EOS-Peptide-16

EOS med chem is the only manufacturer that provides excellent quality chemistry products and services at affordable rates. The experts working here are highly trained to handle these chemicals used in the creation of medicines used for treating various life-threatening diseases. We are into the manufacturing of chemical products after doing a deep research for the same.

EOS team of experts holds the work experience of more than ten years, and therefore we can assure you about the quality and superiority of the products and services we offer to all our valued clients around the globe. At present, this organization is listed among the most leading pharmaceutical suppliers around the world. We always supply products keeping the affordability in mind.

Epothilone B, CAS# 152044-54-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Epothilone D, CAS# 189453-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Epoxiconazole, CAS# 106325-08-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

EPPS, CAS# 16052-06-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eprazinone dihydrochloride, CAS# 10402-53-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eprinomectin, CAS# 123997-26-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

EPROSARTAN, CAS# 133040-01-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eprosartan mesylate, CAS# 144143-96-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

epsilon-(gamma-Glutamyl)-lysine, CAS# 17105-15-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

EPSILON-POLYLYSINE, CAS# 28211-04-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eptaplatin, CAS# 146665-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

EPTC, CAS# 759-94-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eptifibatide, CAS# 188627-80-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eptifibatide, CAS# 148031-34-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eptifibatide Acetate, CAS# 148031-34-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eptifibatide Acetate, CAS# 188627-80-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eptinezumab, CAS# 1644539-04-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ER membrane protein complex subunit 1 isoform 3 precursor (640-648), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ERBB2IP protein (1003-1018), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erdosteine, CAS# 84611-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eremomycin aglycone hexapeptide, CAS# 185461-61-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ergosterol, CAS# 57-87-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eriochrome black T, CAS# 1787-61-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eriochrome blue black R, CAS# 2538-85-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eriochrome cyanine R, CAS# 3564-18-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erioglaucine disodium salt, CAS# 3844-45-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ERKtide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erktide， FAM-labeled??;IPTTPITTTYFFF-K(5-FAM)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erktide??;IPTTPITTTYFFFK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erlotinib, CAS# 183321-74-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erlotinib hydrochloride, CAS# 183319-69-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ertapenem, CAS# 153832-46-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ErtapeneM MonosodiuM, CAS# 153773-82-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ertapenem side chain, CAS# 202467-69-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythritol, CAS# 149-32-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythro-DL-β-Hydroxynorleucine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-D-Phenylserine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythro-D-β-Hydroxynorleucine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-L-Phenyserine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythromycin, CAS# 114-07-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythromycin estolate, CAS# 3521-62-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythromycin ethyl succinate, CAS# 1264-62-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ERYTHROMYCIN OXIME, CAS# 13127-18-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythromycin resistance peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythromycin thiocyanate, CAS# 7704-67-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-N-Boc-D-phenylalanine epoxide [(1R)-(1'-(R)-N-Boc-Amino-2-phenyl-ethyl)oxirane, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-N-Boc-L-3，5-difluorophenylalanine epoxide [(1S)-[(1'-(S)-N-Boc-Amino-2-[3，5-difluoro-phenyl]ethyl)oxirane], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-N-Boc-L-3-bromophenylalanine epoxide [(1S)-[(1'-(S)-N-Boc-Amino-2-[3-bromo-phenyl]ethyl}oxirane], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-N-Boc-L-4-carbamoylphenylalanine epoxide [(1S)-[(1'-(S)-N-Boc-Amino-2-[4-carbamoyl-phenyl]ethyl}oxirane], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-N-Boc-L-4-nitrophenylalanine epoxide [(1S)-{(1'-(S)-N-Boc-Amino-2-[4-nitro-phenyl]ethyl}oxirane], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-N-Boc-L-homophenylalanine epoxide [(1R)-(1'-(R)-N-Boc-Amino-3-phenyl-propyl)oxirane, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-N-Boc-L-homophenylalanine epoxide [(1S)-(1'-(S)-N-Boc-Amino-3-phenyl-propyl)oxirane], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythro-N-Boc-O-benzyl-L-serine epoxide, CAS# 92085-96-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-N-Boc-O-benzyl-L-serine epoxide [(1S)-[(1'-(S)-N-Boc-Amino-2-(benzyloxy-ethyl)oxirane], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

erythro-N-Boc-O-benzyl-L-tyrosine epoxide [(1S)-{(1'-(S)-N-Boc-Amino-2-[4-(benzyloxy)phenyl]ethyl}oxirane], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Erythropoietin Mimetic Peptide Sequence 20, CAS# 203397-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Escitalopram, CAS# 128196-01-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Escitalopram oxalate, CAS# 219861-08-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Esculentin-1A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Esculetin, CAS# 305-01-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Es-fenvalerate, CAS# 66230-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Esmolol, CAS# 81147-92-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Esmolol hydrochloride, CAS# 81161-17-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Esomeprazole, CAS# 119141-88-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Esomeprazole magnesium, CAS# 161973-10-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Esomeprazole magnesium trihydrate, CAS# 217087-09-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Esomeprazole sodium, CAS# 161796-78-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Esprocarb, CAS# 85785-20-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Estradiol, CAS# 50-28-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Estradiol benzoate, CAS# 50-50-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Estradiol valerate, CAS# 979-32-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Estramustine, CAS# 2998-57-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ESTRAMUSTINE PHOSPHATE SODIUM, CAS# 52205-73-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Estriol, CAS# 50-27-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eszopiclone, CAS# 138729-47-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etamsylate, CAS# 2624-44-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etarfolatide, CAS# 479578-27-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etelcalcetide, CAS# 1262780-97-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etelcalcetide Hydrochloride, CAS# 1334237-71-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ETHACRIDINE LACTATE, CAS# 1837-57-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethacridine lactate monohydrate, CAS# 6402-23-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethalfluralin, CAS# 55283-68-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethambutol dihydrochloride, CAS# 1070-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethametsulfuron-methyl, CAS# 97780-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethanethioamide, CAS# 62-55-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethephon, CAS# 16672-87-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethidium bromide, CAS# 1239-45-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethinamide, CAS# 536-33-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethiofencarb, CAS# 29973-13-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethisterone, CAS# 434-03-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethofenprox, CAS# 80844-07-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethofumesate, CAS# 26225-79-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethohexadiol, CAS# 94-96-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethopabate, CAS# 21704,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethoxycarbonyl-Met-Leu-Phe-OMe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethoxysulfuron, CAS# 126801-58-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl (1S，2S)-trans-2-hydroxycyclohexanecarboxylate, CAS# 29569-79-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl (R)-4-benzyloxy-3-hydroxybutyrate, CAS# 106058-91-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl (S)-(-)-2-(tert-Butyldimethylsilyloxy)propionate, CAS# 106513-42-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl (S)-3-Hydroxyhexanoate, CAS# 88496-71-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl (S)-3-hydroxy-tetradecanoate, CAS# 214193-71-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl 2-((3-iodo-5-nitropyridin-4-yl)amino)acetate, CAS# 1305324-91-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl 2-hydroxybenzoate, CAS# 118-61-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ETHYL 3-AMINOCROTONATE, CAS# 626-34-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl 3-chloro-2,4,5-trifluorobenzoylacetate, CAS# 101987-86-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl 4'-hydroxy-3'-methoxycinnamate, CAS# 4046-02-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl 6，8-dichlorooctanoate, CAS# 1070-64-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl carbamate, CAS# 51-79-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl cellulose, CAS# 9004-57-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl crotonate, CAS# 623-70-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl D-(-)-pyroglutamate, CAS# 68766-96-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl gallate, CAS# 831-61-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl isocyanate, CAS# 109-90-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl isoferulate, CAS# 155401-23-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl isonicotinate, CAS# 1570-45-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl lauroyl arginate HCl, CAS# 60372-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl L-pyroglutamate, CAS# 7149-65-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl L-thiazolidine-4-carboxylate hydrochloride, CAS# 86028-91-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl nicotinoate, CAS# 614-18-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl?butylacetylaminopropionate, CAS# 52304-36-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl-6(S)，7-isopropylidenedioxy-hept-4-enoate, CAS# 119392-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl-6(S)，7-isopropylidenedioxy-heptanoate, CAS# 119392-31-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethylene Deltenine, CAS# 5571-36-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyleneimine, CAS# 151-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethylicin, CAS# 682-91-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethyl-ornithine dihydrochloride, CAS# 84772-29-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethynodiol diacetate, CAS# 297-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ethynyl estradiol, CAS# 57-63-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ETIDRONATE DISODIUM, CAS# 7414-83-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etilefrine hydrochloride, CAS# 943-17-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etimicin Sulphate, CAS# 362045-44-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etiracetam, CAS# 33996-58-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etodolac, CAS# 41340-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etofenamate, CAS# 30544-47-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ETOFIBRATE, CAS# 31637-97-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etomidate, CAS# 33125-97-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etonogestrel, CAS# 54048-10-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etoposide, CAS# 33419-42-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etoposide phosphate, CAS# 117091-64-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etoricoxib, CAS# 202409-33-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ETOXAZOLE, CAS# 153233-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etravirine, CAS# 269055-15-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Etrimfos, CAS# 38260-54-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ETV6-AML1 fusion protein (332-346), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ETV6-AML1?fusion protein (334-342), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eukaryotic initiation factor 4A-III (110-119), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eukaryotic translation elongation factor 1 alpha 1 (115-129), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eukaryotic translation initiation factor 4 gamma 1 (1248-1256), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eukaryotic translation initiation factor 4 gamma 1 (719-727), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Evans blue, CAS# 314-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Everolimus, CAS# 159351-69-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ewing Tumor EZH2 (666-674), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exchanger inhibitory peptide, CAS# 132523-75-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exemestane, CAS# 107868-30-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exenatide, CAS# 141758-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exenatide, CAS# 141732-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exenatide Acetate, CAS# 141758-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exenatide Acetate, CAS# 141732-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin (5-39), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin (9-39), CAS# 133514-43-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin (9-39) Acetate, CAS# 133514-43-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 3, CAS# 130357-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 3 (9-39);DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, CAS# 133514-43-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 3;HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, CAS# 130357-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 4, CAS# 141758-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 4 (1-8), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 4 (3-39), CAS# 196109-31-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 4 (3-39);EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, CAS# 196109-31-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 4 (3-39)-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 4， FAM-labeled;FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin 4;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, CAS# 141758-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin-3, CAS# 130357-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin-3 (9-39 Amide) (Heloderma horridum), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin-4, CAS# 141758-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendin-4 (3-39), CAS# 196109-31-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exendins and Fragments, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exogastrula-inducing peptide A， anthocidaris crassispina, CAS# 120365-34-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exogastrula-inducing peptide C， anthocidaris crassispina, CAS# 124585-18-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Exogastrula-inducing peptide D， anthocidaris crassispina, CAS# 120365-36-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Experimental Allergic Encephalitogenic Peptide (human), CAS# 29705-92-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ExperiMental Allergic Encephalitogenic Peptide (huMan) EAE-Peptide (huMan), CAS# 29705-92-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Experimental Allergic Encephalitogenic Peptide (human)/., CAS# 29705-92-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Experimental Autoimmune Encephalomyelitis Complementary Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Extracellular Death Factor, CAS# 960129-66-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Extracellular Death Factor， EDF, CAS# 960129-66-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Extracellular superoxide dismutase (cu-ZN) human, CAS# 851576-28-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eyeseryl / Acetyl Tetrapeptide-5, CAS# 820959-17-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ezetimibe, CAS# 163222-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eα (52–68), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Eα (52–68)??;ASFEAQGALANIAVDKA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F1 Peptide， lobster, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F1 Peptide， lobster;TNRNFLRF-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F2L/HBP(1-21)Acetylated (Human，Procine，Canine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F2L/HBP(1-21)Acetylated (Rat，Mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F2L/HBP(1-21)Nonacetylated(Human，Procine，Canine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F3 Peptide / HMGN2 Protein Fragment 3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F6P, CAS# 26177-86-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-AF-NH2, CAS# 29268-00-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-AK-OH, CAS# 76079-03-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-Ala-Lys-OH, CAS# 76079-03-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-ALA-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-AR-OH, CAS# 76079-06-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FACTP140 (838-845)??;DEVELIHF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-DA-OH, CAS# 196791-00-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-FFR-OH, CAS# 86064-76-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-FV-NH2, CAS# 93936-27-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FAGLA, CAS# 26400-33-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-GLA-OH, CAS# 56186-50-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-GL-OH, CAS# 69654-89-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-Glu-Glu-OH, CAS# 1374423-90-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-Gly-Nva-NH2, CAS# 67607-50-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fa-gly-oh, CAS# 124882-74-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FAGPA, CAS# 26400-34-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-GV-NH2, CAS# 67607-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-KA-OH, CAS# 158016-07-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-KL-OH, CAS# 158016-09-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Faldaprevir, CAS# 801283-95-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FALGPA, CAS# 78832-65-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Famciclovir, CAS# 104227-87-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Famotidine, CAS# 76824-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Famoxadone, CAS# 131807-57-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Famphur, CAS# 52-85-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fanconi anemia group M protein (201-214), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-PA-OH, CAS# 83803-17-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FAPGG, CAS# 64967-39-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FAPP, CAS# 83661-95-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-Pro-OH, CAS# 201156-86-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FARKGALRQ, CAS# 150626-45-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FA-RL-OH, CAS# 158016-08-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Faropenem sodium hemipentahydrate, CAS# 106560-14-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fas C- Terminal Tripeptide, CAS# 189109-90-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fas C-Terminal Tripeptide, CAS# 189109-90-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast Black B Salt, CAS# 53760-27-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast Black K Salt, CAS# 64071-86-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast Blue B salt, CAS# 14263-94-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast blue BB salt, CAS# 5486-84-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast blue RR salt, CAS# 14726-29-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast garnet GBC base, CAS# 97-56-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast Garnet GBC salt, CAS# 101-89-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast green FCF, CAS# 2353-45-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FAST kinase domain-containing protein 1 isoform 1 (497-514), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast red GG salt, CAS# 456-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast red RC salt, CAS# 68025-25-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast red TR, CAS# 51503-28-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fast Violet B Salt, CAS# 14726-28-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fasudil, CAS# 103745-39-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fasudil hydrochloride, CAS# 105628-07-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FATGIGIITV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F-box protein FBL5 (227-255), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FBXO41 protein， partial (284-297), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FCE 26743, CAS# 133865-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FCeRI g-chain ITAM-derived phospho peptide， FAM labeled??;5-FAM-pY-TGLSTRNQET-pY-ETL-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F-Chemotactic peptide, CAS# 71901-21-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F-Chemotactic peptide-fluorescein, CAS# 117576-09-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FDA, CAS# 596-09-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FDC - SP (30 - 85)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FDC - SP (61 - 85)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FDC-SP (30-85)， human;SISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FDC-SP (61-85)， human;FPWFRRNFPIPIPESAPTTPLPSEK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FDP, CAS# 38099-82-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Febantel, CAS# 58306-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Febuxostat, CAS# 144060-53-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fedratinib (SAR302503， TG101348), CAS# 936091-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Felodipine, CAS# 72509-76-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Felypressin, CAS# 56-59-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Felypressin, CAS# 914453-97-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Felypressin Acetate, CAS# 56-59-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Femclorim, CAS# 3740-92-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenaminosulf, CAS# 140-56-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenamiphos, CAS# 22224-92-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenamiphos?sulfone, CAS# 31972-44-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenarimol, CAS# 60168-88-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenazaflor, CAS# 14255-88-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenazaquin, CAS# 120928-09-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenazox, CAS# 61618-27-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenbendazole, CAS# 43210-67-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenbufen, CAS# 36330-85-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenchlorazole, CAS# 103112-35-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenchlorphos, CAS# 299-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenfuram, CAS# 24691-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenhexamid, CAS# 126833-17-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenofibrate, CAS# 49562-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenofibric acid, CAS# 42017-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FENOTEROL HYDROBROMIDE, CAS# 16409,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenothiocarb, CAS# 62850-32-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenoxanil, CAS# 115852-48-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenoxaprop-p-ehtyl, CAS# 113158-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FENOXAPROP-P-ETHYLl, CAS# 66441-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenoxycarb, CAS# 79127-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenproidin, CAS# 67306-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenpropimorph, CAS# 67306-03-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenpyroximate, CAS# 134098-61-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenson, CAS# 80-38-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fensulfothion, CAS# 115-90-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenticonazole nitrate, CAS# 73151-29-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenuron, CAS# 101-42-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenuron-TCA, CAS# 4482-55-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fenvalerate, CAS# 51630-58-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Feprazone, CAS# 30748-29-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ferric citrate, CAS# 3522-50-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ferric phosphate dihydrate, CAS# 13463-10-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ferri-heme undecapeptide, CAS# 30975-71-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ferrous gluconate, CAS# 299-29-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ferrous lactate, CAS# 5905-52-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fertirelin, CAS# 66002-66-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FERTIRELIN, CAS# 38234-21-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fertirelin Acetate, CAS# 66002-66-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fertirelin Acetate, CAS# 38234-21-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FERULIC ACID, CAS# 1135-24-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FERULIC ACID METHYL ESTER, CAS# 149567,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fesoterodinefumarate, CAS# 286930-03-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fexofenadine, CAS# 83799-24-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fexofenadine hydrochloride, CAS# 153439-40-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FGF acidic (1-11) (bovine brain), CAS# 211362-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FGF basic (119-126) (human， bovine， ovine， rabbit), CAS# 152051-61-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FGF basic (119-126) (human， mouse， rabbit， rat), CAS# 152051-61-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FGF basic (120-125) (human， bovine， chicken， ovine， rabbit), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FGF basic (120-125) (human， bovine， ovine， rabbit), CAS# 152051-61-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FGF basic (1-24) (human， bovine), CAS# 211362-85-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FGFG, CAS# 59005-83-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FGGF, CAS# 40204-87-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FHV Coat-(35-49), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrin from human plasma, CAS# 9001-31-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen Bbeta (1-21), CAS# 93334-58-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen Binding Inhibitor Peptide;HHLGGAKQAGDV, CAS# 89105-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen Binding Inhibitory Peptide, CAS# 89105-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen Fragments and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen from human plasma, CAS# 9001-32-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen Related Peptide, CAS# 80755-86-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen β-Chain (10-28), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen β-Chain (24-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen β-Chain (24-42);EEAPSLRPAPPPISGGGYR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen γ - Chain (117 - 133), CAS# 160927-63-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen γ-Chain (117-133), CAS# 160927-63-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen γ-Chain (117-133);NNQKIVNLKEKVAQLEA, CAS# 160927-63-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen γ-Chain (397-411), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen γ-Chain (397-411), CAS# 80755-86-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen γ-Chain (397-411);GQQHHLGGAKQAGDV, CAS# 80755-86-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen-binding Peptide, CAS# 137235-80-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinogen-Binding Peptide;EHIPA, CAS# 137235-80-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinolysin, CAS# 9001-90-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinolysis Inhibiting Factor;GPRP, CAS# 67869-62-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinolysis Inhibitng Factor, CAS# 67869-62-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide A, CAS# 25422-31-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide A (huMan), CAS# 25422-31-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide A， human, CAS# 25422-31-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide A， human;ADSGEGDFLAEGGGVR, CAS# 25422-31-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide B, CAS# 36204-23-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide B， Bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide B， Bovine??;QFPTDYDEGQDDRPKVGLGAR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide B， des-arg(14)-, CAS# 71494-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide B， human, CAS# 36204-23-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibrinopeptide B， human;Pyr-GVNDNEEGFFSAR, CAS# 36204-23-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin (1946-1960), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Adhesion-Promoting Peptide, CAS# 125720-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Analog, CAS# 125455-58-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Binding Protein Peptide， D3 Peptide;FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV, CAS# 119977-20-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin CS-1 Fragment (1978-1982), CAS# 150525-67-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin CS-1 FragMent (1978-1985) EILDVPST, CAS# 136466-51-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin CS-1 Peptide, CAS# 136466-51-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Fragment (1371 - 1382)-[Phe1376], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Fragment (1376-1380), CAS# 158622-13-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Fragment (1377-1388), CAS# 162257-99-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Fragment (1954-1959), CAS# 184895-13-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Fragment (196-203), CAS# 150525-72-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin FragMent (196-203) SRNRCNDQ-NH2, CAS# 150525-72-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Fragments and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Precursor (561-599)， mouse， rat: Fibronectin (530-568)， bovine;CQDSETRTFY, CAS# 94040-53-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Receptor Peptide (124-131), CAS# 172516-80-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Type III Connecting Segment (1-25), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin Type III Connecting Segment(1-25), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin type III domain-containing protein 3B (292-300), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibronectin-Binding Protein, CAS# 119977-20-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibulostatin-6.2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fibulostatin-6.3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fidaxomicin, CAS# 873857-62-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fimasartan, CAS# 247257-48-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Finasteride, CAS# 98319-26-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fingolimod hydrochloride, CAS# 162359-56-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fipronil, CAS# 120068-37-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Firocoxib, CAS# 189954-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC, CAS# 3326-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC - LC - Antennapedia(43-58) Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC - LC - MTS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC - LC - TAT (47 - 57), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Ala-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Arg(Pbf)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Asn(Trt)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Asp(OtBu)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Cys(Trt)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Gln(Trt)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Glu(OtBu)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Gly-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-His(Trt)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Ile-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-LC-Antennapedia Peptide;FITC-LC-RQIKIWFQNRRMKWKK-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-LC-MTS;FITC-LC-AAVLLPVLLAAP-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-LC-Myelin Basic Protein Peptide Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-LC-Synaptophysin Fragment;FITC-LC-GYGPQDSYGPQGGYQPDYGQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-LC-TAT (47-57);FITC-LC-YGRKKRRQRRR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Leu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Lys(Boc)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Met-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Phe-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Phosphotyramine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Pro-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Ser(tBu)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Thr(tBu)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Trp(Boc)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Trp-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Tyr(tBu)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys: Dnp, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-Val-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-β-Ala-Amyloid β-Protein (1-40), CAS# 1802087-76-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-β-Ala-Amyloid β-Protein (1-42), CAS# 1802087-77-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-εAhx-Amyloid β-Protein (1-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FITC-εAhx-Antennapedia Homeobox (43-58) amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FIZZ-1 / RELM-2 (32-51)(Mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FKKSFKL-NH2, CAS# 137168-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flag, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flag peptide, CAS# 98849-88-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FLAG PEPTIDE|DYKDDDDK|ASP-TYR-LYS-ASP-ASP-ASP-ASP-LYS, CAS# 98849-88-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flamprop-methyl, CAS# 52756-25-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flavomycin, CAS# 11015-37-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flavopiridol, CAS# 146426-40-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FLAVOPIRIDOL HYDROCHLORIDE, CAS# 131740-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flavourzyme, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flavoxate hydrochloride, CAS# 3717-88-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flazasulfuron, CAS# 104040-78-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

F-L-E-E-V, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fleroxacin, CAS# 79660-72-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FLEROXACINLACTATE, CAS# 896139-71-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

flg22 PEPTIDE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flomoxef sodium, CAS# 92823-03-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FLONICAMID, CAS# 158062-67-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Florfenicol, CAS# 73231-34-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flounder [Asn: 1， Ile: 5， Thr: 9] Angiotensin 1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FLRFamide, CAS# 80690-77-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluacrypyrim, CAS# 229977-93-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluanisone, CAS# 1480-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluazifop-P-butyl, CAS# 79241-46-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluazinam, CAS# 79622-59-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluazuron, CAS# 86811-58-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flubendazole, CAS# 31430-15-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flucetosulfuron, CAS# 412928-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flucloxacillin, CAS# 5250-39-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flucloxacillin sodium, CAS# 1847-24-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluconazole, CAS# 86386-73-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flucythtinate, CAS# 70124-77-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fludarabine, CAS# 21679-14-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fludarabine phosphate, CAS# 75607-67-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fludioxonil, CAS# 131341-86-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flugestone 17-acetate, CAS# 2529-45-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FluM1 A2 (58-66), CAS# 141368-69-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FluMatinib Mesylate, CAS# 895519-91-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flumazenil, CAS# 78755-81-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flumequine, CAS# 42835-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flumethasone, CAS# 2135-17-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flumethasone acid, CAS# 28416-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flumethrin, CAS# 69770-45-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flumetralin, CAS# 62924-70-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flumetsulam, CAS# 98967-40-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flumiclorac-pentyl, CAS# 87546-18-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flumioxazin, CAS# 103361-09-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flunarizine dihydrochloride, CAS# 30484-77-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flunixin meglumin, CAS# 42461-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluocinolone acetonide, CAS# 67-73-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluocinonide, CAS# 356-12-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluocortolone, CAS# 152-97-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluometuron, CAS# 2164-17-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorene, CAS# 86-73-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescamine, CAS# 38183-12-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescein, CAS# 153954,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescein dichloride, CAS# 76-54-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescein disodium salt, CAS# 518-47-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescein-6-carbonyl-Val-Ala-DL-Asp(OMe)-fluoromethylketone, CAS# 560094-66-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescent HIV Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescent Substrate for Asp-Specific Proteases, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescent Substrate for Glu-Specific Proteases, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescent Substrate for Pro-Specific Proteases, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorescent Substrate for Subtillsin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorochloridone, CAS# 61213-25-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorogenic Caspase 3 Substrate Ac-DEVD-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluorogenic Human CMV Protease Substrate, CAS# 163265-38-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluoroglycofen-ethyl, CAS# 77501-90-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluoromethalone, CAS# 426-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluoro-N，N，N'，N'-tetramethylformamidinium hexafluorophosphate, CAS# 164298-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluoronaphthalene, CAS# 321-38-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluoroquinolonic acid, CAS# 86393-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluoxetine, CAS# 54910-89-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluoxetine hydrochloride, CAS# 56296-78-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluoxymesterone, CAS# 76-43-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flupirtine maleate, CAS# 75507-68-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flurazepam, CAS# 17617-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flurazepam dihydrochloride, CAS# 1172-18-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flurazepam monohydrochloride, CAS# 36105-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flurenoxuron, CAS# 101463-69-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluridone, CAS# 59756-60-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluroxypyr, CAS# 69377-81-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flurprimidol, CAS# 56425-91-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flurtamone, CAS# 96525-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flusilazole, CAS# 136426-54-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flutamide, CAS# 13311-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluticasone, CAS# 90566-53-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluticasone propionate, CAS# 80474-14-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flutolanil, CAS# 66332-96-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Flutriafol, CAS# 76674-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

flutrimazol, CAS# 119006-77-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluvastatin, CAS# 93957-54-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluvastatin Sodium, CAS# 93957-55-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluvoxamine maleate, CAS# 61718-82-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fluxofenim, CAS# 88485-37-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fMLF, CAS# 59880-97-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fMLF， fMLP, CAS# 59880-97-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fMLFF, CAS# 80180-63-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fMLFK, CAS# 67247-11-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fMLF-OMe, CAS# 65929-03-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fMLF-OMe， fMLP-OMe, CAS# 65929-03-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fMMF, CAS# 59881-05-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fMMM, CAS# 59881-03-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMN-Na, CAS# 130-40-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMN-Na, CAS# 6184-17-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc- β-3-D-homoornthine(Boc), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(2R，3S)-AHPA, CAS# 654060-49-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(2S，3R)-AHPA, CAS# 1426128-64-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(3S，4S)Sta-OH, CAS# 158257-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMOC-(DMB)GLY-OH, CAS# 166881-42-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(Phenethyl|)Gly-OH, CAS# 540483-58-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-2-(Aminomethyl)-3-methylbutanoic acid, CAS# 501331-02-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-2-(Aminomethyl)-4-methylpentanoic acid, CAS# 1018899-99-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-2-Methoxy-phenylglycine., CAS# 1217838-25-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-2-tetrahydroisoquinoline acetic acid, CAS# 332064-67-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-2-Thienylglycine, CAS# 208259-66-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-(6-phenyl)-5-hexenoic acid, CAS# 332064-75-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-2-(tert-butoxymethyl)propanoic acid, CAS# 847153-42-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-2-benzylpropanoic acid, CAS# 828254-16-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-2-methylpropanoic acid, CAS# 211682-15-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-2-phenylpropanoic acid, CAS# 1217722-24-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(1-naphthyl)-propionic acid, CAS# 511272-47-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2，3-dichloro-phenyl)-propionic acid, CAS# 511272-38-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2，3-dimethoxy-phenyl)-propionic acid, CAS# 511272-39-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2，4-dichloro-phenyl)-propionic acid, CAS# 511272-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-bromo-phenyl)-propionic acid, CAS# 517905-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-chloro-phenyl)-propionic acid, CAS# 511272-52-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-fluoro-phenyl)-propionic acid, CAS# 511272-50-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-furyl)-propionic acid, CAS# 1217662-55-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-hydroxy-phenyl)-propionic acid, CAS# 511272-34-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-methoxy-phenyl)-propionic acid, CAS# 511272-31-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-methyl-phenyl)-propionic acid, CAS# 507472-27-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-naphthyl)-propionic acid, CAS# 511272-48-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-nitro-phenyl)-propionic acid, CAS# 517905-93-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-thienyl)-propionic acid, CAS# 511272-45-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(2-trifluoromethyl-phenyl)-propionic acid, CAS# 517905-86-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3，4-dimethoxy-phenyl)-propionic acid, CAS# 511272-40-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3，5-dimethoxy-phenyl)-propionic acid, CAS# 511272-41-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-bromo-phenyl)-propionic acid, CAS# 517905-85-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-chloro-phenyl)-propionic acid, CAS# 511272-53-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-cyano-phenyl)-propionic acid, CAS# 517905-91-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-fluoro-phenyl)-propionic acid, CAS# 511272-51-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-hydroxy-phenyl)-propionic acid, CAS# 511272-35-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-methoxy-phenyl)-propionic acid, CAS# 511272-32-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-methyl-phenyl)-propionic acid, CAS# 507472-28-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-nitro-phenyl)-propionic acid, CAS# 374791-04-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-pyridyl)-propionic acid, CAS# 511272-43-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-thienyl)-propionic acid, CAS# 511272-46-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(3-trifluoromethyl-phenyl)-propionic acid, CAS# 517905-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(4-bromo-phenyl)-propionic acid, CAS# 220498-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(4-chloro-phenyl)-propionic acid, CAS# 479064-92-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(4-cyano-phenyl)-propionic acid, CAS# 517905-92-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(4-fluoro-phenyl)-propionic acid, CAS# 479064-95-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(4-hydroxy-phenyl)-propionic acid, CAS# 511272-36-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(4-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(4-methyl-phenyl)-propionic acid, CAS# 479064-98-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(4-nitro-phenyl)-propionic acid, CAS# 507472-26-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(4-trifluoromethyl-phenyl)-propionic acid, CAS# 517905-88-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-(6-methoxy-3-pyridyl)-propionic acid, CAS# 959581-71-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-3-phenylpropionic acid, CAS# 220498-02-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(1-naphthyl)-butyric acid, CAS# 269398-89-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2，4，5-trifluoro-phenyl)-butyric acid, CAS# 1217818-53-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2，4-dichloro-phenyl)-butyric acid, CAS# 269396-54-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2-bromo-phenyl)-butyric acid.HCl., CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2-bromo-phenyl)-butyric acidoHCl., CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2-chloro-phenyl)-butyric acid, CAS# 268734-29-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2-cyano-phenyl)-butyric acid, CAS# 269726-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2-fluoro-phenyl)-butyric acid, CAS# 331763-63-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2-furyl)-butyric acid, CAS# 270596-34-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2-methyl-phenyl)-butyric acid, CAS# 269398-81-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2-naphthyl)-butyric acid, CAS# 269398-91-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(2-trifluoromethyl-phenyl)-butyric acid, CAS# 269726-72-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3，4-dichloro-phenyl)-butyric acid, CAS# 269396-57-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3，4-difluoro-phenyl)-butyric acid, CAS# 269396-60-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3-benzothienyl)-butyric acid, CAS# 269396-51-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3-chloro-phenyl)-butyric acid, CAS# 331763-57-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3-cyano-phenyl)-butyric acid, CAS# 269726-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3-fluoro-phenyl)-butyric acid, CAS# 331763-67-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3-methyl-phenyl)-butyric acid, CAS# 269398-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3-pyridyl)-butyric acid, CAS# 269396-66-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3-thienyl)-butyric acid, CAS# 269726-93-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(3-trifluoromethyl-phenyl)-butyric acid, CAS# 269726-75-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-bromo-phenyl)-butyric acid, CAS# 331763-76-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-chloro-phenyl)-butyric acid, CAS# 331763-60-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-cyano-phenyl)-butyric acid, CAS# 269726-87-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-fluoro-phenyl)-butyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-iodo-phenyl)-butyric acid, CAS# 269396-73-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-methyl-phenyl)-butyric acid, CAS# 269398-86-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-nitro-phenyl)-butyric acid, CAS# 269398-78-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-pyridyl)-butyric acid, CAS# 269396-69-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-tert-butyl-phenyl)-butyric acid, CAS# 401916-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(4-trifluoromethyl-phenyl)-butyric acid, CAS# 269726-78-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4-(pentafluoro-phenyl)-butyric acid, CAS# 269398-94-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-4，4-diphenyl-butyric acid, CAS# 332062-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-5-hexenoic acid, CAS# 269726-95-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-5-hexynoic acid, CAS# 332064-94-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Amino-5-phenyl-pentanoic acid, CAS# 269398-87-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(R)-3-Thienylglycine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-2-(Aminomethyl)-3-methylbutanoic acid, CAS# 203854-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-2-(Aminomethyl)-4-methylpentanoic acid, CAS# 193887-45-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-2-Amino-3，3-diphenylpropanoic acid, CAS# 201484-50-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-2-Amino-4，4-difluorobutyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-2-Methoxy-phenylglycine, CAS# 1176648-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-2-tetrahydroisoquinoline acetic acid, CAS# 270062-99-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-2-Thienylglycine, CAS# 211682-13-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-(6-phenyl)-5-hexenoic acid, CAS# 270596-45-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-2-(tert-butoxymethyl)propanoic acid, CAS# 865152-44-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-2-benzylpropanoic acid, CAS# 203854-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-2-methylpropanoic acid, CAS# 203854-58-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-2-phenylpropanoic acid, CAS# 1217663-60-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(1-naphthyl)-propionic acid, CAS# 507472-10-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2，3-dichloro-phenyl)-propionic acid, CAS# 501015-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2，3-dimethoxy-phenyl)-propionic acid, CAS# 501015-36-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2，4-dichloro-phenyl)-propionic acid, CAS# 501015-34-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-bromo-phenyl)-propionic acid, CAS# 507472-17-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-chloro-phenyl)-propionic acid, CAS# 507472-15-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-fluoro-phenyl)-propionic acid, CAS# 507472-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-furyl)-propionic acid, CAS# 1217741-88-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-hydroxy-phenyl)-propionic acid, CAS# 501015-31-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-methoxy-phenyl)-propionic acid, CAS# 501015-28-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-methyl-phenyl)-propionic acid, CAS# 501015-26-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-naphthyl)-propionic acid, CAS# 507472-11-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-nitro-phenyl)-propionic acid, CAS# 507472-25-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-thienyl)-propionic acid, CAS# 507472-08-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(2-trifluoromethyl-phenyl)-propionic acid, CAS# 507472-19-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3，4-dimethoxy-phenyl)-propionic acid, CAS# 501015-37-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3，5-dimethoxy-phenyl)-propionic acid, CAS# 501015-38-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-bromo-phenyl)-propionic acid, CAS# 507472-18-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-chloro-phenyl)-propionic acid, CAS# 507472-16-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-cyano-phenyl)-propionic acid, CAS# 507472-23-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-fluoro-phenyl)-propionic acid, CAS# 507472-14-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-hydroxy-phenyl)-propionic acid, CAS# 501015-32-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-methoxy-phenyl)-propionic acid, CAS# 501015-29-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-methyl-phenyl)-propionic acid, CAS# 501015-27-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-nitro-phenyl)-propionic acid, CAS# 374791-01-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-pyridyl)-propionic acid, CAS# 507472-06-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-thienyl)-propionic acid, CAS# 507472-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(3-trifluoromethyl-phenyl)-propionic acid, CAS# 507472-20-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(4-bromo-phenyl)-propionic acid, CAS# 220497-68-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(4-chloro-phenyl)-propionic acid, CAS# 479064-91-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(4-cyano-phenyl)-propionic acid, CAS# 507472-24-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(4-fluoro-phenyl)-propionic acid, CAS# 479064-89-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(4-hydroxy-phenyl)-propionic acid, CAS# 501015-33-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(4-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(4-methyl-phenyl)-propionic acid, CAS# 479064-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(4-nitro-phenyl)-propionic acid, CAS# 501015-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(4-trifluoromethyl-phenyl)-propionic acid, CAS# 507472-21-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-(6-methoxy-3-pyridyl)-propionic acid, CAS# 1217771-73-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-3-phenylpropionic acid, CAS# 209252-15-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(1-naphthyl)-butyric acid, CAS# 270063-38-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2，4，5-trifluoro-phenyl)-butyric acid, CAS# 959580-94-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2，4-dichloro-phenyl)-butyric acid, CAS# 270063-49-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2-bromo-phenyl)-butyric acid, CAS# 403661-79-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2-chloro-phenyl)-butyric acid, CAS# 270596-37-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2-cyano-phenyl)-butyric acid, CAS# 270065-84-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2-fluoro-phenyl)-butyric acid, CAS# 270596-49-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2-furyl)-butyric acid, CAS# 270263-07-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2-methyl-phenyl)-butyric acid, CAS# 270062-91-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2-naphthyl)-butyric acid, CAS# 270063-40-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2-thienyl)-butyric acid, CAS# 269726-90-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(2-trifluoromethyl-phenyl)-butyric acid, CAS# 270065-75-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3，4-dichloro-phenyl)-butyric acid, CAS# 270063-52-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3，4-difluoro-phenyl)-butyric acid, CAS# 270063-55-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3-benzothienyl)-butyric acid, CAS# 270063-46-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3-chloro-phenyl)-butyric acid, CAS# 270596-40-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3-cyano-phenyl)-butyric acid, CAS# 270065-87-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3-fluoro-phenyl)-butyric acid, CAS# 270596-52-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3-methyl-phenyl)-butyric acid, CAS# 270062-94-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3-pyridyl)-butyric acid, CAS# 270063-60-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3-thienyl)-butyric acid, CAS# 270263-01-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(3-trifluoromethyl-phenyl)-butyric acid, CAS# 270065-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-bromo-phenyl)-butyric acid, CAS# 270062-86-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-chloro-phenyl)-butyric acid, CAS# 270596-43-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-cyano-phenyl)-butyric acid, CAS# 270065-90-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-fluoro-phenyl)-butyric acid, CAS# 270062-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-iodo-phenyl)-butyric acid, CAS# 270065-72-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-methyl-phenyl)-butyric acid, CAS# 270062-97-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-nitro-phenyl)-butyric acid, CAS# 270062-88-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-pyridyl)-butyric acid, CAS# 270065-69-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-tert-butyl-phenyl)-butyric acid, CAS# 403661-86-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(4-trifluoromethyl-phenyl)-butyric acid, CAS# 270065-81-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4-(pentafluoro-phenyl)-butyric acid, CAS# 270063-43-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-4，4-diphenyl-butyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-5-hexenoic acid, CAS# 270263-04-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-5-hexynoic acid, CAS# 270596-48-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Amino-5-phenyl-pentanoic acid, CAS# 219967-74-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-(S)-3-Thienylglycine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-?-2-tetrahydroisoquinoline acetic acid, CAS# 332064-67-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-?-Ala-OH, CAS# 35737-10-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-?-Ala-OH;FMOC-beta-Alanine, CAS# 35737-10-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-[15N]Ala-OH, CAS# 117398-49-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-[D4]Ala-OH, CAS# 225101-69-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-[ring-D5]Phe-OH, CAS# 225918-67-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-1，4-cis-ACHA-OH, CAS# 1217675-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-11-aminoundecanoic acid, CAS# 88574-07-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-1-Aminocyclopropane-1-carboxylic acid, CAS# 126705-22-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-1-D-Nal-OH, CAS# 138774-93-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-1-Methyl-D-tryptophan, CAS# 168471-22-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-1-Nal-OH, CAS# 96402-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-1-Nal-Wang resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，3-Difluoro-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，3-Dimethy-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，4-Difluoro-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，4-dimethoxy-4-(carboxymethyloxy)-benzhydrylamine, CAS# 126828-35-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，5-Difluoro-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，5-Dimethy-L-Phenylalanine, CAS# 1270300-68-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，6-Dichloro-D-Phenylalanine, CAS# 1260590-53-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，6-Difluoro-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，6-Difluoro-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2，6-Dimethy-L-Phenylalanine, CAS# 911813-85-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Abz-OH, CAS# 150256-42-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Aminoisobutyric acid, CAS# 94744-50-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Bromo-D-Phenylalanine, CAS# 220497-79-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Bromo-L-Phenylalanine, CAS# 220497-47-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Chloro-D-Phenylalanine, CAS# 205526-22-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Chloro-L-Phenylalanine, CAS# 198560-41-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Fluoro-D-Phenylalanine, CAS# 198545-46-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Fluoro-L-Phenylalanine, CAS# 205526-26-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Iodo-D-Phenylalanine, CAS# 478183-65-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Methoxy-D-Phenylalanine, CAS# 170642-30-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Methoxy-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Methy-D-Phenylalanine, CAS# 352351-63-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Methy-L-Phenylalanine, CAS# 211637-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Me-Trp-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Nal-OH, CAS# 112883-43-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Nal-WangResin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Pal-OH, CAS# 1236267-09-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Trifluoromethyl-D-Phenylalanine, CAS# 352523-15-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-2-Trifluoromethyl-L-Phenylalanine, CAS# 352523-16-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(1-Nal)-D-alanin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(1-Nal)-L-alanin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(1-Naphthyl)-Alanine, CAS# 96402-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(1-Naphthyl)-D-Alanine, CAS# 138774-49-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(1-Naphthyl)-D-Alanine, CAS# 138774-93-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(1-Naphthyl)-L-Alanine, CAS# 96402-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(2-Furyl)-D-alanine, CAS# 220497-85-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(2-Furyl)-L-alanine, CAS# 159611-02-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(2-Nal)-D-alanin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(2-Nal)-L-alanin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(2-Naphthyl)-Alanine, CAS# 112883-43-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(2-Naphthyl)-D-Alanine, CAS# 138774-94-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(2-Naphthyl)-L-Alanine, CAS# 112883-43-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(3-benzothienyl)-D-alanine, CAS# 177966-61-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(3-pyridyl)-D-alanine, CAS# 142994-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(3-pyridyl)-L-alanine, CAS# 175453-07-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(4-Thiazoyl)-L-alanine, CAS# 205528-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-(9-anthryl)-L-Alanine, CAS# 268734-27-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3，4-dehydro-L-Val-OH, CAS# 1932087-73-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3，4-Dichloro-D-Phenylalanine, CAS# 177966-58-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3，4-Dichloro-L-Phenylalanine, CAS# 177966-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3，4-Difluoro-D-Phenylalanine, CAS# 198545-59-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3，4-Difluoro-L-Phenylalanine, CAS# 198560-43-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3，5-Difluoro-D-Phenylalanine, CAS# 205526-24-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3，5-Difluoro-D-Phenylalanine, CAS# 205526-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3，5-DiIodo-Tyr-OH, CAS# 103213-31-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Amb-OH, CAS# 155369-11-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Amino-Tyrosine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Bromo-D-Phenylalanin, CAS# 220497-81-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Bromo-L-Phenylalanine, CAS# 220497-48-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Chloro-D-Phenylalanine, CAS# 205526-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Chloro-D-Phe-OH, CAS# 205526-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Chloro-L-Phenylalanine, CAS# 198560-44-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Cyano-D-Phenylalanine, CAS# 205526-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Cyano-L-Phenylalanine, CAS# 205526-36-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-D-Pal-OH, CAS# 142994-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Fluoro-D-Phenylalanine, CAS# 198545-72-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Fluoro-L-Phenylalanine, CAS# 198560-68-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Iodo-D-Phenylalanine, CAS# 478183-67-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Iodo-L-Phenylalanine, CAS# 210282-32-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Methoxy-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Methy-L-Phenylalanine, CAS# 211637-74-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Nitro-D-Phenylalanine, CAS# 478183-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Pal-OH, CAS# 175453-07-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Trifluoromethyl-D-Phenylalanine, CAS# 205526-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-3-Trifluoromethyl-L-Phenylalanine, CAS# 205526-27-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Abz-OH, CAS# 185116-43-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Amb-OH, CAS# 164470-64-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Amc-OH, CAS# 188715-40-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Amino-tetrahydropyran-4-carboxylic acid, CAS# 285996-72-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Bromo-D-Phenylalanin, CAS# 198545-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Bromo-L-Phenylalanine, CAS# 198561-04-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-carbamoylphenylalanine, CAS# 204716-17-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Chloro-D-Phenylalanine, CAS# 142994-19-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Chloro-L-Phenylalanine, CAS# 175453-08-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Cyano-D-Phenylalanine, CAS# 205526-34-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Cyano-L-Phenylalanine, CAS# 173963-93-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-D-Pal-OH, CAS# 205528-30-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Fluoro-D-Phenylalanine, CAS# 177966-64-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Fluoro-L-Phenylalanine, CAS# 169243-86-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Iodo-D-Phenylalanine, CAS# 205526-29-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Iodo-L-Phenylalanine, CAS# 82565-68-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Methy-D-Phenylalanine, CAS# 204260-38-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Methy-L-Phenylalanine, CAS# 199006-54-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Nitro-D-Phenylalanine, CAS# 177966-63-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Nitro-L-Phenylalanine, CAS# 95753-55-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Pal-OH, CAS# 169555-93-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Pal-OH, CAS# 169555-95-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-piperidylacetic acid, CAS# 180181-05-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Trifluoromethyl-D-Phenylalanine, CAS# 238742-88-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-4-Trifluoromethyl-L-Phenylalanine, CAS# 247113-86-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-5-Ava-OH, CAS# 123622-48-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-6-Cl-Trp-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-6-F-Trp-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-7-Amino-heptanoic acid, CAS# 127582-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-8-Aoc-OH, CAS# 126631-93-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-A(Bhoc)-aeg-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-AA-OH, CAS# 87512-31-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Abg-OH*HCl, CAS# 908117-93-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Abu(3-N3)-OH (2R，3R), CAS# 1229394-75-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Abu-OH, CAS# 135112-27-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-AC4C-OH, CAS# 885951-77-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-AC5C-OH, CAS# 117322-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-AC6C-OH, CAS# 162648-54-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Acp-OH, CAS# 88574-06-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-AEEAC, CAS# 166108-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMoc-AEEA-OH, CAS# 166108-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ahp-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Aib-OH, CAS# 94744-50-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-(Dmb)Gly-OH, CAS# 1188402-17-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-Ala-OH, CAS# 87512-31-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-OH, CAS# 35661-39-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-OH| Fmoc-L-Ala-OH, CAS# 35661-39-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-ol, CAS# 161529-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-OMe, CAS# 146346-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-OPfp, CAS# 86060-86-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMOC-ALA-OSU, CAS# 73724-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-Rink Amide-AM Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-Rink Amide-MBHA Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-Ser(Psi(Me，Me)pro)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-Ser(psiMe，Mepro)-OH, CAS# 252554-78-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-Thr(Psi(Me，Me)pro)-OH, CAS# 252554-79-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-Thr{psi(Me，Me)pro}-OH, CAS# 252554-79-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Ala-WangResin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Allo-Thr(tBu)-OH, CAS# 201481-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

fmoc-alpha-abu-oh, CAS# 135112-27-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-All-D-Ala-OH, CAS# 288617-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-All-L-Ala-OH, CAS# 288617-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-allyl-DL-Gly-OH, CAS# 221884-63-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Et-D-Ala-OH, CAS# 857478-30-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMOC-alpha-glutamine, CAS# 292150-20-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-D-Ala(Pentynyl)-OH, CAS# 1050501-65-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-D-Asp(tBu)-OH, CAS# 1231709-26-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-D-Leu-OH, CAS# 1231709-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-D-Lys(Boc)-OH, CAS# 1315449-94-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-D-Orn(Boc)-OH, CAS# 171860-40-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-D-Phe(2-F)-OH, CAS# 1315449-93-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-D-Pro-OH, CAS# 220155-72-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-D-Val-OH, CAS# 616867-28-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Ala(Pentynyl)-OH, CAS# 1198791-56-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Asp(tBu)-OH, CAS# 1072845-47-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Leu-OH, CAS# 312624-65-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Lys(Boc)-OH, CAS# 1202003-49-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Orn(Boc)-OH, CAS# 1315449-95-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Phe(2，6-F2)-OH, CAS# 1223105-51-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Phe(2-F)-OH, CAS# 1172127-44-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Phe-OH*1.5H2O, CAS# 135944-05-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Pro-OH, CAS# 167275-47-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Me-L-Val-OH, CAS# 169566-81-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Octenyl-D-Ala-OH, CAS# 288617-75-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Octenyl-L-Ala-OH, CAS# 945212-26-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Pentenyl-D-Ala-OH, CAS# 288617-73-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Pentenyl-L-Ala-OH, CAS# 288617-77-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Prg-D-Ala-OH, CAS# 1198791-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-alpha-Prg-L-Ala-OH, CAS# 1198791-65-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-AMCP-OH, CAS# 1263045-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-AOAC-OH, CAS# 123106-21-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Aph(Hor)-OH, CAS# 1253282-31-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Aph(tBucbm)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Alloc)2-OH, CAS# 148893-34-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Boc)2-OH, CAS# 143824-77-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Me)2-OH (asymmetrical), CAS# 268564-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Me)2-OH.HCl (ASymmetrical), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Me)2-OH.HCl (Symmetrical), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Me)2-OH·HCl (symmetrical), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Me，Pbf)-OH, CAS# 1135616-49-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Mtr)-OH, CAS# 98930-01-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Mts)-OH, CAS# 88743-97-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Mts)-Wang resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(NO2)-OH, CAS# 58111-94-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Pbf)-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Pbf)-OH, CAS# 154445-77-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Pbf)-ol, CAS# 260450-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Pbf)-OMe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Pbf)-OPFP, CAS# 1864541,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Pbf)-Rink Amide-AM Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Pbf)-Wang Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Pmc)-OPfp, CAS# 136013-81-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Tos)-OH, CAS# 83792-47-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Tos)-ol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg(Z)2-OH, CAS# 207857-35-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Arg-OH, CAS# 91000-69-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-OH, CAS# 132388-59-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-ol, CAS# 198543-08-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-OPfp, CAS# 132388-64-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-Ser[Psi(Me， Me)Pro]-OH, CAS# 920519-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-Ser{psi(Me，Me)pro}-OH, CAS# 920519-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-Thr[Psi(Me， Me)Pro]-OH, CAS# 957780-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-Thr[PSI(Me，Me)Pro]-OH, CAS# 957780-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-Thr{psi(Me，Me)pro}-OH, CAS# 957780-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-Wang Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn(Trt)-WangResin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn-Gly-Ala-Leu-Glu-pNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn-OH, CAS# 71989-16-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn-ol, CAS# 260450-76-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn-OPfp, CAS# 86060-99-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asn-OtBu, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(Dmab)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(EDANS)-OH, CAS# 182253-73-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(Oall)-OH, CAS# 146982-24-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(Obzl)-OH, CAS# 86060-84-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OBzl)-OH;fmoc-L-aspartic acid 4-benzyl ester, CAS# 86060-84-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OcHex)-OH, CAS# 130304-80-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMOC-ASP(ODMAB)-OH, CAS# 269066-08-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(Ome)-OH, CAS# 145038-53-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMOC-ASP(OMPE)-OH, CAS# 180675-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-(Dmb)Gly-OH, CAS# 900152-72-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-Glu(OtBu)-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-OH, CAS# 71989-14-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-ol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-OPfp, CAS# 86061-01-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-Ser[Psi (Me，Me)Pro]-OH, CAS# 955048-92-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-Ser{psi(Me，Me)pro}-OH, CAS# 955048-92-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-Thr(Psi(Me，Me)pro)-OH, CAS# 920519-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-Thr{psi(Me，Me)pro}-OH, CAS# 920519-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-Wang Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp(OtBu)-WangResin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-AMC, CAS# 238084-15-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-OAll, CAS# 144120-53-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-OBzl, CAS# 86060-83-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-ODmab, CAS# 172611-77-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-ODmb, CAS# 155866-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-OFm, CAS# 187671-16-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-OH, CAS# 119062-05-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-OMe, CAS# 145038-52-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-OtBu, CAS# 129460-09-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Asp-Wang resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Azetidine-3-carboxylic acid, CAS# 193693-64-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-b-Ala-WangResin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-b-chloro-L-alanine, CAS# 212651-52-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-beta-(2-quinolyl)-D-Ala-OH, CAS# 214852-58-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-beta-(3-benzothienyl)-Ala-OH, CAS# 177966-60-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-beta-(3-benzothienyl)-L-alanine, CAS# 177966-60-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-beta，beta-diphenyl-Ala-OH, CAS# 201484-50-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-b-HoLys(Boc)-OH, CAS# 203854-47-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Bpa-OH, CAS# 117666-96-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMoc-C(Bhoc)-aeg-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

FMOC-C1, CAS# 28920-43-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cha-OH, CAS# 135673-97-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cha-WangResin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Chg-OH, CAS# 161321-36-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Chg-WangResin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-cis-L-4-Fluoroproline, CAS# 1228307-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cit-OH, CAS# 133174-15-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cit-WangResin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cl, CAS# 28920-43-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cpa-OH, CAS# 371770-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cpg-OH, CAS# 220497-61-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys((RS)-2，3-di(palmitoyloxy)-propyl)-OH, CAS# 210532-98-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(2-hydroxyethyl)-OH, CAS# 200354-35-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(3-(Boc-amino)-propyl)-OH, CAS# 173963-91-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Acm)-OH, CAS# 86060-81-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Acm)-ol, CAS# 198543-46-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Acm)-OPfp, CAS# 86060-96-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Acm)-WangResin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Bzl)-OH, CAS# 53298-33-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Cam)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(DMT)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Dpm)-OH, CAS# 247595-29-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Et)-OH, CAS# 200354-34-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Me)-OH, CAS# 138021-87-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(MMt)-OH, CAS# 177582-21-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(Mtt)-OH, CAS# 269067-38-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(pMeBzl)-OH, CAS# 136050-67-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(pMeOBzl)-OH, CAS# 141892-41-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(StBu)-OH, CAS# 73724-43-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Fmoc-Cys(STmp)-OH, CAS# 1403834-74-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.