EOS-Peptide-10

EOS med chem is the only manufacturer that provides excellent quality chemistry products and services at affordable rates. The experts working here are highly trained to handle these chemicals used in the creation of medicines used for treating various life-threatening diseases. We are into the manufacturing of chemical products after doing a deep research for the same.

EOS team of experts holds the work experience of more than ten years, and therefore we can assure you about the quality and superiority of the products and services we offer to all our valued clients around the globe. At present, this organization is listed among the most leading pharmaceutical suppliers around the world. We always supply products keeping the affordability in mind.

bismuth iodogallate, CAS# 138-58-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BISMUTH POTASSIUM CITRATE, CAS# 57644-54-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BISMUTH POTASSIUM IODIDE, CAS# 41944-01-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bismuth subnitrate, CAS# 1304-85-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bisoprolol Fumarate, CAS# 104344-23-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bispyribac-sodium, CAS# 125401-92-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BIS-TRIS, CAS# 6976-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BIS-TRIS propane, CAS# 64431-96-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bitertanol, CAS# 55179-31-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bitopertin, CAS# 845614-11-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bivalirudin, CAS# 128270-60-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bivalirudin BG 8967， Hirulog， Hirulog I, CAS# 128270-60-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bivalirudin Trifluoacetate, CAS# 128270-60-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bivalirudin Trifluoroacetate, CAS# 128270-60-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bj6 Protein, CAS# 136626-40-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BKM120 (NVP-BKM120， Buparlisib), CAS# 944396-07-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BKT140CXCR4 antagonist, CAS# 664334-36-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

blasticidin-S, CAS# 2079-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bleomycin sulfate, CAS# 9041-93-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Blomhotin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Blomhotin [Leu3], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Blonanserin, CAS# 132810-10-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bluo-Gal, CAS# 97753-82-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BmKb1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BmKn1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BmKn2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BMN 673;LT-673, CAS# 1207456-01-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BM-PACAP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BMS-599626 (Hydrochloride), CAS# 873837-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

b-MSH， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

b-MSH， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BMV Gag-(7-25), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Bn-AFP1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

b-Neo-Endorphin, CAS# 77739-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP (1-21)， Pro (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP (22-46)， Pro (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP (51-95)， rat;NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfidebridge:10-26), CAS# 133448-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP (7-32)， porcine;DSGCFGRRLDRIGSLSGLGCNVLRRY(Disulfidebridge:4-20), CAS# 114547-28-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP(1-21)Prepro(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP(1-46)Prepro(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP(22-46)Prepro(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP(24-4)Prepro(Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-26 (porcine), CAS# 114547-28-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-32 (huMan) Brain Natriuretic Peptide-32 (huMan)， Nesiritide, CAS# 124584-08-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-32 (porcine) Brain Natriuretic Peptide-32 (porcine), CAS# 117345-87-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-32 (rat), CAS# 133448-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-32 (rat) Brain Natriuretic Peptide-32 (rat), CAS# 133448-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-32 ，porcine, CAS# 117345-87-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-32(Rat), CAS# 133448-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-32， human, CAS# 114471-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-32， porcine;SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY(Disulfidebridge:10-26), CAS# 117345-87-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-32， rat, CAS# 133448-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-45 (51-95)， rat， 5K Cardiac Natriuretic Peptide;SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfidebridge:23-39), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-45 (rat), CAS# 123337-89-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-45 (rat) Brain Natriuretic Peptide-45 (rat), CAS# 123337-89-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-45 ，rat, CAS# 123337-89-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BNP-45， mouse;SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL(Disulfidebridge:23-39), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(1-naphthyl)-pyrrolidine-3-carboxylic acid, CAS# 959577-47-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2，3-dichloro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2，3-dimethoxy-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1392214-13-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2，5-dichloro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-bromo-phenyl)-pyrrolidine-3-carboxylicacid, CAS# 1161787-74-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-chloro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-cyano-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1161787-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-fluoro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 959581-02-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-furanyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-hydroxy-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1392212-25-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-methoxy-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1217689-78-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-methyl-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 957476-23-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-naphthyl)-pyrrolidine-3-carboxylic acid, CAS# 959583-04-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-nitro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 959577-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-pyridinyl)-pyrrolidine-3-carboxylic acid, CAS# 267876-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-thienyl)-pyrrolidine-3-carboxylic acid, CAS# 959581-75-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(2-trifluoromethyl-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1381947-36-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3，4-dimethoxy-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 959580-91-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3，5-dimethoxy-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1392210-31-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-bromo-phenyl)-pyrrolidine-3-carboxylicacid, CAS# 959582-16-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-chloro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1217859-41-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-cyano-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 959580-33-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-fluoro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 301226-53-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-hydroxy-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1217740-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-methoxy-phenyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-methyl-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1255933-98-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-nitro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 959577-50-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-pyridinyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-thienyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(3-trifluoromethyl-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 169248-97-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-bromo-phenyl)-pyrrolidine-3-carboxylicacid, CAS# 1217829-96-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-chloro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-cyano-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1217702-50-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-fluoro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1002732-10-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-hydroxy-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1392211-32-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-methoxy-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1000415-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-methyl-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 1360437-60-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-nitro-phenyl)-pyrrolidine-3-carboxylic acid, CAS# 959579-94-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-pyridinyl)-pyrrolidine-3-carboxylic acid, CAS# 959579-54-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(4-trifluoromethyl-phenyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-(6-methoxy-3-pyridinyl)-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-isopropyl-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(±)-trans-4-Phenyl-pyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(2R，3S)-AHPA, CAS# 105181-72-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(2RS，3S)-AHPA, CAS# 191849-93-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(2S，3S)-AHPA, CAS# 116661-86-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(3R，4S)Sta-OH, CAS# 66967-01-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(3S，4S)-AHPPA-OH, CAS# 72155-46-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(3S，4S)Sta-OH, CAS# 58521-49-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(Asp(OBzl)16)-Gastrin I (13-17) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(Asp(OBzl)16)-Gastrin I (13-17) (human), CAS# 78700-57-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(Asp(OBzl)16)-Gastrin I (13-17) (huMan) Boc-(Asp(OBzl)7)-Cholecystokinin Octapeptide (4-8)， Boc-(Asp(OBzl)9)-Caerulein (6-10), CAS# 78700-57-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(Lys9)-Neurotensin (9-13)-methyl ester, CAS# 89545-20-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-2-(Aminomethyl)-3-methylbutanoic acid, CAS# 191664-14-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-2-(Aminomethyl)-4-methylpentanoic acid, CAS# 132605-96-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-2-Methoxy-phenylglycine, CAS# 1217786-73-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-2-tetrahydroisoquinoline acetic acid, CAS# 332064-64-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-2-Thienylglycine, CAS# 74562-03-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-(6-phenyl)-5-hexenoic acid, CAS# 332064-73-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-2-(benzyloxymethyl)propanoic acid, CAS# 1287146-61-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-2-benzylpropanoic acid, CAS# 262301-38-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-2-methylpropanoic acid, CAS# 132696-45-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-2-phenylpropanoic acid, CAS# 181140-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(1-naphthyl)-propionic acid, CAS# 500789-00-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2，3-dichloro-phenyl)-propionic acid, CAS# 500788-91-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2，3-dimethoxy-phenyl)-propionic acid, CAS# 500788-92-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2，4-dichloro-phenyl)-propionic acid, CAS# 500788-90-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-bromo-phenyl)-propionic acid, CAS# 500789-07-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-chloro-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-fluoro-phenyl)-propionic acid, CAS# 500789-03-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-furyl)-propionic acid, CAS# 1217725-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-hydroxy-phenyl)-propionic acid, CAS# 500788-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-methoxy-phenyl)-propionic acid, CAS# 500788-85-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-methyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-naphthyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-nitro-phenyl)-propionic acid, CAS# 501015-23-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-thienyl)-propionic acid, CAS# 500788-98-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(2-trifluoromethyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3，4-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3，5-dimethoxy-phenyl)-propionic acid, CAS# 500788-94-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-bromo-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-chloro-phenyl)-propionic acid, CAS# 500789-06-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-cyano-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-fluoro-phenyl)-propionic acid, CAS# 500789-04-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-hydroxy-phenyl)-propionic acid, CAS# 500788-89-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-methyl-phenyl)-propionic acid, CAS# 464930-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-nitro-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-pyridyl)-propionic acid, CAS# 500788-96-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-thienyl)-propionic acid, CAS# 500788-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(3-trifluoromethyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-bromo-phenyl)-propionic acid, CAS# 261380-20-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-chloro-phenyl)-propionic acid, CAS# 479064-93-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-cyano-phenyl)-propionic acid, CAS# 501015-22-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-cyano-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-fluoro-phenyl)-propionic acid, CAS# 479064-94-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-hydroxy-phenyl)-propionic acid, CAS# 329013-12-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-methyl-phenyl)-propionic acid, CAS# 479064-97-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-nitro-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(4-trifluoromethyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-(6-methoxy-3-pyridyl)-propionic acid, CAS# 1212298-83-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-3-phenylpropionic acid, CAS# 161024-80-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(1-naphthyl)-butyric acid, CAS# 190190-49-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2，4，5-trifluoro-phenyl)-butyric acid, CAS# 486460-00-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2，4-dichloro-phenyl)-butyric acid, CAS# 269396-53-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-bromo-phenyl)-butyric acid.HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-bromo-phenyl)-butyric acidoHCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-chloro-phenyl)-butyric acid, CAS# 218608-93-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-cyano-phenyl)-butyric acid, CAS# 269726-80-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-fluoro-phenyl)-butyric acid, CAS# 218608-98-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-furyl)-butyric acid, CAS# 270596-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-methyl-phenyl)-butyric acid, CAS# 269398-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-naphthyl)-butyric acid, CAS# 219297-10-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-thienyl)-butyric acid, CAS# 269726-89-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(2-trifluoromethyl-phenyl)-butyric acid, CAS# 269396-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3，4-dichloro-phenyl)-butyric acid, CAS# 269396-56-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3，4-difluoro-phenyl)-butyric acid, CAS# 269396-59-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3-benzothienyl)-butyric acid, CAS# 190190-48-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3-chloro-phenyl)-butyric acid, CAS# 331763-56-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3-cyano-phenyl)-butyric acid, CAS# 269726-83-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3-fluoro-phenyl)-butyric acid, CAS# 331763-66-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3-methyl-phenyl)-butyric acid, CAS# 269398-83-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3-pyridyl)-butyric acid, CAS# 269396-65-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3-thienyl)-butyric acid, CAS# 269726-92-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(3-trifluoromethyl-phenyl)-butyric acid, CAS# 269726-74-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-bromo-phenyl)-butyric acid, CAS# 331763-75-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-chloro-phenyl)-butyric acid, CAS# 218608-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-cyano-phenyl)-butyric acid, CAS# 269726-86-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-fluoro-phenyl)-butyric acid, CAS# 218609-00-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-iodo-phenyl)-butyric acid, CAS# 269396-71-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-methyl-phenyl)-butyric acid, CAS# 269398-85-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-nitro-phenyl)-butyric acid, CAS# 219297-12-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-pyridyl)-butyric acid, CAS# 269396-68-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-tert-butyl-phenyl)-butyric acid, CAS# 401916-48-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(4-trifluoromethyl-phenyl)-butyric acid, CAS# 269726-77-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4-(pentafluoro-phenyl)-butyric acid, CAS# 269398-93-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-4，4-diphenyl-butyric acid, CAS# 332062-06-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-5-hexenoic acid, CAS# 269726-94-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-5-hexynoic acid, CAS# 332064-91-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Amino-5-phenyl-pentanoic acid, CAS# 218608-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-3-Thienylglycine, CAS# 33130-97-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-Pga-OH, CAS# 138782-45-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(1-Naphthalenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2，4-dichloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-bromo-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-chloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-cyano-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-fluoro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-Furanylmethyl)-proline, CAS# 959582-72-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-methyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-Naphthalenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-nitro-benzyl)-proline, CAS# 959578-20-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-Pyridinylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-Thiophenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(2-trifluoromethyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3，4-dichloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3，4-difluoro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-Benzo[b]thiophenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-bromo-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-chloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-cyano-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-fluoro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-methyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-nitro-benzyl)-proline, CAS# 959582-68-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-Phenyl-allyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-Phenyl-propyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-Pyridinylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-Thiophenylmethyl)-proline, CAS# 959578-37-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(3-trifluoromethyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-Biphenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-bromo-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-chloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-cyano-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-fluoro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-iodo-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-methyl-benzyl)-proline, CAS# 706806-62-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-nitro-benzyl)-proline, CAS# 1217715-29-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-Pyridinylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-tert-Butyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-Thiazolylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(4-trifluoromethyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-(5-Bromo-2-thiophenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-Allyl-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-Benzhydryl-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-Benzyl-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-Phenethyl-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-α-Propynyl-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(1-naphthalenylmethyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2，4-dichloro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2-bromo-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2-chloro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2-cyano-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2-fluoro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2-iodo-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2-methyl-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2-naphthalenylmethyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2-nitro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(2-trifluoromethyl-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3，4-dichloro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3，4-difluoro-benzyl)-L-proline., CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-benzothienyl-methyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-bromo-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-chloro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-cyano-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-fluoro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-iodo-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-methyl-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-nitro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-phenyl-allyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-phenyl-propyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-pyridinyl-methyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-thienyl-methyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(3-trifluoromethyl-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-biphenyl-methyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-bromo-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-chloro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-cyano-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-fluoro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-iodo-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-methyl-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-nitro-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-pyridinyl-methyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-tert-butyl-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-(4-trifluoromethyl-benzyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-allyl-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-benzyl-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(R)-γ-propynyl-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-2-(Aminomethyl)-3-methylbutanoic acid, CAS# 210346-16-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-2-(Aminomethyl)-4-methylpentanoic acid, CAS# 828254-18-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-2-Methoxy-phenylglycine, CAS# 1217710-00-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-2-tetrahydroisoquinoline acetic acid, CAS# 270062-98-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-2-Thienylglycine, CAS# 40512-56-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-(6-phenyl)-5-hexenoic acid, CAS# 270596-44-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-2-(benzyloxymethyl)propanoic acid, CAS# 865704-62-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-2-benzylpropanoic acid, CAS# 189619-55-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-2-methylpropanoic acid, CAS# 190897-47-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-2-phenylpropanoic acid, CAS# 136916-26-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(1-naphthyl)-propionic acid, CAS# 500770-68-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2，3-dichloro-phenyl)-propionic acid, CAS# 499995-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2，3-dimethoxy-phenyl)-propionic acid, CAS# 499995-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2，4-dichloro-phenyl)-propionic acid, CAS# 499995-81-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-bromo-phenyl)-propionic acid, CAS# 500770-75-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-chloro-phenyl)-propionic acid, CAS# 500770-73-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-fluoro-phenyl)-propionic acid, CAS# 500770-71-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-furyl)-propionic acid, CAS# 1217736-81-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-hydroxy-phenyl)-propionic acid, CAS# 499995-78-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-methoxy-phenyl)-propionic acid, CAS# 499995-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-methyl-phenyl)-propionic acid, CAS# 499995-74-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-naphthyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-nitro-phenyl)-propionic acid, CAS# 500770-83-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-thienyl)-propionic acid, CAS# 500770-66-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(2-trifluoromethyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3，4-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3，5-dimethoxy-phenyl)-propionic acid, CAS# 499995-85-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-bromo-phenyl)-propionic acid, CAS# 500770-76-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-chloro-phenyl)-propionic acid, CAS# 500770-74-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-cyano-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-fluoro-phenyl)-propionic acid, CAS# 500770-72-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-hydroxy-phenyl)-propionic acid, CAS# 499995-79-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-methyl-phenyl)-propionic acid, CAS# 499995-75-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-nitro-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-pyridyl)-propionic acid, CAS# 297773-45-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-thienyl)-propionic acid, CAS# 500770-67-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(3-trifluoromethyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(4-bromo-phenyl)-propionic acid, CAS# 261165-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(4-chloro-phenyl)-propionic acid, CAS# 479064-90-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(4-cyano-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(4-fluoro-phenyl)-propionic acid, CAS# 479064-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(4-hydroxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(4-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(4-methyl-phenyl)-propionic acid, CAS# 479064-96-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(4-nitro-phenyl)-propionic acid, CAS# 499995-73-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(4-trifluoromethyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-(6-methoxy-3-pyridyl)-propionic acid, CAS# 1217755-81-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-3-phenylpropionic acid, CAS# 103365-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(1-naphthyl)-butyric acid, CAS# 219297-09-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2，4，5-trifluoro-phenyl)-butyric acid, CAS# 922178-94-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2，4-dichloro-phenyl)-butyric acid, CAS# 270063-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-bromo-phenyl)-butyric acid, CAS# 403661-78-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-chloro-phenyl)-butyric acid, CAS# 218608-95-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-cyano-phenyl)-butyric acid, CAS# 270065-83-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-fluoro-phenyl)-butyric acid, CAS# 218608-99-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-furyl)-butyric acid, CAS# 270263-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-methyl-phenyl)-butyric acid, CAS# 270062-90-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-naphthyl)-butyric acid, CAS# 219297-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-thienyl)-butyric acid, CAS# 269726-89-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-thienyl)-butyric acid, CAS# 190190-47-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(2-trifluoromethyl-phenyl)-butyric acid, CAS# 270065-74-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3，4-dichloro-phenyl)-butyric acid, CAS# 270063-51-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3，4-difluoro-phenyl)-butyric acid, CAS# 270063-54-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3-benzothienyl)-butyric acid, CAS# 270063-45-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3-chloro-phenyl)-butyric acid, CAS# 270596-39-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3-cyano-phenyl)-butyric acid, CAS# 270065-86-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3-fluoro-phenyl)-butyric acid, CAS# 270596-51-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3-methyl-phenyl)-butyric acid, CAS# 270062-93-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3-pyridyl)-butyric acid, CAS# 208404-16-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3-thienyl)-butyric acid, CAS# 270263-00-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(3-trifluoromethyl-phenyl)-butyric acid, CAS# 270065-77-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-bromo-phenyl)-butyric acid, CAS# 270062-85-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-chloro-phenyl)-butyric acid, CAS# 270596-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-cyano-phenyl)-butyric acid, CAS# 270065-89-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-fluoro-phenyl)-butyric acid, CAS# 218608-97-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-iodo-phenyl)-butyric acid, CAS# 270065-71-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-methyl-phenyl)-butyric acid, CAS# 270062-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-nitro-phenyl)-butyric acid, CAS# 127106-71-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-pyridyl)-butyric acid, CAS# 219297-13-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-tert-butyl-phenyl)-butyric acid, CAS# 403661-85-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(4-trifluoromethyl-phenyl)-butyric acid, CAS# 270065-80-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4-(pentafluoro-phenyl)-butyric acid, CAS# 270063-42-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4，4-diphenyl-butyric acid, CAS# 332062-06-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-4，4-diphenyl-butyric acid, CAS# 190190-50-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-5-hexenoic acid, CAS# 270263-03-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-5-hexynoic acid, CAS# 270596-47-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Amino-5-phenyl-pentanoic acid, CAS# 218608-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-3-Thienylglycine, CAS# 910309-12-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(1-Naphthalenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2，4-dichloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-bromo-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-chloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-cyano-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-fluoro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-Furanylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-methyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-Naphthalenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-nitro-benzyl)-proline, CAS# 1217814-62-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-Pyridinylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-Thiophenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(2-trifluoromethyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3，4-dichloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3，4-difluoro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-Benzo[b]thiophenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-bromo-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-chloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-cyano-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-fluoro-benzyl)-proline, CAS# 1196886-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-methyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-nitro-benzyl)-proline, CAS# 1217776-53-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-Phenyl-allyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-Phenyl-propyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-Pyridinylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-Thiophenylmethyl)-proline, CAS# 1217714-91-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(3-trifluoromethyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-Biphenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-bromo-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-chloro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-cyano-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-fluoro-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-iodo-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-methyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-nitro-benzyl)-proline, CAS# 959581-73-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-Pyridinylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-tert-Butyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-Thiazolylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(4-trifluoromethyl-benzyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-(5-Bromo-2-thiophenylmethyl)-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-Allyl-proline, CAS# 706806-59-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-Benzhydryl-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-Benzyl-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-Phenethyl-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-α-Propynyl-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-γ-(2-furanyl-methyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-γ-(2-pyridinyl-methyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-(S)-γ-(2-thienyl-methyl)-L-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc，Bzl-D-Ala-OH, CAS# 120571-59-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc，Bzl-L-Ala-OH, CAS# 159999-80-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-2-tetrahydroisoquinoline acetic acid, CAS# 332064-64-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(2-bromo-phenyl)-butyric acid.HCl, CAS# 765263-36-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(2-chloro-phenyl)-butyric acid, CAS# 218608-93-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(2-fluoro-phenyl)-butyric acid, CAS# 218608-98-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(2-methyl-phenyl)-butyric acid, CAS# 269398-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(2-thienyl)-butyric acid, CAS# 190190-47-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(2-trifluoromethyl-phenyl)-butyric acid, CAS# 269396-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(3-chloro-phenyl)-butyric acid, CAS# 331763-56-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(3-methyl-phenyl)-butyric acid, CAS# 269398-94-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(4-chloro-phenyl)-butyric acid, CAS# 218608-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(4-cyano-phenyl)-butyric acid, CAS# 269726-86-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(4-methyl-phenyl)-butyric acid, CAS# 269398-85-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4-(4-trifluoromethyl-phenyl)-butyric acid, CAS# 269726-77-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-4，4-diphenyl-butyric acid, CAS# 190190-50-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-3-Amino-5-phenyl-pentanoic acid, CAS# 218608-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-Ala-OH, CAS# 3303-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-?-iodo-Ala-OMe, CAS# 93267-04-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-[15N]Ala-OH, CAS# 139952-87-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-[15N]Leu-OH, CAS# 146953-81-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-[15N]Val-OH, CAS# 141509-91-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-[Lys(Z)]3 -Obzl, CAS# 62196-20-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1，2-cis-ACHC-OH, CAS# 63216-49-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1，2-trans-ACHC-OH, CAS# 209128-50-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1，3-cis-ACHC-OH, CAS# 222530-33-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1，4-cis-ACHA-OH, CAS# 327156-95-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1，4-cis-ACHC-OH, CAS# 53292-90-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1，4-trans-ACHA-OH, CAS# 189153-10-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1，4-trans-ACHC-OH, CAS# 53292-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-10-Adc-OH, CAS# 173606-50-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-11-Aminoundecanoic acid, CAS# 10436-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-12-Ado-OH, CAS# 18934-81-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1-aminocyclobutane-1-carboxylic acid, CAS# 120728-10-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1-aminocyclopentane-1-carboxy acid, CAS# 35264-09-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1-D-Nal-OH, CAS# 76932-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-1-Nal-OH, CAS# 55447-00-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，3-Dichloro-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，3-Dichloro-L-Phenylalanine, CAS# 261165-14-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，3-Difluoro-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，3-Difluoro-L-Phenylalanine, CAS# 266360-64-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，3-Dimethy-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，3-Dimethy-L-Phenylalanine, CAS# 849440-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4，5-Trifluoro-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4，5-Trifluoro-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4，6-Trifluoro-D-Phenylalanine, CAS# 945261-78-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4，6-Trifluoro-L-Phenylalanine, CAS# 324028-28-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4-Dichloro-D-Phenylalanin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4-Dichloro-L-Phenylalanin, CAS# 114873-04-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4-Difluoro-D-Phenylalanine, CAS# 167993-24-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4-Difluoro-L-Phenylalanine, CAS# 167993-00-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4-Dimethy-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，4-Dimethy-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，5-Dichloro-D-Phenylalanine, CAS# 945262-14-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，5-Dichloro-L-Phenylalanine, CAS# 1213352-71-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，5-Difluoro-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，5-Difluoro-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，5-Dimethy-D-Phenylalanine, CAS# 261380-33-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，5-Dimethy-L-Phenylalanine, CAS# 261165-17-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，6-Dichloro-D-Phenylalanine, CAS# 261380-30-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，6-Dichloro-L-Phenylalanine, CAS# 261165-15-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，6-Difluoro-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，6-Difluoro-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，6-Dimethy-D-Phenylalanine, CAS# 1212874-79-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2，6-Dimethy-L-Phenylalanine, CAS# 126312-57-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc2-3，5-DABA-OH, CAS# 133887-83-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Abz-OH, CAS# 68790-38-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Amino-5-bromo-6-methylpyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Amino-5-chloropyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Amino-5-fluoropyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Amino-5-methylpyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Amino-5-nitropyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Amino-6-methylpyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Aminoisobutyric acid, CAS# 30992-29-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Aminopyridine-3-boronic acid pinacol ester, CAS# 1072944-99-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Aminopyridine-4-boronic acid pinacol ester, CAS# 1095708-32-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Bromo-D-Phenylalanine, CAS# 261360-76-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Bromo-L-Phenylalanine, CAS# 261165-02-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Chloro-D-Phenylalanine, CAS# 80102-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Chloro-L-Phenylalanine, CAS# 114873-02-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Cyano-D-Phenylalanine, CAS# 261380-28-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Cyano-L-Phenylalanine, CAS# 216312-53-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Fluoro-D-Phenylalanine, CAS# 114873-10-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Fluoro-L-Phenylalanine, CAS# 114873-00-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Iodo-D-Phenylalanine, CAS# 478183-64-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Iodo-L-Phenylalanine, CAS# 273221-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Methoxy-D-Phenylalanine, CAS# 170642-26-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Methoxy-L-Phenylalanine, CAS# 143415-63-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Methy-D-Phenylalanine, CAS# 80102-29-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Methy-L-Phenylalanine, CAS# 114873-05-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Nal-OH, CAS# 58438-04-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Nal-OH, CAS# 76985-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Nitro-D-Phenylalanine, CAS# 478183-69-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Nitro-L-Phenylalanine, CAS# 185146-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Pal, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Pal-OH, CAS# 71239-85-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Pal-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Trifluoromethyl-D-Phenylalanine, CAS# 346694-78-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-2-Trifluoromethyl-L-Phenylalanine, CAS# 167993-21-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(1-Nal)-D-Ala, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(1-Nal)-D-Ala1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(1-Nal)-L-Ala, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(1-Naphthyl)-Alanine, CAS# 55447-00-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(1-Naphthyl)-D-Alanine, CAS# 76932-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(1-Naphthyl)-L-Alanine, CAS# 55447-00-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(2-Furyl)-D-alanine dicyclohexylamine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(2-Furyl)-L-alanine dicyclohexylamine salt, CAS# 331730-08-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(2-Nal)-D-Ala, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(2-Nal)-L-Ala, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(2-Naphthyl)-Alanine, CAS# 58438-04-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(2-Naphthyl)-D-Alanine, CAS# 76985-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(2-Naphthyl)-L-Alanine, CAS# 58438-04-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(3-benzothienyl)-D-alanine, CAS# 111082-76-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(3-benzothienyl)-L-alanine, CAS# 154902-51-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(3-Pyridyl)-Alanine, CAS# 117142-26-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(3-pyridyl)-D-alanine, CAS# 98266-33-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(3-pyridyl)-L-alanine, CAS# 117142-26-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-(Aminomethyl)pyridine-4-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，4-dehydroPro-OH, CAS# 51154-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，4-Dichloro-D-Phenylalanine, CAS# 114873-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，4-Dichloro-L-Phenylalanine, CAS# 80741-39-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，4-Difluoro-D-Phenylalanine, CAS# 205445-51-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，4-Difluoro-L-Phenylalanine, CAS# 198474-90-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，4-Dimethy-D-Phenylalanine, CAS# 1213310-14-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，4-Dimethy-L-Phenylalanine, CAS# 142995-30-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-Dibromo-D-tyrosine, CAS# 204692-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-Dichloro-D-Phenylalanine, CAS# 1212983-95-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-Dichloro-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-Difluoro-D-Phenylalanine, CAS# 205445-52-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-Difluoro-D-Phenylalanine, CAS# 205445-53-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-Diiodo-D-tyrosine, CAS# 214630-08-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-Diiodo-L-tyrosine ethyl ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-diiodo-Tyr(2，6-dichloro-Bzl)-OH, CAS# 201416-66-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-diiodo-Tyr-OMe, CAS# 128781-80-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-diiodo-Tyr-OSu, CAS# 163679-35-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-Dimethy-D-Phenylalanine, CAS# 1213338-17-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3，5-Dimethy-L-Phenylalanine, CAS# 849440-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Abz-OH, CAS# 111331-82-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Aminopyridine-4-boronic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Bromo-D-Phenylalanine, CAS# 261360-77-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Bromo-L-Phenylalanine, CAS# 82278-73-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Chloro-D-Phenylalanine, CAS# 80102-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Chloro-L-Phenylalanine, CAS# 114873-03-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Cl-Tyr-OH·DCHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Cyano-D-Phenylalanine, CAS# 205445-56-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Cyano-L-Phenylalanine, CAS# 131980-30-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-D-Ala(2-thienyl)-OH, CAS# 78452-55-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-D-Pal-OH, CAS# 98266-33-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Fluoro-D-Phenylalanine, CAS# 114873-11-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Fluoro-L-Phenylalanine, CAS# 114873-01-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Hydroxy-4-aminophenylbutyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Iodo-D-Phenylalanine, CAS# 478183-66-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Methoxy-D-Phenylalanine, CAS# 261380-37-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Methoxy-L-Phenylalanine, CAS# 261360-71-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Methy-D-Phenylalanine, CAS# 114873-14-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Methy-L-Phenylalanine, CAS# 114873-06-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Nitro-D-Phenylalanine, CAS# 158741-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Nitro-L-Phenylalanine, CAS# 131980-29-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Nitro-Tyrosine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Pal, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Pal-OH, CAS# 117142-26-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Trifluoromethyl-D-Phenylalanine, CAS# 82317-82-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-3-Trifluoromethyl-L-Phenylalanine, CAS# 142995-31-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Abz-OH, CAS# 66493-39-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Abz-OSu, CAS# 120465-50-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Amb-OH, CAS# 33233-67-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-AMC-OH, CAS# 162046-58-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Aminopyridine-3-boronic acid, CAS# 863752-59-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Amino-tetrahydropyran-4-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-APAc-OH, CAS# 81196-09-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Bromo-D-Phenylalanine, CAS# 79561-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Bromo-L-Phenylalanine, CAS# 62129-39-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Br-Phe-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Chloro-D-Phenylalanine, CAS# 57292-44-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Chloro-L-Phenylalanine, CAS# 68090-88-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Cyano-D-Phenylalanine, CAS# 146727-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Cyano-L-Phenylalanine, CAS# 131724-45-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-D-Pal-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Fluoro-D-Phenylalanine, CAS# 57292-45-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Fluoro-L-Phenylalanine, CAS# 41153-30-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Iodo-D-Phenylalanine, CAS# 176199-35-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Iodo-L-Phenylalanine, CAS# 62129-44-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Methoxy-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Methoxy-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Methy-D-Phenylalanine, CAS# 80102-27-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Methy-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Nitro-D-Phenylalanine, CAS# 61280-75-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Nitro-L-Phenylalanine, CAS# 33305-77-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-4-OXO-L-PROLINE, CAS# 84348-37-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-4-OXO-L-PROLINE TERT-BUTYL ESTER, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-oxo-Pro-OH, CAS# 84348-37-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-oxo-Pro-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-oxo-Pro-OMe, CAS# 102195-80-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-4-OXO-PRO-OME, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Pal-OH, CAS# 37535-57-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-phosphono-Phe(Et)2-OH, CAS# 154483-81-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-pinicalborane-L-phenylalanine, CAS# 216439-76-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-tert-butyl-D-Phenylalanine, CAS# 250611-12-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-tert-butyl-L-Phenylalanine, CAS# 143415-62-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Trifluoromethyl-D-Phenylalanine, CAS# 82317-83-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-4-Trifluoromethyl-L-Phenylalanine, CAS# 114873-07-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-5-(Aminomethyl)pyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-5-Amino-2-chloropyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-5-Amino-2-methoxypyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-5-Amino-6-chloropyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-5-Aminovaleric acid, CAS# 27219-07-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-5-Ava-OH, CAS# 27219-07-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-6-Amino-5-methylpyridine-3-boronic acid pinacol ester, CAS# 1075249-37-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-6-Amino-5-nitropyridine-3-boronic acid pinacol ester, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-6-Aminopyridine-3-boronic acid pinacol ester, CAS# 910462-31-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-6-Chloro-D-Tryptophan, CAS# 1217738-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-7-Aminoheptanoic acid, CAS# 60142-89-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-7-Amino-heptanoic acid, CAS# 60142-89-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-8-Aoc-OH, CAS# 30100-16-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-9-Anc-OH, CAS# 173435-78-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-AA-OH, CAS# 27317-69-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-AAP-OH, CAS# 63769-98-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-ABU-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Abu-OH.DCHA, CAS# 34306-42-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-AC3C-OH, CAS# 88950-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Acp-OH, CAS# 6404-29-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Acp-Osu, CAS# 51513-80-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-AGGG-OH, CAS# 64263-99-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-AGG-OH, CAS# 115035-47-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ahx-ol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Aib-OH, CAS# 30992-29-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-AIB-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Aib-OSu, CAS# 104055-39-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala(I)-Ome, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-ALA-2NA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ala-Asp-pNA, CAS# 201732-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-ALA-ALA-D-TRP-PHE-D-PRO-PRO-NLE-NH2, CAS# 141663-86-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ala-Gly-pNA, CAS# 90037-94-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ala-Nva-pNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ala-OH, CAS# 27317-69-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ala-Ome, CAS# 19794-10-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ala-Phe-pNA, CAS# 70968-20-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ala-pNA, CAS# 50439-35-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ala-Pro-Ala-pNA, CAS# 121570-42-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ala-Pro-OH, CAS# 63769-98-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-D-Glu(OBzl)-NH2, CAS# 18814-49-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-D-Glu-NH2, CAS# 18814-50-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-D-Glu-OBzl, CAS# 50515-48-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Glu-Val-Asp-aldehyde (pseudo acid), CAS# 220094-15-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Gly-Gly-Gly-OH, CAS# 64263-99-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Gly-Gly-OH, CAS# 115035-47-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Gly-OH, CAS# 28782-78-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Gly-Pro-Arg-AMC · HCl, CAS# 118850-78-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Gly-Sar-OH, CAS# 249757-08-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-NH2, CAS# 85642-13-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-OH, CAS# 15761-38-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-OH, CAS# 3303-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-ol, CAS# 79069-13-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Ome, CAS# 28875-17-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-ONP, CAS# 2483-49-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-OPFP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-OSu, CAS# 3392-05-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Phe-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Ala-Pro-OH, CAS# 33300-72-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-alpha-Et-D-Ala-OH, CAS# 151171-11-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-alpha-Et-L-Ala-OH, CAS# 123254-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-alpha-Me-DL-Val-OH, CAS# 139938-00-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-alpha-Me-D-Pro-OH, CAS# 166170-15-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-alpha-Me-L-Pro-OH, CAS# 103336-06-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-AMCP-OH, CAS# 204376-48-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-aminoethanol, CAS# 26690-80-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Aminomalonic acid, CAS# 119881-02-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-AOAc-OH, CAS# 42989-85-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Mtr)-OH.CHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Mts)-OH, CAS# 136625-03-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Mts)-OH.CHA, CAS# 68262-71-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Mts)-OH·CHA, CAS# 68262-71-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-ARG(NO2)-DIAZOMETHYLKETONE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(NO2)-OH, CAS# 2188-18-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Pbf)-OH, CAS# 200124-22-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Pbf)-OH·CHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Pmc)-OH, CAS# 200125-12-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Tos)-OH, CAS# 13836-37-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Tos)-OL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Z)2-OH, CAS# 51219-19-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Z)2-ONP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Z)2-OPFP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Z)2-OSU, CAS# 76052-29-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg(Z)-OH, CAS# 51219-18-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg-Arg-Arg-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-ARG-OH, CAS# 13726-76-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg-OH?HCl?H2O, CAS# 35897-34-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg-OH·HCl·H2O, CAS# 35897-34-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg-pNA·HCl, CAS# 99306-64-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Arg-Val-Arg-Arg-AMC, CAS# 136132-77-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn(Trt)-OH, CAS# 132388-68-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn(Xan)-OH, CAS# 65420-40-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn(Xan)-ONP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn(Xan)-OPFP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn(Xan)-OSU, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn-OH, CAS# 7536-55-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn-ol, CAS# 30044-67-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn-ONp, CAS# 4587-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn-OPFP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn-OSU, CAS# 42002-18-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asn-Phe-Pro-aldehyde, CAS# 249757-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OBzl)-OH, CAS# 7536-58-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OBzl)-ONP, CAS# 26048-69-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(Obzl)-Onp, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OBzl)-OPFP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OBzl)-OSU, CAS# 13798-75-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OBzl)-Phe-OH, CAS# 68763-45-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OBzl)-Pro-Arg-AMC · HCl, CAS# 113866-00-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OBzl)-Tyr(Bzl)-NHNH-Z, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OcHex)-OH, CAS# 73821-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OcHex)-OSu, CAS# 118534-86-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OfM)-OH, CAS# 117014-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OMe)-OH, CAS# 59768-74-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OMe)-OH.DCHA, CAS# 59768-74-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OMe)-OH·DCHA, CAS# 135941-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OSu)-OBzl, CAS# 140171-25-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OtBu)-OH, CAS# 1676-90-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OtBu)-OH.DCHA, CAS# 5091,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OtBu)-OH·DCHA, CAS# 5091,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OtBu)-ONP, CAS# 29365-05-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp(OtBu)-OSu, CAS# 50715-50-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp-OBzl, CAS# 30925-18-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp-OcHex · DCHA, CAS# 200283-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp-OFm, CAS# 129046-87-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp-OH, CAS# 13726-67-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp-OH;N-(tert-Butoxycarbonyl)-L-aspartic acid, CAS# 13726-67-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp-Ome, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp-OMe, CAS# 98045-03-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Asp-OtBu, CAS# 34582-32-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Azetidine-3-carboxylic acid, CAS# 142253-55-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Azetidine-3-carboxylic acid., CAS# 142253-55-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-beta-(2-quinolyl)-Ala-OH, CAS# 161453-37-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-beta-(2-quinolyl)-D-Ala-OH, CAS# 170157-64-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-beta-cyano-D-Ala-OH, CAS# 184685-17-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-beta-cyclohexyl-L-alaninol, CAS# 103322-56-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Bip(4，4')-OH, CAS# 147923-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cha-OH, CAS# 37736-82-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cha-OH.DCHA, CAS# 37462-62-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Chg-OH, CAS# 109183-71-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cholecystokinin Octapeptide (3-8), CAS# 23446-11-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cholecystokinin Octapeptide (desulfated), CAS# 25687-34-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cholecystokinin Octapeptide (desulfated) Boc-CCK-8 (desulfated), CAS# 25687-34-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-cis-4-fluoro-Pro-OH, CAS# 203866-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-cis-Hyp-OMe, CAS# 102195-79-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cit-OH, CAS# 45234-13-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Acm)-OH, CAS# 19746-37-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Acm)-ONp, CAS# 58651-76-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Acm)-OPFP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Acm)-OSU, CAS# 19746-38-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Bzl)-OH, CAS# 5068-28-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Bzl)-ol, CAS# 139428-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Bzl)-OSu, CAS# 3401-33-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Bzl)-Ser-OMe, CAS# 13512-53-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Dpm)-OH, CAS# 21947-97-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Et)-OH, CAS# 16947-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Mbzl)-OSu, CAS# 140842-91-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Me)-OH, CAS# 16947-80-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Npys)-OH, CAS# 76880-29-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(pMeBzl)-OH, CAS# 61925-77-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(pMeBzl)-ol, CAS# 129397-85-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(pMeOBzl)-OH, CAS# 18942-46-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(SEt)-OH · DCHA, CAS# 25461-01-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(tBu)-OH, CAS# 56976-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Trt)-OH, CAS# 21947-98-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Trt)-OH·DCHA, CAS# 26988-59-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Cys(Trt)-OSu, CAS# 75179-29-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-1，2，3，4-Tetrahydroisoquinoline-3-carboxylic acid, CAS# 115962-35-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-1，2，3，4-Tetrahydronorharman-3-carboxylic acid, CAS# 123910-26-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-(5-Bromothienyl)alanine, CAS# 261380-16-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2，4，5-Trifluorophe, CAS# 486460-09-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2，4-Difluorophe, CAS# 167993-24-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2，4-Dimethylphe, CAS# 791625-59-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2，4-Dinitrophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2Abu-OH*DCHA, CAS# 27494-47-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Amino-4-bromo-4-pentenoic acid, CAS# 149930-92-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Amino-5-phenyl-pentanoic acid.DCHA, CAS# 156130-68-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Amino-5-phenyl-pentanoic acidoDCHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Aminomethylphe(Fmoc), CAS# 1212895-19-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Bromophe, CAS# 261360-76-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Carbamoylphe, CAS# 1213116-63-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Chloro-4-fluorophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Chlorophe, CAS# 80102-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Cyanophe, CAS# 261380-28-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Fluoro-4-chlorophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Fluorophe, CAS# 114873-10-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Furylalanine.DCHA, CAS# 261380-18-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-FurylalanineoDCHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Iodotyrosine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Methyl-4-fluorophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Nitrophe, CAS# 478183-69-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Pal-OH, CAS# 98266-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Thienylalanine, CAS# 78452-55-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-2-Trifluoromethylphe, CAS# 346694-78-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-(2-Pyridyl)-alanine, CAS# 98266-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-(3-Pyridyl)-alanine, CAS# 98266-33-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3，4-Dichlorophe, CAS# 114873-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3，5-Difluorophe, CAS# 205445-53-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Aminobutyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Aminomethylphe(Fmoc), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Benzothienylalanine, CAS# 111082-76-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Bromophe, CAS# 261360-77-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Carbamoylphe, CAS# 1213190-47-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Cyanophe, CAS# 205445-56-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Methylphe, CAS# 114873-14-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Nitrophe, CAS# 158741-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Pal-OH, CAS# 98266-33-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Thienylalanine.DCHA, CAS# 226880-86-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-ThienylalanineoDCHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-3-Trifluoromethylphe, CAS# 82317-82-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-D-4,4'-BIPHENYLALANINE, CAS# 128779-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4，4'-Biphenylalanine, CAS# 147923-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Acetamidophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Acetylphe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Aminomethylphe(Fmoc), CAS# 215302-77-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Azidophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Benzoylphenylalanine, CAS# 117666-94-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Bromophe, CAS# 79561-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Bromophenylalanine, CAS# 79561-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Carbamoylphe, CAS# 1213639-41-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Iodophe, CAS# 176199-35-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4Pal-OH, CAS# 37535-58-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Phenylphenylalanine, CAS# 128779-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Pyridylalanine, CAS# 37535-58-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-tert-butyl-Phe, CAS# 250611-12-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Thiazolylalanine, CAS# 134107-69-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-4-Trifluoromethylphe, CAS# 82317-83-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-7-Hydroxy-Tic, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-9-Anthrylalanine, CAS# 128050-98-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dab(Aloc)-OH, CAS# 171820-73-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dab(Boc)-OH·DCHA, CAS# 201472-66-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dab(Z)-OH·DCHA, CAS# 16947-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Daba-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dab-OH, CAS# 25691-37-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dab-OtBu · HCl, CAS# 190447-69-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Abu-OH, CAS# 45121-22-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Abu-OH.DCHA, CAS# 27494-47-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Ala(3，3-diphenyl)-OH, CAS# 143060-31-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Ala-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Ala-NH2, CAS# 78981-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-D-Alanine, CAS# 7764-95-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Ala-OH, CAS# 7764-95-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Ala-ol, CAS# 106391-86-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Ala-OMe, CAS# 91103-47-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Ala-ONp, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Ala-OSu, CAS# 34404-33-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Allo-Ile-OH, CAS# 55780-90-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-allo-isoleucine, CAS# 55780-90-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Allyglycine.DCHA, CAS# 170899-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Allylglycine, CAS# 170899-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Allylglycine.DCHA, CAS# 170899-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-AllylglycineoDCHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dap(Boc)-OH·DCHA, CAS# 201472-68-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dap(Dnp)-OSu, CAS# 214750-68-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dap(Z)-OH, CAS# 65710-57-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-DAP(Z)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dap(Z)-OH·DCHA, CAS# 65710-58-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dapa(Fmoc)-OH, CAS# 122235-70-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dapa(Z)-OH.DCHA, CAS# 65710-58-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dapa-OH, CAS# 73259-81-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg(Mtr)-OH, CAS# 200122-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg(Mts)-OH, CAS# 68262-72-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg(NO2)-OH, CAS# 50913-12-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg(Pbf)-OH, CAS# 186698-61-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg(Pmc)-OH, CAS# 214630-02-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg(Tos)-OH, CAS# 61315-61-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg(Z)2-OH, CAS# 145881-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg-OH*H2O*HCl, CAS# 113712-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg-OH?HCl?H2O, CAS# 113712-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Arg-OH·HCl·H2O, CAS# 114622-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asn(Trt)-OH, CAS# 210529-01-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asn-OH, CAS# 75647-01-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asn-ONp, CAS# 104199-82-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp(OBzl)-OH, CAS# 51186-58-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp(OcHex)-OH, CAS# 112898-18-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp(OFm)-OH, CAS# 123417-19-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp(OMe)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp(OtBu)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp(OtBu)-OH, CAS# 155542-33-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp(OtBu)-OH · DCHA, CAS# 200334-95-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp(OtBu)-OH.DCHA, CAS# 200334-95-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-asparagine, CAS# 75647-01-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp-NH2, CAS# 200282-47-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp-OBzl, CAS# 92828-64-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp-OFm, CAS# 214630-04-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp-OH, CAS# 62396-48-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp-OMe, CAS# 137130-65-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Asp-OtBu, CAS# 77004-75-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Aza-OH*CHA, CAS# 225780-77-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-beta-HPhe-OH, CAS# 101555-61-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-beta-HPro-OH, CAS# 101555-60-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Bip-OH, CAS# 128779-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Bpa-OH, CAS# 117666-94-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cha-OH, CAS# 127095-92-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cha-OH*DCHA, CAS# 198470-07-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cha-OH.DCHA, CAS# 198470-07-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Chg-OH, CAS# 70491-05-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cit-OH, CAS# 121080-95-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-cyclohexylalanine, CAS# 127095-92-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cyclohexylglycine, CAS# 70491-05-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cyclopropylalanine.DCHA, CAS# 89483-09-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-CyclopropylalanineoDCHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cyclopropylglycine, CAS# 609768-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cys(Bzl)-OH, CAS# 102830-49-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cys(Bzl)-ol, CAS# 198470-16-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cys(Dpm)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cys(NPys)-OH, CAS# 200350-73-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cys(pMeBzl)-OH, CAS# 61925-78-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cys(pMeBzl)-ol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cys(Trt)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cys(Trt)-OH, CAS# 87494-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Cys-OH, CAS# 149270-12-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dab(Boc)-OH*DCHA, CAS# 350820-58-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dab(Dde)-OH, CAS# 1263046-41-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dab(Fmoc)-OH, CAS# 131570-57-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dab(Z)-OH·DCHA, CAS# 101854-42-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dab-OH, CAS# 80445-78-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dap(Aloc)-OH, CAS# 179251-60-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dap(Boc)-OH*DCHA, CAS# 159652-30-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dap(Boc)-OH·DCHA, CAS# 159652-30-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dap(Fmoc)-OH, CAS# 131570-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dap(Z)-OH, CAS# 81306-93-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Dap-OH, CAS# 76387-70-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Gln(Trt)-OH, CAS# 210750-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Gln(Xan)-OH, CAS# 99092-88-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Gln-OH, CAS# 61348-28-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Gln-ONp, CAS# 74086-23-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu(OBzl)-OH;Boc-L-Glutamic Acid-5-Benzyl Ester, CAS# 35793-73-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu(OBzl)-OSu, CAS# 18800-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu(OcHex)-OH, CAS# 133464-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu(OcHex)-OH·DCHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu(OFm)-OH, CAS# 123417-20-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu(OMe)-OH, CAS# 76379-02-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu(OtBu)-OH, CAS# 104719-63-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu(OtBu)-ONp, CAS# 200397-60-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu-NH2, CAS# 55297-72-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu-OBzl, CAS# 34404-30-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu-Obzl·DCHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu-Oet, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu-OFm, CAS# 214630-10-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu-OH, CAS# 34404-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu-OMe, CAS# 55227-00-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Glu-OtBu, CAS# 73872-71-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-glutamic acid, CAS# 34404-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-glutamic acid γ-allyl ester, CAS# 259221-91-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-glutamine, CAS# 61348-28-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Gly(Allyl)-OH.DCHA, CAS# 221352-64-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-HArg(Et)2-OH, CAS# 110761-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-DH-Cys(Me)-OH-Phe-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His(1-Me)-OH, CAS# 200871-52-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His(3-Me)-OH, CAS# 200871-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His(Boc)-OH·DCHA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His(Bom)-OH, CAS# 99310-01-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His(Dnp)-OH isopropanol solvate, CAS# 204125-02-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His(Dnp)-OH·IPA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His(DNp)-OH·IPA, CAS# 204125-02-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His(Tos)-OH, CAS# 69541-68-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His(Trt)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-His-OH, CAS# 50654-94-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Homoarg(Et)2-OH (symmetrical), CAS# 110761-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Homoarg(NO2)-OH, CAS# 13278-70-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Homoarginine hydrochloride, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Homocitrulline, CAS# 121080-97-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Homoleu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-homoPhenylalanine, CAS# 82732-07-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-HoPhe-OH, CAS# 82732-07-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-HoPro-OH, CAS# 28697-17-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-HPip-OH, CAS# 351410-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-diethanolamine, CAS# 103898-11-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Ile-OH, CAS# 55721-65-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-Dipropylglycine, CAS# 87113-32-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-isoleucine, CAS# 55721-65-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-DL-3-Aminoisobutyric acid, CAS# 16948-10-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-DL-Ala-OH, CAS# 3744-87-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-D-Leucine, CAS# 16937-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Leucine monohydrate, CAS# 16937-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

BOC-D-Leucine monohydrate;Boc-D-Leu-OH.H2O, CAS# 16937-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Leu-OH?H2O, CAS# 16937-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Boc-D-Leu-OH·H2O, CAS# 200937-17-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.