Disulfidebridge:2-7), CAS# 103429-31-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys2， Tyr3， Orn5， Pen7-amide]-Somatostatin 14 (7-14), CAS# 103429-31-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys20]-beta-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys21] Corticotropin Releasing Factor， human， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys26]-beta-Amyloid (1-40)， S26C beta-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys26]-beta-Amyloid (1-42)， S26C beta-Amyloid (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys26]-beta-amyloid (17-40)， S26C beta-amyloid (17-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys3， 6， Tyr8， Pro10]-Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys3，6， Tyr8， Pro10]-Substance P;RPCPQCFYGPM-NH2(Disulfidebridge:3-6), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys3，6， Tyr8， Pro9]-Substance P;RPCPQCFYPLM-NH2(Disulfidebridge:3-6), CAS# 141459-28-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys40]-beta-hairpin (BHA)， Protein G B1 Domain (41-56), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys58]105Y， α1 - antitrypsin (358 - 374), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys7]-beta-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys8，13]-Dynorphin A (1-13) amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Cys8] Renin Substrate Tetradecapeptide， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[CysCys21] Atrial Natriuretic Factor (3-28)， Rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala1] Peptide T， amide, CAS# 106362-34-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2， DArg6] Dynorphin A， (1-13)， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2， D-Leu5]-Enkephalin;YaGFL, CAS# 63631-40-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DAla2，: pClPhe3] b-Casomorphin， amide， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2，4，Tyr5] -b-Casomorphin (1-5)， amide， bovine, CAS# 98815-38-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2，DLeu5] Enkephalin amide, CAS# 66609-26-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2，DMet5] Enkephalin, CAS# 100929-50-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2，DPro4，Tyr5] -b-Casomorphin (1-5)， amide, CAS# 83936-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2，D-Pro4，Tyr5] -b-Casomorphin (1-5)， amide, CAS# 83936-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2，Hyp4，Tyr5]- b-Casomorphin (1-5) amide, CAS# 102029-98-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2，Leu5，Arg6] Enkephalin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2，Met5]- β-Casomorphin (1-5) ， bovine ，amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2，Met5]- β-Casomorphin (1-5)， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DAla2，Tyr5] b-Casomorphin: 1-5， amide， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DAla2] a-Neo-Endorphin: 1-2， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DAla2] b-Lipotropin (61-69), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2] Deltorphin I, CAS# 122752-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2] Deltorphin II, CAS# 122752-16-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DAla2] Dynorphin A (1-13)， amide， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2] Dynorphin A (1-9)， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DAla2] g-Endorphin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2] Leu-Enkephalin， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2] Met-Enkephalin, CAS# 61370-87-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2] Met-Enkephalin， amide, CAS# 61090-95-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2]- β-Casomorphin (1-4) amide (bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2]- β-Casomorphin (1-5) amide (bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2]- β-Casomorphin (1-5)， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DAla2]， Leu-Enkephalin, CAS# 64963-01-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2]-b-Casomorphin (1-6)， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2]-GRF (1-29) amide (human), CAS# 89453-59-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala2]-β-Casomorphin (1-3) amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ala4]-Substance P (4-11), CAS# 81381-50-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DAla6] LH-RH, CAS# 51230-19-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg0，Hyp2，3，D-Phe7]-Bradykinin, CAS# 111929-26-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg0，Hyp3，D-Phe7，Leu8]-Bradykinin, CAS# 135701-67-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg0，Hyp3，D-Phe7]-Bradykinin, CAS# 109333-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg1，D-Phe5，D-Trp7，9，Leu11]-Substance P, CAS# 96736-12-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg1，D-Pro2，D-Phe7，D-His9]-Substance P, CAS# 115760-58-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg1，D-Pro2，D-Trp7，9，Leu11]-Substance P, CAS# 84676-91-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg1，D-Trp5，7，9，Leu11]-Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg1，D-Trp7，9，Leu11]-Substance P, CAS# 91224-37-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg2，Lys4]-Dermorphin (1-4)， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg2，Sar4]-Dermorphin (1-4), CAS# 90549-86-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg2] Dermorphin (1-4)， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg2]- Kyotorphin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg2]- Kyotorphin, CAS# 70904-57-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg25]-Neuropeptide Y， human， rat: [D-Arg25]-NPY， human， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg25]-Neuropeptide Y， human， rat; [D-Arg25]-NPY， human， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg25]-Neuropeptide Y， human， rat;YPSKPDNPGEDAPAEDMARYYSALrHYINLITRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg6，Asn10]-MCH (6-16) amide (human， mouse， rat), CAS# 440635-61-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg6] - Dynorphin A (1 - 13)， porcine, CAS# 75921-87-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg8] - Dynorphin A (1 - 13)， porcine, CAS# 125357-12-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Arg8]-Dynorphin A (1-13)， porcine;YGGFLRRrRPKLK, CAS# 125357-12-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Asp1]-Amyloid- b-Protein (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Cys6，Asn7，D-Ala11，Cys14]-Bombesin (6-14), CAS# 349657-39-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Deamino1， Arg8] Vasopressin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Deamino-Cys1， D-Arg8]-Vasopressin， free acid;3-Mercaptopropionyl-YFQNCPrG(Disulfidebridge:1-6), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Deamino-Cys1，D-3-PyridylAla2，Arg8] Vasopressin, CAS# 136105-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Deamino-Pen1，Val4，DArg8] Vasopressin, CAS# 64158-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DehydroPro2，4， Pro9]-Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Dehydro-Pro4] Substance P (4-11), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des - His1， Glu9] - Glucagon (1 - 29)， amide, CAS# 110084-95-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des Asp10]Decorsin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Ac， Biotin] ICE Inhibitor III, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Ac] a-MSH， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Ac]-α-MSH， amide;SYSMEHFRWGKPV-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Acetyl]-a-MSH, CAS# 53697-27-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Ala1，des-Gly2，His4，5，D-Trp8]-Somatostatin-14, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Arg1]-Bradykinin;PPGFSPFR, CAS# 16875-11-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Arg10]-HOE I40;rRP-Hyp-G-Thi-S-(D-Tic)-Oic, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Arg30，Des-Pro31]-Dendroaspis Natriuretic Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Asp10]Decorsin， Leech, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Asp187，Met186]-Melanocyte Protein PMEL 17 (185-193) (human， bovine， mouse), CAS# 255710-51-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Asp187]-Melanocyte Protein PMEL 17 (185-193) (human， bovine， mouse), CAS# 319927-23-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Gln16]-PACAP (6-27)， amide， human， ovine， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Gln16]-PACAP (6-27)， amide， human， ovine， rat;FTDSYSRYRKMAVKKYLAAVL-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Gly10，Dleu6， ProNHEt9] LH-RH， AcetateLeuprolide， Acetate, CAS# 74381-53-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Gly77，His78] Myelin Basic Protein (68-84)， bovine, CAS# 98474-59-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-His1， Glu9] - Glucagon (1 - 29)， amide, CAS# 110084-95-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-His1， Glu9]-Glucagon (1-29)， amide;SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2, CAS# 110084-95-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-His1，Glu9] Glucagon, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Leu26，Cys(Acm)20，31]-EGF (20-31), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Leu9]-Kinetensin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-octanoyl]-Ghrelin， human, CAS# 313951-59-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-octanoyl]-Ghrelin， human;GSSFLSPEHQRVQQRKESKKPPAKLQPR, CAS# 313951-59-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-octanoyl]-Ghrelin， rat, CAS# 307950-60-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-octanoyl]-Ghrelin， rat;GSSFLSPEHQKAQQRKESKKPPAKLQPR, CAS# 307950-60-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Pro2] Bradykinin, CAS# 80943-05-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Ser1] Cerebellin, CAS# 94245-80-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Thr5]-Glucagon, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Thr7]-Glucagon, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1，DPen2，5] Enkephalin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1，DPen2，Pen5] Enkephalin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1] b-Casomorphin， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1] Dynorphin A (1-8), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1] Dynorphin A: 1-8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1] g-Endorphin, CAS# 67810-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1]- g-Endorphin, CAS# 67810-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1] Leu-Enkephalin, CAS# 60254-83-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1] Met-Enkephalin, CAS# 61370-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Des-Tyr1]-β-Endorphin， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DGlp1，DPhe2，DTrp3，6]-LH-RH, CAS# 68059-94-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Glu5，D-Trp7，9，10]-Substance P (5-11), CAS# 289632-61-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-His26]-Neuropeptide Y， human， rat: [D-His26]-NPY， human， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-His26]-Neuropeptide Y， human， rat; [D-His26]-NPY， human， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-His26]-Neuropeptide Y， human， rat;YPSKPDNPGEDAPAEDMARYYSALRhYINLITRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor, CAS# 39705-60-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DLeu6， Val7]-LH-RH (1-9) Ethyl Amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Lys16]-ACTH(1-24), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Lys16]-ACTH（1-24）, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Lys3]- GHRP- 6, CAS# 136054-22-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DLys6] LH-RH, CAS# 130751-49-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Met2，Pro5] Enkephalin， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pen2， 5]-Enkephalin;Y-(D-Pen)-G-F-(D-Pen), CAS# 88373-73-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe11]-Neurotensin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe11]-Neurotensin;Pyr-LYENKPRRPfIL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe12， Leu14]-Bombesin;Pyr-QRLGNQWAVGfLL-NH2, CAS# 108437-88-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe12，Leu14]-Bombesin, CAS# 108437-88-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe12，Nle21，38]-CRF (12-41) (human， rat), CAS# 129133-27-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe12]-Bombesin, CAS# 108437-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe12]-Bombesin;Pyr-QRLGNQWAVGfLM-NH2, CAS# 108437-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DPhe2，5，: pClPhe4] Enkephalin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DPhe2，6， Pro3]-LH-RH, CAS# 67019-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe2，6，Pro3]-LHRH, CAS# 67019-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DPhe2，DAla6] LH-RH, CAS# 54784-44-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe2]-VIP (human， bovine， porcine， rat), CAS# 104051-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe6，Leu-NHEt13，des-Met14]-Bombesin (6-14), CAS# 124199-90-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe7， D-Trp10]-Somatostatin 14 (7-14), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe7， D-Trp10]-Somatostatin 14 (7-14);fCYwKTCT(Disulfidebridge:8-13), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe7] a-MSH， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe7]-ACTH， α-MSH (1-13)， amide;SYSMEHfRWGKPV-NH2, CAS# 53697-27-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe7]-Bradykinin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe7]-Bradykinin;RPPGFSfFR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Phe7]-Somatostatin-14, CAS# 64813-74-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro10]-Dynorphin A (1-11)， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro194]-IL-1 b (193-195) (human), CAS# 117027-34-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro2， D-Trp6，8， Nle10]-Neurokinin B;DpHDFwVwL-Nle-NH2, CAS# 109212-72-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro2， D-Trp7，9]-Substance P, CAS# 80434-86-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro2，D-Phe7，D-Trp9]-Substance P, CAS# 77275-70-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro2，D-Trp6，8，Nle10]-Neurokinin B, CAS# 109212-72-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DPro2，DTrp7，9] Substance P, CAS# 80434-86-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DPro2] b-Casomorphin: 1-4， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro2]-b-Casomorphin (1-5) ， bovine， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro2]-b-Casomorphin (1-5) ，bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro4，D-Trp7，9，10，Val8]-Substance P (4-11), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro4，D-Trp7，9，10]-Substance P (4-11), CAS# 86917-57-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Pro4，D-Trp7，9，Nle11]-Substance P (4-11), CAS# 89430-34-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DPro4，DTrp7，9] Substance P: 4-11, CAS# 81039-85-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DPro4] b-Casomorphin (1-4)， amide， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DPro5] Corticotropin Releasing Factor， human， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DSer(tBu)6， Des-Gly10]-LH-RH， Ethyl Amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ser1]-ACTH (1-24)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ser13]-Somatostatin-14, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ser14] - Humanin (HN), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ser14]-Humanin (HN), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Ser2] Leu-Enkephalin-Thr, CAS# 75644-90-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DThr2] Leu-Enkephalin-Thr, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp11]-Neurotensin, CAS# 73634-68-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp11]-Neurotensin;Pyr-LYENKPRRPwIL, CAS# 73634-68-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp12，Tyr34]-pTH (7-34) amide (bovine), CAS# 118102-98-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp2，7，9]-Substance P, CAS# 100930-11-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp2] Met-Enkephalin， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp32]-Neuropeptide Y (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp32]-Neuropeptide Y (porcine), CAS# 153549-78-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp32]-Neuropeptide Y， human， rat;YPSKPDNPGEDAPAEDMARYYSALRHYINLIwRQRY-NH2, CAS# 178861-83-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp34]-Neuropeptide Y， human: [D-Trp34]-NPY， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp34]-Neuropeptide Y， human; [D-Trp34]-NPY， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp34]-Neuropeptide Y， human;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRwRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp6，8，9]-Galanin (1-15)-ol;GWTLNwAwwLLGPHA-ol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DTrp6]-LH-RH Triptoreline， Ethyl Amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp8，D-Cys14]-Somatostatin-14, CAS# 61950-59-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DTrp8，Tyr11] Somatostatin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Trp8]-Somatostatin-14, CAS# 58976-46-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Tyr11]-Neurotensin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Tyr11]-Neurotensin;Pyr-LYENKPRRPyIL, CAS# 39379-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Tyr27，36， D-Thr32]-Neuropeptide Y (27-36)， rat; [D-Tyr27，36， D-Thr32]-NPY (27-36)， rat, CAS# 163887-48-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Tyr27，36， D-Thr32]-Neuropeptide Y (27-36)， rat;yINLItRQRy-NH2, CAS# 163887-48-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Tyr27，36， D-Thr32]-Neuropeptide Y， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Tyr27，36， D-Thr32]-Neuropeptide Y， human;YPSKPDNPGEDAPAEDMARYYSALRHyINLItRQRy-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Tyr6， ?-Ala11， ?-Phe13， Nle14]-Bombesin (1-14);Pyr-QRLGyQWAV-(?-A)-H-(?-F)-Nle-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Tyr6， ?-Ala11， Phe13， Nle14]-Bombesin (6-14);yQWAV-(?-A)-HF-Nle-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Tyr6， b-Ala11， β-Phe13， Nle14]-Bombesin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Val22， Phe33] Big Endothelin-1 (16-38)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[DVal22， Phe33] Big Endothelin-1: 16-38， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[D-Val22] Big Endothelin-1 (16-38)， human, CAS# 158884-64-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Fmoc-Glu70，Ala71，72，Lys74]-C3a (70-77), CAS# 145082-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gla17，21，24]-Osteocalcin (1-49);YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV(Gla=γ-CarboxyglutamicAcid:Disulfidebridge:23-29), CAS# 136461-80-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln11] b-Amyloid: 1-40?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln11] -β- Amyloid (1 - 16), CAS# 133605-53-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln11] -β- Amyloid (1 - 28), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln11] -β- Amyloid (1 - 40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln11]-beta-Amyloid (1-16), CAS# 133605-53-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln11]-beta-Amyloid (1-16);DAEFRHDSGYQVHHQK, CAS# 133605-53-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln11]-beta-Amyloid (1-40), CAS# 106686-61-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln11]-beta-Amyloid (1-40);DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, CAS# 106686-61-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln144] - PLP (139 - 151)， Q144 - PLP(139 - 151), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln144]-PLP (139-151)， Q144-PLP(139-151);HSLGKQLGHPDKF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln18]-Platelet Factor 4 (15-22) (human), CAS# 144207-60-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22， Asn23]-beta-Amyloid (1-40)， E22Q/D23N Dutch/Iowa double mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22] - 25359 - Amyloid (6 - 40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22] ?Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22] -β- Amyloid (1 - 40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22]-25359-Amyloid (6-40);HDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22]-beta-Amyloid (1-40)， Dutch Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22]-beta-Amyloid (1-40);DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22]-beta-Amyloid (1-42)， E22Q Dutch Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22]-beta-Amyloid (15-23), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22]-beta-Amyloid (6-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln22]-beta-Amyloid (6-40);HDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln4] Neurotensin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln4]-Neurotensin;Pyr-LYQNKPRRPYIL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln8， Gln9] Helodermin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln8] LH-RH， chicken, CAS# 47922-48-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln9]-Amyloid β-Protein (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gln9]-beta-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glp5，(Me)Phe8，Sar9] Substance P (5-11), CAS# 77128-69-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glp5，Sar9] Substance P (5-11), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glu1] Fibrinopeptide B， human, CAS# 103213-49-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glu1] TRH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glu10] - ACTH (1-17), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glu10]-ACTH (1-17);SYSMEHFRWEKPVGKKR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glu2]-TRH, CAS# 85541-78-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glu27] Protein Kinase C (19-36), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glu3，4，7，10，14]-Conantokin G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Glu32]-Charybdotoxin;Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKECRCYS(Disulfidebridge:7-28，13-33and17-35), CAS# 321854-18-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly1，Ser3，22，Gln4，34，Thr6，Ala19，Tyr21，Ala23，31， Aib32]-Pancreatic Polypeptide (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly10，11]-beta-Amyloid (1-11), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly102]-MCC (88-103)， MCCpT102G;ANERADLIAYLKQAGK, CAS# 213260-63-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly11] Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly21]-beta-Amyloid (1-40)， A21G， Flemish Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly21]-beta-Amyloid (1-42)， A21G Flemish Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly22] -β- Amyloid (1 - 40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly22]-?-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly22]-Amyloid β-Protein (1-42), CAS# 1802086-23-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly22]-beta-Amyloid (1-40)， Arctic Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly22]-beta-Amyloid (1-40);DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly22]-beta-Amyloid (1-42)， Arctic Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly28，Cys30]-Amyloid β-Protein (1-30), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly30， Cys31] β-Amyloid (13-31)??NEW;HHQKLVFFAEDVGSNKGGC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly30，Cys31]- b-Amyloid (13-31), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Gly35， Asp37]-beta-Amyloid (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[His1， Lys6] - GHRP， GHRP- 6, CAS# 87616-84-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[His1，Nle27] GHRF (1-32)， amide， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[His11]Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[His7] Corazonin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile12， Val15] MUC5AC Analog 3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile161]MAGE - A2 (157-166), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile3] Pressinoic Acid, CAS# 34330-23-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile34] Beta-Amyloid (25-34);GSNKGAIIGI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile34]-beta-Amyloid (25-34), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile34]-β- Amyloid (25 - 34), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile7] Angiotensin III, CAS# 52498-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile76]-TNF-a (70-80) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile8]-Oxytocin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile-Ser] - Bradykinin (T - Kinin), CAS# 86030-63-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ile-Ser]-Bradykinin (T-Kinin);ISRPPGFSPFR, CAS# 86030-63-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu116]-Prepro-Neuromedin U (104-136) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu13] Motilin， human， porcine, CAS# 59530-69-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu144， Arg147]-PLP (139-151)， [L144， R147-PLP(139-151)];HSLGKLLGRPDKF, CAS# 188859-65-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu144，Arg147]-Myelin Proteolipid Protein(139-151), CAS# 188859-65-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu144] - PLP (139 - 151)， L144 - PLP(139 - 151), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu144]-PLP (139-151)， L144-PLP(139-151);HSLGKLLGHPDKF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu15]-Gastrin I (human), CAS# 39024-57-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu17， D-Trp32]-Neuropeptide Y， human;YPSKPDNPGEDAPAEDLARYYSALRHYINLIwRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu18] Parathyroid Hormone (1-34)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu27]-Melan-A， MART 1 (26-35);ELAGIGILTV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu28]-Melan-A (27-35);ALGIGILTV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu31， Pro34]-Neuropeptide Y， human， rat;YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2, CAS# 132699-73-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu31， Pro34]-Neuropeptide Y， porcine;YPSKPDNPGEDAPAEDARYYSALRHYINLLTRPRY-NH2, CAS# 125580-28-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu31， Pro34]-Peptide YY， human;YPIKPEAPGEDASPEELNRYYASLRHYLNLLTRPRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu31， Pro34]Peptide YY， PYY， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu31，Pro34]-Neuropeptide Y (13-36) (human， rat), CAS# 302798-54-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu31，Pro34]-Neuropeptide Y (human， rat), CAS# 132699-73-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu31，Pro34]-Neuropeptide Y (porcine), CAS# 125580-28-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu31，Pro34]-Peptide YY (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu33]-beta-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu35]-beta-Amyloid (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu37]-beta-Amyloid (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu5]-Enkephalin;YGGFL, CAS# 58822-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu8， Des-Arg9] - Bradykinin, CAS# 64695-06-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu8， Des-Arg9]-Bradykinin;RPPGFSPL, CAS# 64695-06-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu8，D-Trp22，Tyr25]-Somatostatin-28, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Leu8] Renin Substrate Tetradecapeptide， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys0] - Bradykinin (Kallidin), CAS# 342-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys0] - γ - 1 - MSH (41 - 58)， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys0] g-1-MSH， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys0]-Bradykinin (Kallidin);KRPPGFSPFR, CAS# 342-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys0]-γ-1-MSH (41-58)， amide;KYVMGHFRWDRFG-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys1， Pro2，5，Arg3，4，Tyr6] VIP， human， porcine， rat， ovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys1015，1024]-Thrombospondin-1 (1015-1024) (human， bovine， mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys15]-Amyloid β-Protein (15-21), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys22] b-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys22] b-Amyloid: 1-40, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys22]-beta-Amyloid (1-40)， Italian Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys22]-beta-Amyloid (1-42)， Italian Mutation, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys3， Phe10， Tyr13] - Autocamtide - 2 - Related Inhibitory Peptide (AIP) Analog, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys3， Phe10， Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog;KKKLRRQEAFDAY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys3]–Bombesin, CAS# 66839-66-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys3]-Bombesin;Pyr-QKLGNQWAVGHLM-NH2, CAS# 66839-66-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys4] Sarafotoxin S6c, CAS# 116495-45-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys4]-Sarafotoxin 6c;CTCKDMTDEECLNFCHQDVIW(Disulfidebridge:1-15and3-11), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys5(Boc)]lanreotide acetate, CAS# 182482-12-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys5(Boc)]octreotate acetate, CAS# 133304-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys5， MeLeu9， NIe10]-Neurokinin A (4-10), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys5， NMeLeu9， NIe10]-Neurokinin A (4-10);DKFVG-(NMeL)-NIe-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys6] Leu-Enkephalin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys8，9]-Neurotensin (8-13);KKPYIL, CAS# 139026-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys8，Asn9] Neurotensin LANT-6 (8-13), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys8，Lys9]-Neurotensin (8-13), CAS# 139026-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys8] Deamino Vasopressin Desglycinamide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys8] LH-RH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys8] Vasopressin, CAS# 50-57-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys8] Vasopressin Desglycinamide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys8]-Conopressin S, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Lys8]-Vasotocin (free acid), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[MePhe8，Sar9] Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met: O21] Corticotropin Releasing Factor， ovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met: O24， DLys8， Phe9] ACTH: 4-9， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met]-beta-Amyloid (1-28)， mouse， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met]-beta-Amyloid (1-38), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met]-beta-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met]-beta-Amyloid (1-42)， mouse， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met2]-Deltorphin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5， Lys6， Arg7] a-Neo-Endorphin (1-7), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5， Lys6，7] a-Neo-Endorphin (1-7), CAS# 80237-40-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5， Lys6] a-Neo-Endorphin (1-6), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5，Arg6，7，Val8，Gly9] Enkephalin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5，Arg6，Gly7，Leu8] Enkephalin, CAS# 80501-44-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5，Arg6，Phe7] Enkephalin, CAS# 73024-95-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5，Arg6，Phe7] Enkephalin， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5，Arg6] Enkephalin, CAS# 76310-14-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5，Arg6] Enkephalin-Arg, CAS# 76496-10-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5]-Enkephalin;YGGFM, CAS# 58569-55-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5]-ENKEPHALIN-Arg-Gly-Leu, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Met5]-ENKEPHALIN-Arg-Phe, CAS# 100929-69-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Mpr1，Val4，DArg8] Vasopressin, CAS# 43157-23-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Mpr7， DAla9] ANP (7-28)， amide， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[N2-(N-Glycyl-L-histidyl)-L-lysinato(2-)]copper, CAS# 89030-95-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nal3]Octreotide acetate, CAS# 848820-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle10]-Neurokinin A (4-10), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle11] Substance P, CAS# 57462-42-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle13， Glu14] Motilin， human， porcine, CAS# 50881-15-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle13]-Motillin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle21，Tyr32] Corticotropin Releasing Factor， ovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle27]-GRF (1-29) amide (human), CAS# 91869-58-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle35] b-Amyloid: 1-40?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle35] beta-Amyloid (17-42);LVFFAEDVGSNKGAIIGL-Nle-VGGVVIA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle35]-beta-Amyloid (1-40);DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-Nle-VGGVV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle35]-beta-Amyloid (1-42);DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-Nle-VGGVVIA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle35]-Beta-Amyloid (25-35);GSNKGAIIGL-Nle, CAS# 163265-32-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle4，DPhe7] a-MSH， amide;Melanotan Ⅰ, CAS# 75921-69-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle4] a-MSH， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8，18， Tyr34] Parathyroid Hormone (1-34)， human, CAS# 78041-34-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8，18，Tyr34] Parathyroid Hormone (7-34)， amide， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8] Pancreastatin， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8] Somatostatin (1-28), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8’18，Tyr34]-pTH (1-34) amide (bovine), CAS# 64763-77-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8’18，Tyr34]-pTH (3-34) amide (bovine), CAS# 64297-16-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8’18，Tyr34]-pTH (7-34) amide (bovine), CAS# 71539-01-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8’21，Tyr34]-pTH (1-34) amide (rat), CAS# 105267-88-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8'18，Tyr34]-pTH (1-34) amide (bovine), CAS# 64763-77-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8'18，Tyr34]-pTH (3-34) amide (bovine), CAS# 64297-16-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8'18，Tyr34]-pTH (7-34) amide (bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Nle8'21，Tyr34]-pTH (1-34) amide (rat), CAS# 105267-88-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[NMePhe3， DPro4] b-Casomorphin: 1-4， amide， bovine, CAS# 83397-56-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[NMeTyr1] Dynorphin A: 1-13， amide， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pClPhe5，8] Bradykinin, CAS# 125229-63-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pGlu16]-VIP (16-28)， porcine;Pyr-MAVKKYLNSILN-NH2, CAS# 134907-86-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe1，Ser2，Tyr6]-PAR-1 (1-6) amide (human), CAS# 245329-02-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe1，Ser2]-TRAP-6, CAS# 374898-11-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe10] b-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe10] b-Amyloid: 1-40?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe13，Tyr19]-MCH (human， mouse， rat), CAS# 160201-86-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe1376] - Fibronectin Fragment (1371 - 1382), CAS# 174063-90-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe1376]-Fibronectin Fragment (1371-1382);RQDRVFHSRNSI, CAS# 174063-90-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe17] - Apelin 17, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe17]-Apelin 17;H-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe2， Nle4]-ACTH (1-24), CAS# 97773-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe2， Nle4]-ACTH (1-24);SFS-Nle-EHFRWGKPVGKKRRPVKVYP, CAS# 97773-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe2，Orn8]-Oxytocin, CAS# 2480-41-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe2]-TRH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe22] Big Endothelin-1 (19-37)， human, CAS# 189064-07-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe22] Big Endothelin-1: 19-37， human, CAS# 189064-07-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe34]-beta-Amyloid (25-35), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe4]-Dermorphin (1-4) amide, CAS# 118476-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe668]-Amyloid Precursor Protein (APP) (659-676), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe7] Dynorphin A (1-7)， amide， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe7] Dynorphin A (1-7)， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe7] Dynorphin A: 1-7， amide， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Phe7] Dynorphin A: 1-7， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pmp1，DTyr(OEt)2，Val4，Cit8] Vasopressin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pmp1，Tyr(OEt)2] AVP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pmp1，Tyr(OMe)2，Arg8] Vasopressin, CAS# 67269-08-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pmp1，Tyr(OMe)2，Orn8] Vasotocin, CAS# 77327-45-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pNO2Phe7，Nle11] Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro1，Tyr4]bombesin (1-14) synthetic GRP receptor ligand., CAS# 832724-21-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro18， Asp21] beta-Amyloid (17-21)， iAb5;LPFFD, CAS# 182912-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro18， Asp21] β - Amyloid (17 - 21)， iAb5, CAS# 182912-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro18， Asp21]-beta-Amyloid (17-21)， iAb5, CAS# 182912-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro31]-beta-Amyloid (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro34]-Neuropeptide Y， human， rat: [Pro34]-NPY， human， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro34]-Neuropeptide Y， human， rat; [Pro34]-NPY， human， rat, CAS# 128768-54-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro34]-Neuropeptide Y， human， rat;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRPRY-NH2, CAS# 128768-54-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro34]-Peptide YY， human;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRPRY-NH2, CAS# 179986-93-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro34]Peptide YY， PYY， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro7]-Neurokinin B, CAS# 120814-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro9] Substance P, CAS# 104486-69-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pro9]-Substance P;RPKPQQFFPLM-NH2, CAS# 104486-69-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pS119] CREB327 (113-126)， Biotinyl??;Biotin-ILSRRP(pS)YRKILND, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pSer5] - Kemptide， Biotinylated, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pSer5]-Kemptide， 5-TMR labeled;5-TMR-LRRA-pS-LG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pSer5]-Kemptide， Biotinylated， Amide;Biotin-LRRA-pS-LG-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pSer5]-Kemptide， Biotinylated;Biotin-LRRA-pS-LG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pSer5]-Kemptide， Biotinylated-LC;Biotin-LC-LRRA-pS-LG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pSer5]-Kemptide， HiLyte Fluor? 488 labeled;HiLyteFluor?488-LRRA-pS-LG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pSer5]-Kemptide;LRRA-pS-LG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[pY185]MAP (177 - 189) kinase, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr1] - Apelin-13, CAS# 217082-60-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr1]-Apelin-13;Pyr-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH, CAS# 217082-60-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr11]-Amyloid β-Protein (11-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr11]-beta-Amyloid (11-40);Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV, CAS# 192377-94-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr11]-beta-Amyloid (11-42);Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr16]-VIP (16-28) (chicken), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr16]-VIP (16-28) (human， bovine， porcine， rat), CAS# 134907-86-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr3]-Amyloid β-Protein (3-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr3]-beta-Amyloid (3-40);Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr-3]-beta-Amyloid (3-42), CAS# 183449-57-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr3]-beta-Amyloid (3-42);Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, CAS# 183449-57-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr4] - MBP (4 - 14), CAS# 136132-68-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr5]-Substance P (5-11), CAS# 56104-22-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr6，Pro9]-Substance P (6-11), CAS# 79775-19-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Pyr6]-Substance P (6-11), CAS# 61123-13-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar1，Ala8]-Angiotensin II, CAS# 38027-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar1，Gly8]-Angiotensin II, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar1，Ile4，8]-Angiotensin II, CAS# 185461-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar1，Thr8]-Angiotensin II, CAS# 53632-49-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar1，Val5， Ala8] Angiotensin II, CAS# 34273-10-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar1，Val5，Ala8]-Angiotensin II, CAS# 34273-10-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar1] Angiotensin II, CAS# 102029-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar1]-Angiotensin I/II (1-7) amide, CAS# 126112-22-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar9， Met(O2)11, CAS# 110880-55-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Sar9] Substance P, CAS# 77128-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser102]-MCC (88-103)， MCC (T102S);ANERADLIAYLKQASK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser140]-Myelin Proteolipid Protein (139-151) (depalmitoylated)， human， bovine， dog， mouse， rat, CAS# 122018-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser2] - Neuromedin C, CAS# 136058-54-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser2]-Neuromedin C;GSHWAVGHLM-NH2, CAS# 136058-54-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser25] - PKC (19 - 31), CAS# 136795-05-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser25] - PKC (19 - 31)， biotinylated, CAS# 177966-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser25] - PKC (19 - 36) Substrate, CAS# 113715-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser25]-PKC (19-31)， Biotinylated;K(Biotin)-RFARKGSLRQKNV, CAS# 177966-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser25]-PKC (19-31);RFARKGSLRQKNV, CAS# 136795-05-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser25]-PKC (19-36) Substrate;RFARKGSLRQKNVHEVKN, CAS# 113715-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser4，Ile8]-Oxytocin, CAS# 550-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Ser8]-GLP-1 (7-36) amide (human， bovine， guinea pig， mouse， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Succinyl-Asp6， NMePhe8]-Substance P (6-11)， Senktide;Suc-DF-(NMeF)-GLM-NH2, CAS# 106128-89-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[t-BuDSer6，: AzaGly10]-LH-RH, CAS# 145781-92-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Thi5，8，DPhe7] Bradykinin, CAS# 97825-07-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Thr28， Nle31]-Cholecystokinin (25-33)， sulfated;RD-Y(SO3H)-TGW-Nle-DF-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Thr30]-Neuropeptide Y， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Thr30]-Neuropeptide Y， human;YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Thr4，Gly7] Oxytocin, CAS# 60786-59-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Thr4，Gly7]-Oxytocin, CAS# 60786-59-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Thr46]-Osteocalcin (45-49) (human), CAS# 352279-02-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Thr6]-Bradykinin, CAS# 6120-63-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Trp11] Neurotensin (8-13), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Trp11]-Neurotensin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Trp3，Arg5]-Ghrelin (1-5), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Trp4]-beta-Amyloid (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Trp4]-Kemptide, CAS# 80224-16-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Trp63， 64] - C3a (63 - 77), CAS# 130154-64-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Trp63， 64]-C3a (63-77);WWGKKYRASKLGLAR, CAS# 130154-64-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Trp7，Leu8] LH-RH， Free Acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Trp7，β-Ala8]-Neurokinin A (4-10), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Try: OMe21] Neuropeptide Y， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr(OMe)21]-Neuropeptide Y， human;YPSKPDNPGEDAPAEDMARYY(OMe)SALRHYINLITRQRY-NH2, CAS# 131256-74-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0，DTrp8] Somatostatin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0，Nle8] Pancreastatin， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] - Neurokinin A, CAS# 116868-93-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] - Neurokinin B, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] - α - CGRP， [Tyr0] - α - CGRP， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] - α - CGRP， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] Atriopeptin II, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] BNP (1-32)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] Calcitonin Gene Related Peptide， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] Calcitonin Gene Related Peptide， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] Fibrinopeptide A， human, CAS# 103226-11-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] Gastric Inhibitory Peptide (23-42)， human; [Tyr22] Gastric Inhibitory Peptide (22-42)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] Gastric Inhibitory Peptide: 23-42， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0] Thymus Factor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Apelin-13 (human， bovine， mouse， rat), CAS# 1815617-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Atrial Natriuretic Peptide (5-27)， [Tyr0]-Atriopeptin II， rat;YSSCFGGRIDRIGAQSGLGCNSFR(Disulfidebridge:4-20), CAS# 117856-13-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Atriopeptin II (rat), CAS# 117856-13-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-BNP-32 (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Corticotropin Releasing Factor， [Tyr0]-CRF， human， rat;YSEEPPISLDLTFHLLREVLEEMARAEQLAQQAHSNRKLMEII-NH2, CAS# 100513-58-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Corticotropin Releasing Factor， [Tyr0]-CRF， ovine;YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-C-Peptide (dog), CAS# 101135-67-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-C-Peptide (human), CAS# 57327-90-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-C-Peptide， human, CAS# 57327-90-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-C-Type Natriuretic Peptide (32-53) (human， porcine， rat), CAS# 142878-79-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Hypercalcemia Malignancy Factor (1-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Hypercalcemia Malignancy Factor (1-40);YAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Neurokinin A;YHKTDSFVGLM-NH2, CAS# 116868-93-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Neurokinin B;YDMHDFFVGLM-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Prepro-Atrial Natriuretic Factor (104-123) (human), CAS# 309245-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-pTH-Related Protein (1-34) (human， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Somatostatin 28;YSANSNPAMAPRERKAGCKNFFWKTFTSC(Disulfidebridge:18-29), CAS# 86649-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Stresscopin (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Stresscopin-Related Peptide (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-Urocortin (rat), CAS# 187111-93-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-α-Calcitonin Gene Related Peptide， [Tyr0]-α-CGRP， rat;YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2(Disulfidebridge:2-7), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-α-CGRP， [Tyr0]-α-CGRP， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr0]-α-CGRP， human;YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2(Disulfidebridge:2-7), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr1] Adipokinetic Hormone， locust, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr1] -pTH (1-34)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr1] Somatostatin, CAS# 59481-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr1]-Delta-Sleep Inducing Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr1]-pTH (1-34) (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr1]-Somatostatin 14;YGCKNFFWKTFTSC(Disulfidebridge:3-14), CAS# 59481-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr1]-TRAP-7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr11] Head Activator;Pyr-PPGGSKVILY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr11]-Somatostatin-14, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr12] Somatostatin 28 (1-14), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr12]-Somatostatin-28 (1-14), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr123] Prepro Endothelin (110-130)， amide， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr15]-ACTH (7-15), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr15]-Fibrinopeptide B, CAS# 125455-56-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr19] Diazepam-Binding Inhibitor Fragment, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr22] - a - CGRP (22 - 37)， rat, CAS# 198277-54-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr22]-a-CGRP (22-37)，rat, CAS# 198277-54-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr22]-α-CGRP (22-37)， rat;YVKDNFVPTNVGSEAF-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr27]-a-CGRP (27-37) (canine， mouse， rat), CAS# 124501-79-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr27]-pTH (27-48) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr3，Lys5(Boc)]octreotide acetate, CAS# 147790-89-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr3]Octreotate acetate, CAS# 302794-43-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr34]-pTH (7-34) amide (bovine), CAS# 86292-93-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr36]-pTH-Related Protein (1-36) (human， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr38，Phe42，46]-Osteocalcin (38-49) (human), CAS# 129356-77-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr4， D-Phe12]-Bombesin;Pyr-QRYGNQWAVGfLM-NH2, CAS# 108437-89-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr4，D-Phe12]-Bombesin, CAS# 108437-89-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr4] - MBP (1 - 11), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr4]-Bombesin, CAS# 67338-70-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr4]-Bombesin;Pyr-QRYGNQWAVGHLM-NH2, CAS# 67338-70-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr4]-MBP (1-11);Ac-ASQYRPSQRHG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr43] PTH (43-68) (human), CAS# 92952-95-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr5， D-Trp6，8，9， Arg10]-Neurokinin A (4-10);DYwVwwR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr5，D-Trp6，8，9，Arg-NH210]-Neurokinin A (4-10), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr5] Bradykinin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr52] PTH (52-84) (human), CAS# 89492-47-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr6，D-Phe7，D-His9]-Substance P (6-11), CAS# 145194-26-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr63] PTH (63-84)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr65，Phe67]-C5a (65-74) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr69，Ala71，72，Lys74]-C3a (69-77), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr8，Nle11] Substance P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr8] Bradykinin, CAS# 32222-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr8] Substance P, CAS# 55614-10-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr8]-Atrial Natriuretic Peptide (5-27)， [Tyr8]-Atriopeptin II， rat;SSCYGGRIDRIGAQSGLGCNSFR(Disulfidebridge:3-19), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr8]-Atrial Natriuretic Peptide (5-27)， rat: [Tyr8]-Atriopeptin II， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr8]-Atrial Natriuretic Peptide (5-27)， rat; [Tyr8]-Atriopeptin II， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr9]- β-MSH (porcine): (Tyr49)-β-Lipotropin (41-58) (porcine), CAS# 198281-81-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Tyr9]- β-MSH (porcine); (Tyr49)-β-Lipotropin (41-58) (porcine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val3]b-Casomorphin (1-4)， amide， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val3]-β-Casomorphin (1-4) amide (bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val35] -β - Amyloid (1 - 42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val4] Angiotensin III, CAS# 100900-28-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val4]-Angiotensin III, CAS# 100900-28-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val438]-Tyrosinase (432-444) (human), CAS# 320341-56-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val5，Asn9]-Angiotensin I, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val5] Angiotensin I， human, CAS# 484-43-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val5] Angiotensin II， human, CAS# 5649-07-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val671]-Amyloid b/A4 Protein Precursor770 (667-676), CAS# 252256-43-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val671]-Amyloid b/A4 Protein Precursor770 (667-676), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[Val8] Renin Substrate Tetradecapeptide， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[β-Ala70]-C3a (70-77), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

[β-Ala8]-Neurokinin A (4-10), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

{ASP}{ARG}{VAL}{TYR}{ILE}{HIS}{d-ALA}, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

|á-Secretase Substrate I， Fluorogenic, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(1，5-Naphthyridin-3-yl)ethanone, CAS# 1246088-62-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(1-ethoxyethyl)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(1H-Pyrrolo[2，3-b]pyridin-5-yl)-ethanone, CAS# 944937-14-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2-((tert-Butyldimethylsilyloxy)methyl)furo[3，2-b]pyridin-6-yl)ethanone, CAS# 1203499-37-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2-(Trimethylsilyl)furo[3，2-b]pyridin-6-yl)ethanone, CAS# 1228666-31-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2，5，6-Trimethoxypyridin-3-yl)ethanone, CAS# 1414864-08-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2-Chloro-5-fluoropyridin-3-yl)ethanone, CAS# 1203499-12-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2-Chloro-5-methylpyridin-3-yl)ethanone, CAS# 885223-64-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2-Fluoro-6-(pyrrolidin-1-yl)pyridin-3-yl)ethanone, CAS# 1203499-51-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2-Fluoro-6-(pyrrolidin-1-yl)pyridin-4-yl)ethanone, CAS# 1228665-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2-isopropylthiazol-4-yl-N-MethylMethanaMine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2-Methoxy-5-methylpyridin-3-yl)ethanone, CAS# 1203499-64-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(2-Methoxy-6-(pyrrolidin-1-yl)pyridin-3-yl)ethanone, CAS# 1228666-25-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(3-Carboxypyrid-2-yl)-2-phenyl-4-methyl-piperazine, CAS# 61338-13-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(3-Iodo-1H-pyrrolo[2，3-b]pyridin-5-yl)ethanone, CAS# 1015609-03-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(3-Methyl-3H-imidazo[4，5-b]pyridin-6-yl)ethanone, CAS# 1186310-80-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(4-Amino-6，7-dimethoxy-2-quinazolinyl)4-[(tetrahydro-2-furanyl)carbonyl]piperazine hydrochloride, CAS# 63074-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(4-Methoxybenzyl)-2-oxo-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazine-6-carbonitrile, CAS# 1203499-67-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(4-Methoxybenzyl)-6-((trimethylsilyl)ethynyl)-1H-pyrido[2，3-b][1，4]oxazin-2(3H)-one, CAS# 1198425-56-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(4-Nitrobenzyloxycarbonyl)benzotriazole, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(5，6-Dimethoxypyridin-2-yl)ethanone, CAS# 1203499-03-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(5-Bromo-2-chloropyridin-3-yl)ethanone, CAS# 886365-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(5-Bromo-3-fluoropyridin-2-yl)ethanone, CAS# 1160936-52-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(5-Bromo-3-nitropyridin-2-yl)piperazine, CAS# 1203499-08-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(5-Fluoro-1H-pyrrolo[2，3-b]pyridin-4-yl)ethanone, CAS# 1228666-59-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(5-Methoxypyridin-3-yl)ethanone, CAS# 886364-74-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(5-Methyl-1H-pyrrolo[2，3-b]pyridin-3-yl)ethanone, CAS# 1222533-85-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(6-(3-((tert-Butyldimethylsilyloxy)methyl)pyrrolidin-1-yl)-2-fluoropyridin-3-yl)ethanone, CAS# 1228666-50-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(6-(3-Hydroxypropyl)-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazin-1-yl)-2，2-dimethylpropan-1-one, CAS# 1299607-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(6-(3-Hydroxypropyl)-3，4-dihydro-1，8-naphthyridin-1(2H)-yl)-2，2-dimethylpropan-1-one, CAS# 1222533-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(6-(Dimethoxymethyl)-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazin-1-yl)-2，2-dimethylpropan-1-one, CAS# 1261365-93-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(6-Bromo-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazin-1-yl)-2，2-dimethylpropan-1-one, CAS# 1228666-49-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(6-Fluoro-3，4-dihydro-1，8-naphthyridin-1(2H)-yl)-2，2-dimethylpropan-1-one, CAS# 1222533-74-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(6-Iodo-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazin-1-yl)-2，2-dimethylpropan-1-one, CAS# 1228665-79-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(6-Iodo-7-methyl-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazin-1-yl)-2，2-dimethylpropan-1-one, CAS# 1261365-43-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(7-bromo-4-methyl-3，4-dihydropyrido[2，3-b]pyrazin-1(2H)-yl)-2，2-dimethylpropan-1-one, CAS# 1142192-65-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(7-bromo-6-(3-((tert-Butyldimethylsilyl)oxy)propyl)-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazin-1-yl)-2，2-dimethylpropan-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(Diphenylmethyl)-3-hydroxyazetidine, CAS# 18621-17-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(Diphenylmethyl)-3-hydroxyazetidine hydrochloride, CAS# 90604-02-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(Furo[3，2-b]pyridin-6-yl)ethanone, CAS# 1203499-00-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(N-Acetylmuramyl-alanyl-isoglutaminyl)-2，3-dipalmitoyl-sn-glycerol, CAS# 95238-29-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1(S)-Amino-5-phosphonoindan-1-carboxylic acid, CAS# 220029-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(tert-Butoxycarbonyl)-5-chloro-1H-pyrrolo[3，2-b]pyridine-3-boronic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(tert-Butoxycarbonyl)-5-methyl-1H-pyrrolo[2，3-b]pyridine-3-carboxylic acid, CAS# 1198097-92-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(tert-Butyl[dimethyl]silyl)-7-methyl-1H-indole-3-boronic acid pinacol ester, CAS# 1263986-66-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(tert-Butyldimethylsilyl)-5-methyl-1H-indole-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(Toluene-4-sulfonyl)-1H-indole-3-boronic acid pinacol ester, CAS# 1073354-51-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(Toluene-4-sulfonyl)-1H-pyrrolo[2，3-b]pyridine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-(Triisopropylsilyl)-1H-indole-3-boronic acid, CAS# 208655-73-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，1'-(5-Methyl-1H-pyrrolo[2，3-b]pyridine-1，3-diyl)diethanone, CAS# 1222533-87-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，1，1-Tris(4-hydroxyphenyl)ethane, CAS# 27955-94-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，10-Phenanthroline hydrate, CAS# 5144-89-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，1-dimethylbiguanide hydrochloride, CAS# 1115-70-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，1'-Thiocarbonyldiimidazole, CAS# 6160-65-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，2，3，5-Tetra-O-acetyl-β-D-ribofuranose, CAS# 13035-61-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，2:5，6-Bis-O-(1-methylethylidene)-D-mannitol, CAS# 1707-77-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，2-BIS(2-AMINOPHENOXY)ETHANE-N，N，N，N-TETRAACETIC ACID ACETOXYMETHYL ESTER, CAS# 126150-97-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，2-cyclopentane dicarboxylic acid, CAS# 1461-97-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，2-Dichloropropane, CAS# 78-87-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，2-Dihexanoyl-SN-glycerol, CAS# 30403-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，2-Pyrrolidinedicarboxylicacid， 4-fluoro-， 1-(1，1-dimethylethyl) ester， (2S，4S)-, CAS# 203866-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，2-Pyrrolidinedicarboxylicacid， 4-oxo-， 1-(1，1-dimethylethyl) 2-methyl ester， (2S)-, CAS# 102195-80-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，3-Dichloropropene, CAS# 542-75-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，3-Dimethylxanthine calcium, CAS# 37287-41-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，4-Cineole, CAS# 470-67-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，4-DIACETOXY-2-OXABUTANE, CAS# 59278-00-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，4-DIACETYLBENZENE, CAS# 1009-61-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，4-DIAMINO-2，3-DICYANO-1，4-BIS(2-AMINOPHENYLTHIO)BUTADIENE, CAS# 109511-58-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，4-Dithio-DL-threitol, CAS# 578517,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，5-Anhydro-4，6-O-benzylidene-2，3-dideoxy-2-[5-methyl-1H-pyrimidine-2，4-dione-1-yl]-D-glucitol, CAS# 852235-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，5-Diazabicyclo[4.3.0]non-5-ene, CAS# 3001-72-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，5-Diphenylcarbazide, CAS# 140-22-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，5-Naphthyridin-3-amine, CAS# 14756-77-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，5-Naphthyridin-3-ol, CAS# 14756-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，5-Naphthyridine-3-boronic acid pinacol ester, CAS# 1356165-79-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，5-Naphthyridine-3-carbaldehyde, CAS# 959617-49-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，5-Naphthyridine-3-carbonitrile, CAS# 1142927-37-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，5-Naphthyridine-3-carboxylic acid, CAS# 90418-64-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，6-Naphthyridine, CAS# 253-72-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，8-ANS, CAS# 82-76-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，8-Diacetoxy-3-carboxyanthraquinone, CAS# 13739-02-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1，9-Pyrazoloanthrone, CAS# 129-56-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-[(3，4-DICHLOROPHENYL)METHYL]-1H-INDOLE-2，3-DIONE, CAS# 79183-19-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-[[4-[(4-Fluoro-2-methyl-1H-indol-5-yl)oxy]-5-methylpyrrolo[2，1-f][1，2，4]triazin-6-yl]oxy]-2-propanolBrivanibTyrosine Kinase Inhibitor, CAS# 649735-46-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-[4-[3-Ethyl-7-(morpholin-4-yl)-3H-[1，2，3]triazolo[4，5-d]pyrimidin-5-yl]phenyl]-3-[4-[(4-methylpiperazin-1-yl)carbonyl]phenyl]urea, CAS# 1173204-81-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-[4-Bromo-3-(chloromethyl)phenyl]ethanone, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-[tert-Butyl(Dimethyl)Silyl]-1H-Indole-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-{2-[5-(2-Methoxy-ethoxy)-benzoimidazol-1-yl]-quinolin-8-yl}-piperidin-4-ylamineCP 673451, CAS# 343787-29-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

10% Iron chelate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

10，11-Dihydro-11-oxodibenzo[b，f][1，4]thiazepine, CAS# 460029,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

10-Hydroxycamptothecin, CAS# 64439-81-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

10-Hydroxycamptothecin, CAS# 19685-09-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

10Panx, CAS# 955091-53-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

11，12-Dimethoxydihydrokawain, CAS# 93159-88-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

117854-17-8, CAS# 117854-17-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

11a，16b，17，21-Tetrahydroxy-pregna-1，4-diene-3，20-dione, CAS# 13951-70-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

11a-Hydroxy-16，17a-epoxyprogesterone, CAS# 19427-36-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

11-alpha-Hydroxycarvenone, CAS# 192569-17-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

11-Aminoundecanoic acid, CAS# 2432-99-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

12(S)-Hydroxy-16-heptadecynoic acid, CAS# 148019-74-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

15-28-Somatostatin-28, CAS# 38916-34-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

16a，17a-Epoxyprogesterone, CAS# 1097-51-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

16alpha-Hydroxyprednisonlone acetate, CAS# 86401-80-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

16-BETA METHYL EPOXIDE, CAS# 981-34-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

16-beta Methyl Epoxide, CAS# 24916-90-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

16-Dehydropregnenolone acetate, CAS# 979-02-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

17-(3-pyridyl)-5，16-androstadien-3beta-acetate, CAS# 154229-18-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

17a-Hydroxyprogesterone caproate, CAS# 630-56-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

17a-Methyl-1-testosterone, CAS# 23835,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

17a-Methyl-Drostanolone, CAS# 3381-88-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

17-Hydroxy-1a，2a-methylenepregna-4，6-diene-3，20-dione acetate, CAS# 2701-50-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

17-Methyltestosterone, CAS# 58-18-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

17α-Hydroxy-progesterone, CAS# 68-96-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

18-(tert-Butoxy)-18-oxooctadecanoic acid;OCTADECANEDIOIC ACID MONO-TERT-BUTYL ESTER, CAS# 843666-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

18-methoxy-18-oxooctadecanoic acid;Octadecanedioic acid, 1-methyl ester, CAS# 72849-35-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

19-Hydroxy-androst-4-ene-3，17-dione, CAS# 510-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

19-Norandrost-5(10)-ene-3，17-dione, CAS# 3962-66-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

19-Norandrostenedione, CAS# 734-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Acetyl-1H-indol-3-yl acetate, CAS# 16800-67-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-ADAMANTANAMINE SULFATE, CAS# 31377-23-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Amino-1-deoxy-D-mannitol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-AMINO-3，3-DIETHOXYPROPANE, CAS# 41365-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-aminocyclobutane-1-carboxylic acid, CAS# 22264-50-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Aminocyclopentane-1-carboxylic acid, CAS# 52-52-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Aminocyclopropane-1-carboxylic acid, CAS# 22059-21-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Aminocyclopropane-1-carboxylic acid ethyl ester hydrochloride, CAS# 42303-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-AMINOHYDANTOIN, CAS# 1607470,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Aminohydantoin hydrochloride, CAS# 2827-56-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-androstene-3b-ol，17-one, CAS# 76822-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzenesulfonyl-1H-pyrrolo[2，3-b]pyridine-5-carbonitrile, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzenesulfonyl-3-iodo-1H-pyrrolo[2，3-b]pyridine, CAS# 887115-53-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzenesulfonyl-5-bromo-1H-pyrrolo[2，3-b]pyridine, CAS# 1001070-33-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzenesulfonyl-5-bromo-3-iodo-1H-pyrrolo[2，3-b]pyridine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzenesulfonyl-5-chloro-1H-pyrrolo[2，3-b]pyridine, CAS# 1015608-87-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzenesulfonyl-5-chloro-3-iodo-1H-pyrrolo[2，3-b]pyridine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzenesulfonyl-5-fluoro-1H-pyrrolo[2，3-b]pyridine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzenesulfonyl-5-fluoro-3-iodo-1H-pyrrolo[2，3-b]pyridine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzenesulfonyl-5-iodo-1H-pyrrolo[2，3-b]pyridine, CAS# 1227268-94-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzhydrylazetidine-3-carboxylic acid, CAS# 36476-87-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzyl-4(S)-hydroxy-pyrrolidin-2-one, CAS# 191403-66-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Benzyl-7-iodo-1H-pyrido[2，3-b][1，4]oxazin-2(3H)-one, CAS# 1203499-40-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-beta-D-Arabinofuranosylcytosine hydrochloride, CAS# 69-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Boc-3-azetidinone, CAS# 398489-26-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Boc-4-(Fmoc-amino)-piperidine-4-carboxylic acid, CAS# 183673-66-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Boc-4-cyanopiperidine, CAS# 91419-52-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Boc-azetidine-3-ylmethanol, CAS# 142253-56-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Chloroisoquinoline-4-boronic acid, CAS# 848841-48-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Cyclopentyl-3-(1H-pyrrolo[2，3-b]pyridin-5-yl)-1H-pyrazolo[3，4-d]pyrimidin-4-aminePP 121, CAS# 1092788-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-ETHYL-3-METHYLIMIDAZOLIUM BIS(TRIFLUOROMETHYLSULFONYL)IMIDE， 99% [EMIIM], CAS# 174899-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Fluoro-4-iodobenzene, CAS# 352-34-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Fmoc-4-(Fmoc-amino)-piperidine-4-carboxylic acid, CAS# 252029-00-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-iMidazole， 5，5'-[1，1'-biphenyl]-4，4'-diylbis[2-(2s)-2-pyrrolidinyl-， hydrochloride (1:4), CAS# 1009119-83-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Indazole-7-carboxylicacid, methyl ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Purin-6-amine sulfate, CAS# 321-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrazolo[3，4-b]pyridine-5-boronic acid pinacol ester, CAS# 1093819-50-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrazolo[3，4-b]pyridine-5-carbonitrile, CAS# 1234616-67-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrazolo[3，4-b]pyridine-5-carboxylic acid, CAS# 952182-02-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrido[2，3-b][1，4]oxazin-2(3H)-one, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridin-4-amine, CAS# 74420-00-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridin-4-ol, CAS# 74420-02-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridin-4-yl trifluoromethanesulfonate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridin-5-ol, CAS# 98549-88-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridin-5-ylamine, CAS# 100960-07-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridine-4-boronic acid pinacol ester, CAS# 942919-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridine-4-carbonitrile, CAS# 344327-11-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridine-4-carboxamide, CAS# 1086390-83-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridine-4-carboxylic acid, CAS# 479553-01-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridine-5-boronic acid pinacol ester, CAS# 754214-56-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridine-5-carbaldehyde, CAS# 849067-90-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridine-5-carbonitrile, CAS# 517918-95-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[2，3-b]pyridine-5-carboxylic acid, CAS# 754214-42-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[3，2-b]pyridin-6-amine, CAS# 1015609-67-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[3，2-b]pyridin-6-ol, CAS# 1015609-35-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-pyrrolo[3，2-b]pyridine, CAS# 272-49-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[3，2-b]pyridine-5-carbonitrile, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[3，2-b]pyridine-6-boronic acid pinacol ester, CAS# 1045855-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-pyrrolo[3，2-b]pyridine-6-carbaldehyde, CAS# 1020056-33-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[3，2-b]pyridine-6-carbonitrile, CAS# 944937-79-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1H-Pyrrolo[3，2-b]pyridine-6-carboxylic acid, CAS# 112766-32-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Hydroxybenzotriazole, CAS# 2592-95-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Indanone, CAS# 83-33-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Iodopropane, CAS# 107-08-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Methyl-1H-imidazole-2-carboxylic acid, CAS# 20485-43-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Methyl-1H-pyrrolo[2，3-b]pyridin-5-ol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Methyl-3-(trifluoromethyl)pyrazole-5-boronic acid pinacol ester, CAS# 1025719-23-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Methyl-4-(4-piperidinyl)piperazine, CAS# 53617-36-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Methyl-4-nitro-2-(trichloroacetyl)-1H-imidazole, CAS# 120095-64-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Methyl-4-nitro-2-(trichloroacetyl)-1H-pyrrole, CAS# 120122-47-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Methylpyrrolidine, CAS# 120-94-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Naphthalenylsulfonyl-Ile-Trp-aldehyde, CAS# 161709-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Naphthtaleneacetic acid, CAS# 86-87-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Naphthylamine, CAS# 134-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Naphtyol, CAS# 90-15-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Nitroso-2-naphthol, CAS# 131-91-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-O-Hexadecyl-2-O-acetyl-sn-glycero-3-phosphocholine, CAS# 74389-68-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Pivaloyl-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazine-6-carbaldehyde, CAS# 1228665-85-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Pivaloyl-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazine-6-carbonitrile, CAS# 1228666-61-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Pivaloyl-2，3-dihydro-1H-pyrido[2，3-b][1，4]oxazine-6-carboxylic acid, CAS# 1228665-93-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Pyrrolidinecarboxylicacid， 4-hydroxy-2-(hydroxymethyl)-， phenylmethyl ester， (2S，4R)-, CAS# 95687-41-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-tert-Butyl 3-methyl 4-formyl-1H-pyrrolo[2，3-b]pyridine-1，3-dicarboxylate, CAS# 1228666-48-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-tert-Butyl 3-methyl 4-oxopiperidine-1，3-dicarboxylate, CAS# 161491-24-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-tert-Butyl 5-methyl 1H-pyrazolo[3，4-b]pyridine-1，5-dicarboxylate, CAS# 1305325-08-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-tert-Butyl 6-methyl 2，3-dihydro-1H-pyrrolo[2，3-b]pyridine-1，6-dicarboxylate, CAS# 1305324-57-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-tert-Butyl-1H-pyrido[2，3-b][1，4]oxazin-2(3H)-one, CAS# 1203499-66-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-tert-Butyl-6-iodo-1H-pyrido[2，3-b][1，4]oxazin-2(3H)-one, CAS# 1203499-26-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

1-Tosyl-1H-Pyrrolo[2，3-b]pyridine-4-boronic acid pinacol ester, CAS# 916176-50-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(((tert-Butyldimethylsilyl)oxy)methyl)furo[3，2-b]pyridine-6-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((1-(tert-Butoxycarbonyl)pyrrolidin-3-yl)methoxy)pyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((2-Chloropyridin-4-yl)carbamoyl)-6-methylpyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((2-Methoxyethyl)amino)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((6-Methylpyridin-2-yl)carbamoyl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((Methoxycarbonyl)amino)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((tert-Butyldimethylsilyl)oxy)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((tert-Butyldimethylsilyloxy)methyl)-6-((trimethylsilyl)ethynyl)furo[3，2-b]pyridine, CAS# 1171920-57-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((tert-Butyldimethylsilyloxy)methyl)-6-(trimethylsilyl)furo[3，2-b]pyridine, CAS# 1171920-41-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((tert-Butyldimethylsilyloxy)methyl)-6-chlorofuro[3，2-b]pyridine, CAS# 1171920-42-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((tert-Butyldimethylsilyloxy)methyl)-6-iodofuro[3，2-b]pyridine, CAS# 1171920-30-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((tert-Butyldimethylsilyloxy)methyl)furo[3，2-b]pyridin-6-ol, CAS# 1171920-47-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((tert-Butyldimethylsilyloxy)methyl)furo[3，2-b]pyridine-6-carbaldehyde, CAS# 1171920-38-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((tert-Butyldimethylsilyloxy)methyl)furo[3，2-b]pyridine-6-carbonitrile, CAS# 1186310-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((tert-Butyldimethylsilyloxy)methyl)furo[3，2-b]pyridine-6-carboxylic acid, CAS# 1171920-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((Trimethylsilyl)ethynyl)pyridin-3-amine, CAS# 947330-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-((Trimethylsilyl)ethynyl)pyridin-3-ol, CAS# 556832-92-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-([(tert-butyldimethylsilyl)oxy]methyl)pyridine-4-boronic acid pinacol ester, CAS# 880495-84-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1-(ethylsulfonyl)azetidin-3-ylidene)acetonitrile, CAS# 1187595-85-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1(R)-Methyl-2-oxo-4(R)-isopropenyl-6(R)-hydroxycyclohexyl)acetic acid-γ-lactone, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1(R)-Methyl-2-oxo-4(R)-isopropyl-6(R)-hydroxycyclohexyl)acetic acid-γ-lactone, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1H-imidazol-1-yl)pyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1H-Imidazol-1-yl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1H-Pyrazol-1-yl)pyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1H-Pyrazol-1-yl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1H-Pyrazol-1-yl)thiazole-4-boronic acid pinacol ester, CAS# 1309982-50-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1H-Pyridin-2-one)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1H-Pyrrol-1-yl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1H-Pyrrol-1-yl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1-naphthyl)acetamide, CAS# 86-86-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(1-Oxy-pyridin-2-yl)-1，1，3，3-tetramethylisothiouronium tetrafluoroborate, CAS# 255825-38-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2，2，2-Trifluoroethoxy)pyridine-3-boronic acid, CAS# 1218790-79-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2，2，2-Trifluoroethoxy)pyridine-3-boronic acid pinacol ester, CAS# 1073354-46-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Ethylimidazol-1-yl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Fluorophenyl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Fluorophenyl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Fluorophenyl)thiazole-5-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Furoyl)-PAR-2 (2-6)-Orn amide (mouse， rat), CAS# 729589-58-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Hydroxyethoxy)pyridin-3-ol, CAS# 156840-58-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Methoxyacetamido)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Methoxyphenyl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Methoxyphenyl)thiazole-5-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Methylimidazol-1-yl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Methylimidazol-1-yl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Methylpiperidin-1-yl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Methylpiperidin-1-yl)thiazole-4-boronic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Methylpiperidin-1-yl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Oxopyrrolidin-1-yl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Tolyl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Tolyl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Tolyl)thiazole-5-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Trifluoromethylphenyl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(2-Trifluoromethylphenyl)thiazole-5-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3-((tert-Butyldimethylsilyloxy)methyl)pyrrolidin-1-yl)-3-iodo-5-methylpyridine, CAS# 1203499-22-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3-((tert-Butyldimethylsilyloxy)methyl)pyrrolidin-1-yl)-3-iodopyridine, CAS# 1203499-01-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3-((tert-Butyldimethylsilyloxy)methyl)pyrrolidin-1-yl)-5-fluoro-3-iodopyridine, CAS# 1203499-14-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3-((tert-Butyldimethylsilyloxy)methyl)pyrrolidin-1-yl)-6-(pyrrolidin-1-yl)pyridine, CAS# 1228666-52-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3-((tert-Butyldimethylsilyloxy)methyl)pyrrolidin-1-yl)-6-fluoro-4-iodopyridine, CAS# 1228665-82-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3-((tert-Butyldimethylsilyloxy)methyl)pyrrolidin-1-yl)-6-fluoropyridine, CAS# 1228666-47-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3，3-Dimethylbutanamido)-6-(ethoxycarbonyl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3，4-Difluorophenyl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3，4-Dimethylphenyl)-1，2-dihydro-5-methyl-3H-pyrazol-3-one, CAS# 277299-70-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3，5-Difluorophenyl)thiazole-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3-Aminopyridin-2-yloxy)ethanol, CAS# 1021015-09-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3-Aminopyridin-4-yloxy)ethanol, CAS# 1040316-57-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

2-(3-Ethylureido)thiazolo[5，4-b]pyridine-6-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.