搜索此博客

2018年10月7日星期日

EOS-Peptide-19

EOS Med Chem is one of TOP Med-chemical company, special in FDA 2015-2018 new API and Intermediates commercial & GMP production.

Use EOS Med Chem GMP & ISO plant, custom synthesis your need chemicals.

All Intermediates we could supply CMC & DMF OPEN list. Form change, Impurity research, Change route, Improve purity.

Welcome to Site Audit.

2018, EOS Med Chem got China TOP100 New Drug Manu.


GP120-W61D-5-S;LGMLMICSAAE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-6;LGMLMICSAAEQLWV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-61;TFDGKGLCTNVSTVQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-62;KGLCTNVSTVQCTHG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-63;TNVSTVQCTHGIRPV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-69;SLAEEEVVIRSDNFM, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-6-S;MICSAAEQLWV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-7;MICSAAEQLWVTVYY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-70;EEVVIRSDNFMDNTK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-71;IRSDNFMDNTKTIIV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-72;NFMDNTKTIIVQLNE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-72-S;NFMDNTKTIIV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-73;NTKTIIVQLNESVAI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-74;IIVQLNESVAINCTR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-74-S;LNESVAINCTR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-75;LNESVAINCTRPNNN, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-76;VAINCTRPNNNTRKG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-77;CTRPNNNTRKGIHIG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-78;NNNTRKGIHIGPGRA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-79;RKGIHIGPGRAFYAA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-8;AAEQLWVTVYYGVPV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-80;HIGPGRAFYAARKII, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-81;GRAFYAARKIIGDIR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-82;YAARKIIGDIRQAHC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-83;KIIGDIRQAHCNLSR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-84;DIRQAHCNLSRAQWN, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-85;AHCNLSRAQWNNTLK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-86;LSRAQWNNTLKQIVI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-87;QWNNTLKQIVIKLRE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-88;TLKQIVIKLREHFGN, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-89;IVIKLREHFGNKTIK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-90;LREHFGNKTIKFNQS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-91;FGNKTIKFNQSSGGD, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-92;TIKFNQSSGGDPEIV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-93;NQSSGGDPEIVRHSF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-94;GGDPEIVRHSFNCGG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-95;EIVRHSFNCGGEFFY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-96;HSFNCGGEFFYCDTT, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-97;CGGEFFYCDTTQLFN, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-97-S;FFYCDTTQLFN, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-98;FFYCDTTQLFNSTWN, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-98-S;DTTQLFNSTWN, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GP120-W61D-99;DTTQLFNSTWNGTEG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
gp38, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
gp38;RVTAIEKYLQDQARLNSWGCAFRQVC(Disulfidebridge:20-26), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPC3 (144 - 152), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPC3 (144-152)??;FVGEFFTDV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPC3 (298 - 306), mouse, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPC3 (298-306), mouse??;EYILSLEEL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPDA, CAS# 65094-46-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-Pen-GRGDSPCA, CAS# 126716-28-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-Pen-G-R-G-D-S-P-C-A, CAS# 111844-17-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPG-NH2, CAS# 141497-12-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPHRSTPESRAAV, 5-FAM labeled;5-FAM-GPHRSTPESRAAV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPHRSTPESRAAV, 5-TMR labeled;5-TMR-GPHRSTPESRAAV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPHRSTPESRAAV, Biotinylated;Biotin-GPHRSTPESRAAV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPHRSTPESRAAV;GPHRSTPESRAAV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPNA/H-Glu-PNA, CAS# 7300-59-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPR, CAS# 47295-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-P-R, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-protein coupled receptor 143 (126-134), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPRP, CAS# 67869-62-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPRP-NH2, CAS# 126047-75-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPRPP amide, CAS# 126047-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GPRPPERHQS-NH2, CAS# 149836-35-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-Q, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GR 83074, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GR 83895, CAS# 152323-73-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GR 87389, CAS# 141663-86-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GR 94800, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GR 94800, CAS# 141636-65-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GR231118;H-Ile-Glu-Pro-Dap-Tyr-Arg-Leu-Arg-Tyr-NH2, CAS# 158859-98-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRADSP, CAS# 99896-86-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRADSPK, CAS# 125455-58-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRADSPK;GRADSPK, CAS# 125455-58-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRAMICIDIN, CAS# 1393-88-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRAMICIDIN C, CAS# 113-73-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Gramicidin S, CAS# 113-73-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Gramine, CAS# 87-52-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Granisetron, CAS# 109889-09-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Granisetron hydrochloride, CAS# 107007-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Granuliberin R, CAS# 64704-41-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Granuliberin-R, CAS# 64704-41-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Grape Seed Extract, CAS# 84929-27-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRAPE SEED P E, CAS# 274678-42-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Grb2 SH2 Domain Ligand, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Grb2 SH2 Domain Ligand;pY-VNV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRDGS, CAS# 99131-38-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Green Tea P.E, CAS# 84650-60-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (1-29) amide (rat), CAS# 91826-20-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (1-29) amide, human, [D-Ala2]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (1-29) amide, human, [D-Tle2,Nle26]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (1-29) amide, human, [D-Tle2]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (1-44) (HUMAN), CAS# 83930-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (bovine), CAS# 88894-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (bovine) Growth HorMone-Releasing HorMone (bovine), Growth HorMone-Releasing Factor (bovine), GHRH (bovine), SoMatoliberin (bovine), SoMatocrinin (bovine), CAS# 88894-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (free acid) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (free acid) (human), CAS# 90599-39-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (free acid) (huMan) GHRH (free acid) (huMan), Growth HorMone-Releasing Factor (free acid) (huMan), Growth HorMone-Releasing HorMone (free acid) (huMan), SoMatocrinin (free acid) (huMan), SoMatoliberin (free acid) (huMan), SoMatorelin (free acid), CAS# 90599-39-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (human), CAS# 83930-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (human) Acetate, CAS# 83930-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (huMan) SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin, CAS# 83930-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (ovine, caprine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (ovine, caprine) SoMatocrinin (ovine, caprine), SoMatoliberin (ovine, caprine), GHRH (ovine, caprine), Growth HorMone-Releasing HorMone (ovine, caprine), Growth HorMone-Releasing Factor (ovine, caprine), CAS# 94948-82-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (porcine), CAS# 88384-73-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (porcine) SoMatocrinin (porcine), SoMatoliberin (porcine), Growth HorMone-Releasing Factor (porcine), GHRH (porcine), Growth HorMone-Releasing HorMone (porcine), CAS# 88384-73-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF (rat) SoMatocrinin (rat), SoMatoliberin (rat), Growth HorMone-Releasing Factor (rat), GHRH (rat), Growth HorMone-Releasing HorMone (rat), CAS# 86472-71-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRF, porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Grf-phi heptacosapeptide amide, CAS# 90967-78-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDNP, CAS# 114681-65-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDS, CAS# 96426-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDS, amide;GRGDS-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDS;GRGDS, CAS# 96426-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDSC, CAS# 91037-71-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDsP, CAS# 111844-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDSP, CAS# 91037-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-R-G-D-S-P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDSP;GRGDSP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDSPC, CAS# 91575-26-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-R-G-D-S-P-C, CAS# 126646-79-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDSPK, CAS# 111119-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDSPK;GRGDSPK, CAS# 111119-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDTP, CAS# 108682-58-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-R-G-D-T-P, CAS# 108682-58-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGDTP;GRGDTP, CAS# 108682-58-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGES, CAS# 97461-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGESP, CAS# 99896-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-R-G-E-S-P (Inactive control), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGESP;GRGESP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGETP, CAS# 198632-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-R-G-E-T-P, CAS# 198632-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGETP;GRGETP, CAS# 198632-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRGLSLSR, CAS# 57836-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth arrest-specific protein 7 (281-290), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor human, CAS# 83930-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF (1 - 29), amide, human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF (1 - 40), amide, human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF (1 - 44), amide, bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF (1-29), amide, human;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, CAS# 89453-59-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF (1-40), amide, human;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2, CAS# 84069-10-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF (1-44), amide, bovine;YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF (1-44), amide, human;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF (1-44), amide, porcine;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF, (1 - 40), human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Factor, GRF, (1-40), human;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth hormone releasing hexapeptide, CAS# 87616-84-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth hormone releasing hexapeptide acetate, CAS# 145177-42-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth Hormone Releasing Peptide-6(GHRP-6), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Growth-Blocking Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRP (1-16) (porcine), CAS# 95211-11-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRP (14-27) (human, porcine, canine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRP (14-27) (huMan, porcine, canine), CAS# 81608-29-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRP (18-27) (huMan, porcine, canine) NeuroMedin C, CAS# 81608-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRP (huMan), CAS# 93755-85-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRP (porcine), CAS# 74815-57-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRP Gene-Associated Peptide Fragment, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GRPP (human), CAS# 1132745-52-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GS1101 CAL-101 (GS-1101), CAS# 870281-82-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSH, CAS# 70-18-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Gsk peptide, CAS# 99278-03-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSK-1120212 sodium salt, CAS# 871702-06-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSK-1120212(traMetinib,JTP-74057), CAS# 871700-17-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSK1349572 sodiuM salt, CAS# 1051375-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSK3 Peptide Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSK3 Peptide Substrate;GRPRTTSFAE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSK3 Substrate, a, b subunit;RAAVPPSPSLSRHSSPHQSEDEEE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSK-3 Substrate, Biotinylated, Phosphorylated, LC;Biotin-LC-RRAAEELDSRAG-pS-PQL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSK-3 Substrate, Biotinylated, Phosphorylated;Biotin-RRAAEELDSRAG-pS-PQL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSK-3 Substrate, Biotinylated;Biotin-RRAAEELDSRAGSPQL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GsMTx4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GSSG, CAS# 27025-41-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GST-Sa Chimera-Catalyzed Peptide;EAIYAAPFAK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GTPase KRas (7-15), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GTPase NRas (55-64), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GTP-Binding Protein Fragment, G alpha, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GTP-Binding Protein Fragment, G beta, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GTP-Binding Protein Fragment, Go alpha, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GTP-Binding Protein Fragment, Gs alpha, CAS# 101038-78-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GUAIFENESIN, CAS# 93-14-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GUANFACINE HCL, CAS# 29110-48-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Guanidineacetic acid, CAS# 352-97-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GUANIDINOPROPIONIC ACID, CAS# 353-09-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Guanosine, CAS# 118-00-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Guanylin (huMan), CAS# 183200-12-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Guanylin (rat), CAS# 144940-98-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Guanylin (Rat)??;PNTCEICAYAACTGC(DisulfidebondsbetweenCys4-Cys12andCys7-Cys15), CAS# 144940-98-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Guanylin, human, CAS# 183200-12-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Guanylin, human;PGTCEICAYAACTGC(Disulfidebridge:4-12and7-15), CAS# 183200-12-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Guanylin, rat, mouse, CAS# 144940-98-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Gum acacia powder, CAS# 2593228,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
G-V-L-S-N-V-I-G-Y-L-K-K-L-G-T-G-A-L-N-A-V-L-K-Q, CAS# 136831-50-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Gvp anti-ulcer agent, CAS# 138331-05-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Gycogen Synthase-derived peptide, phosphorylated, TAMRA-labeled??;5-TAMRA-KKLNRTL-pS-VA-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Gycogen Synthase-derived peptide, phosphorylated??;KKLNRTL-pS-VA-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
GYPGKF-NH2 Selective Protease-Activated Receptor 4 (PAR4) Agonist, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H 261, CAS# 91464-97-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H(-Arg-εAhx)6-Arg-OH, CAS# 457633-17-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H(-Asn-Pro-Asn-Ala)6-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-(Cys)2 胱氨酸, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H(-EENV)6-OH, CAS# 138783-15-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H(-Glu-Glu-Asn-Val)6-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H(-Glu-Glu-Asn-Val-Glu-His-Asp-Ala)2-Glu-Glu-Asn-Val-Glu-Glu-Asn-Val-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H/ACA ribonucleoprotein complex subunit 2 isoform a (144-153), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-1,4-cis-ACHC-OMe*HCl, CAS# 61367-16-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-142, CAS# 88806-65-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H1-7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H1-7, CAS# 65189-70-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-1-D-Nal-OH, CAS# 78306-92-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-1-Nal-OH, CAS# 55516-54-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2,5-Diiodo-His-OH · HCl, CAS# 105158-70-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db A23R297 tetramer-IGMFNLTFI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db AdV5 E1A tetramer-SGPSNTPPEI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db AdV5 E1A tetramer-SGPSNTPPEI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db AQM9 tetramer-AQMNNRDCL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Chlamydia CrpA tetramer-ASFVNPIYL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Chlamydia CrpA tetramer-ASFVNPIYL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Cpn FQL tetramer-FQLCNSYDL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Cpn QAP tetramer-QAPTNRWML-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db EpCAM17 2 tetramer-CLVMKAEM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Flu M2 8 tetramer-TPIRNEWGC-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db gp100 tetramer-EGSRNQDWL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db gp100 tetramer-EGSRNQDWL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db GP100 tetramer-KVPRNQDWL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db GQK9 tetramer-GQKMNAQAI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db HCV NS3 1629-1637 tetramer-GAVQNEVTL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db hPSA tetramer-HCIRNKSVIL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db hPSA tetramer-HCIRNKSVIL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db HPV 16 E7 tetramer-RAHYNIVTF-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db HPV16 E7 tetramer-RAHYNIVTF-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db human gp100 tetramer-KVPRNQDWL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db HY Uty tetramer-WMHHNMDLI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Influenza NP tetramer-ASNENMDAM-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Influenza NP tetramer-ASNENMDAM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Influenza NP tetramer-ASNENMDTM-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Influenza NP tetramer-ASNENMDTM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Influenza NP tetramer-ASNENMETM-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Influenza NP tetramer-ASNENMETM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Influenza PA tetramer-SSLENFRAYV-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Influenza PA tetramer-SSLENFRAYV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db LCMV gp276-286 tetramer-SGVENPGGYCL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db LCMV gp33 (C9M) tetramer-KAVYNFATM-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db LCMV gp33 (C9M) tetramer-KAVYNFATM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db LCMV gp33 tetramer-KAVYNFATC-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db LCMV gp33 tetramer-KAVYNFATC-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db LCMV NP396 tetramer-FQPQNGQFI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db LCMV NP396 tetramer-FQPQNGQFI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db MCMV M45 tetramer-HGIRNASFI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db MCMV M45 tetramer-HGIRNASFI-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db MCMV M45 tetramer-HGIRNASFI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db MimA2 tetramer-YAIENYLEL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db MimA2 tetramer-YAIENYLEL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db RSV M187-195 tetramer-NAITNAKII-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db RSV M187-195 tetramer-NAITNAKII-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db SPAS 1 tetramer-STHVNHLHC-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Survivin tetramer-ATFKNWPFL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Survivin tetramer-ATFKNWPFL-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db Survivin tetramer-ATFKNWPFL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db SV40 large T Ag 206-215 tetramer-SAINNYAQKL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db SV40 large T Ag 206-215 tetramer-SAINNYAQKL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db SV40 large T Ag 489-497 tetramer-QGINNLDNL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db SV40 large T Ag 489-497 tetramer-QGINNLDNL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db VSK9 tetramer-VSKINRTEM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Db WT1 tetramer-RMFPNAPYL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Dd HIV env tetramer-IGPGRAFYA-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Dd HIV V3 IGP tetramer-IGPGRAFYAR-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Dd MCMV M164 tetramer-AGPPRYSRI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Dd MCMV M164 tetramer-AGPPRYSRI-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Dd MCMV M164 tetramer-AGPPRYSRI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Dk HY RRL tetramer-RRLRKTLL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2-D-Nal-OH.HCl, CAS# 76985-09-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb b Gal ICP tetramer-ICPMYARV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Cpn ISF tetramer-ISFAFCQL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Cpn LIY tetramer-LIYNYPGV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Cpn LQQ tetramer-LQQRYSRL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Cpn LVY tetramer-LVYNYPGV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Cpn QES tetramer-QESCYGRL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Cpn SII tetramer-SIILFLPL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb gp34-41 tetramer-AVYNFATC-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb HBV core tetramer-MGLKFRQL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb HBV core tetramer-MGLKFRQL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb HBV HBsAg tetramer-VWLSVIWM-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb HBV HBsAg tetramer-VWLSVIWM-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb HBV HBsAg tetramer-VWLSVIWM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb HSV-1 gB tetramer-SSIEFARL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Influenza NS2 tetramer-RTFSFQLI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Influenza NS2 tetramer-RTFSFQLI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Influenza PB1 tetramer-SSYRRPVGI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Influenza PB1 tetramer-SSYRRPVGI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb LCMV gp34-41 tetramer-AVYNFATC-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb LCMV gp34-41 tetramer-AVYNFATC-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb LCMV gp34-43 tetramer-AVYNFATCGI-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb LCMV NP205-212 tetramer-YTVKYPNL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb LCMV NP205-212 tetramer-YTVKYPNL-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb LLO296 tetramer-VAYGRQVYL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb MAGE-A5 tetramer-HNTQYCNL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb MAGE-A5 tetramer-HNTQYCNL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb MAGE-AX169-176 tetramer-LGITYDGM-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb MAGE-AX169-176 tetramer-LGITYDGM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb mTERT tetramer-VGRNFTNL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb mTERT tetramer-VGRNFTNL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb MuLV p15E tetramer-KSPWFTTL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb Negative (SIY) tetramer-SIYRYYGL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb OVA E1 tetramer-EIINFEKL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb OVA G4 tetramer-SIIGFEKL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb OVA G4 tetramer-SIIGFEKL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb OVA Q4H7 tetramer-SIIQFEHL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb OVA tetramer-SIINFEKL-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb OVA tetramer-SIINFEKL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb pBM1 tetramer-INFDFNTI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb pBM1 tetramer-INFDFNTI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb SeV tetramer-FAPGNYPAL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb TRP-2 tetramer-SVYDFFVWL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb TRP-2 tetramer-SVYDFFVWL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb TSKB20 tetramer-ANYKFTLV-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb TSKB20 tetramer-ANYKFTLV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb VACV B8R tetramer-TSYKFESV-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb VACV B8R tetramer-TSYKFESV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb β-galactosidase tetramer-DAPIYTNV-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kb β-galactosidase tetramer-DAPIYTNV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd A20 DYW tetramer-DYWGQGTEL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd CD166 tetramer-SLNVSAISI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd EGFP tetramer-HYLSTQSAL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd HER2 tetramer-TYLPTNASL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd HIV gag tetramer-AMQMLKETI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd HIV gag tetramer-AMQMLKETI-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd IGRP tetramer-VYLKTNVFL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd IGRP tetramer-VYLKTNVFL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd Influenza HA tetramer-IYSTVASSL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd Influenza HA tetramer-IYSTVASSL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd Influenza HA tetramer-LYQNVGTYV-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd Influenza HA tetramer-LYQNVGTYV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd Influenza NP tetramer-TYQRTRALV-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd Influenza NP tetramer-TYQRTRALV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd InsB tetramer-LYLVCGERL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd M tb HspX tetramer-TYDKGILTV-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd malaria Pb9 tetramer-SYIPSAEKI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd MHV M2 tetramer-GFNKLRSTL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd MHV M2 tetramer-GFNKLRSTL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd NRP A7 tetramer-KYNKANAFL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd NRP-V7 tetramer-KYNKANVFL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd NRP-V7 tetramer-KYNKANVFL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd P11 tetramer-RFLAVFTMM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd P15 tetramer-VFTMMALCSL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd P60 217-225 tetramer-KYGVSVQDI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd Plasmodium CSP tetramer-SYVPSAEQI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd Plasmodium CSP tetramer-SYVPSAEQI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd RSV F glycoprotein tetramer-KYKNAVTEL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd RSV F glycoprotein tetramer-KYKNAVTEL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd RSV M2 tetramer-SYIGINNI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd RSV M2 tetramer-SYIGINNI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd RSV M2 tetramer-SYIGSINNI-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd RSV tetramer-SYIGSINNI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kd TUM tetramer-KYQAVTTTL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Kk TEN8 tetramer-TENSGKDI-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Ld LCMV NP118 tetramer-RPQASGVYM-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Ld M tb Ag85A tetramer-MPVGGQSSF-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Ld MTB Ag85A tetramer-MPVGGQSSF-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Ld MTB Ag85A tetramer-MPVGGQSSF-BV421 labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Ld MuLV gp70 tetramer-SPSYVYHQF-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Ld MuLV gp70 tetramer-SPSYVYHQF-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Ld β-galactosidase tetramer-TPHPARIGL-APC labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2Ld β-galactosidase tetramer-TPHPARIGL-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2M3 AttM MIV tetramer-MIVTLF-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2M3 LemA MIG tetramer-MIGWII-PE labeled, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2-Mercapto-His-OH, CAS# 2002-22-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2-Nal-OH, CAS# 616-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2-Nal-OH.HCl, CAS# 58438-03-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2-Pal-OH.2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2-Pal-OH·2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-2-Pal-OH·2HCl, CAS# 1082692-96-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-3,4-dehydroPro-OH, CAS# 4043-88-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-3,5-Diiodo-D-Tyr-OH, CAS# 16711-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-3-D-Pal-OH.2HCl, CAS# 70702-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-3-Pal-OH, CAS# 64090-98-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-3-Pal-OH.2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-3-Pal-OH·2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-3-Pal-Ome·2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-4-Pal-OH.2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-4-Pal-OH·2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-5-Ava-OH, CAS# 660-88-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HA Peptide, CAS# 92000-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HA peptide;YPYDVPDYA, CAS# 92000-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Abu-Gly-OH, CAS# 16305-80-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Abu-NH2.HCl, CAS# 7682-20-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Abu-OH, CAS# 1492-24-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Abu-OH(2氨基丁酸), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Abu-OtBu.HCl, CAS# 53956-05-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Abu-OtBu·HCl, CAS# 53956-05-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Abu-Phe-OH, CAS# 60577-37-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-AC6C-OH, CAS# 2756-85-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Acpc-Oet·HCl, CAS# 42303-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Acp-OH, CAS# 60-32-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Aib-Oet.HCl, CAS# 17288-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Aib-OEt·HCl, CAS# 17288-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Aib-OH, CAS# 10569-72-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Aib-OH, CAS# 62-57-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Aib-Ome.HCl, CAS# 15028-41-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Aib-OMe·HCl, CAS# 15028-41-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Aib-OtBu.HCl, CAS# 103614-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Aib-OtBu·HCl, CAS# 4512-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala(Cl)-OH.HCl, CAS# 2731-73-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-2-Chlorotrityl Resin?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-ALA-2NA.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Abu-OH, CAS# 39537-33-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-ALA-AFC TFA, CAS# 201847-57-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-4-Abz-OH, CAS# 94722-22-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-Ala-Ala-Ala-OH, CAS# 10576-91-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-Ala-Ala-OH, CAS# 10183-34-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-Ala-Glu-Glu-Glu-Glu-Glu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-Ala-OH, CAS# 926-79-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-NH2 · HCl, CAS# 79955-53-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-OMe, CAS# 84794-58-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-pNA · HCl, CAS# 50450-80-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-Tyr-Ala-Ala-OH, CAS# 107865-42-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-Tyr-Ala-OH, CAS# 107865-40-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ala-Tyr-OH, CAS# 112079-60-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-D-Ala-OH, CAS# 6745-19-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Gln-OH, CAS# 290312-62-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Gly-OH, CAS# 16422-07-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Lys-OH, CAS# 45243-22-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-NH2 · HCl, CAS# 41036-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-OH, CAS# 1948-31-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-OMe · HCl, CAS# 41036-19-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Ome.HCl, CAS# 41036-19-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-OtBu · HCl, CAS# 60417-38-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Phe-4MβNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Phe-AMC (free base), CAS# 62037-41-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Phe-AMC (free base)AAF-AMC (free base), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Phe-chloromethylketone · TFA, CAS# 184901-82-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Phe-pNA, CAS# 61043-41-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Phe-pNAAAF-pNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Phe-βNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-pNA, CAS# 50450-81-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Pro-Ala-Ala-OH, CAS# 61430-17-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Pro-Ala-OH, CAS# 53620-20-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Pro-Leu-pNA · HCl, CAS# 201732-32-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Pro-OH, CAS# 61430-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Pro-pNA · HCl, CAS# 201732-27-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Pro-Val-chloromethylketone, CAS# 90105-47-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Tyr-Ala-OH, CAS# 27485-58-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-Tyr-OH, CAS# 67131-52-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-βNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ala-βNA · TFA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-AMC, CAS# 77471-41-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-AMC.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Arg(NO2)-OMe · HCl, CAS# 161451-22-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Arg-AMC · HCl, CAS# 83363-71-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Arg-Arg-AFC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Arg-Arg-AFC;ARR-AFC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Arg-Arg-Ala-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Arg-OH, CAS# 16709-12-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Arg-βNA · 2 HCl, CAS# 90836-22-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Asn-OH, CAS# 31796-57-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Asp-Ala-Gln-His-Ala-Thr-Pro-Pro-Lys-Lys-Lys-Arg-Lys-Val-Glu-Asp-Pro-Lys-Asp-Phe-OH, CAS# 135546-44-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Asp-OH, CAS# 20727-65-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-CTC Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Cys-Ser-Ser-Ser-Pro-Ser-Lys-His-Cys-Gly-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Ala-Ala-OH, CAS# 5874-86-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Ala-OH, CAS# 3695-80-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Gln-OH, CAS# 281660-34-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Glu(K-D-Ala-D-Ala)-OH, CAS# 2614-55-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Glu(Lys-D-Ala-D-Ala-OH)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Glu(Lys-D-Ala-D-Ala-OH)-OH, CAS# 2614-55-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Glu-NH2, CAS# 45159-25-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Isogln-OH, CAS# 45159-25-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Phe-Ala-OH, CAS# 155114-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-D-Phe-OH, CAS# 3061-93-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Gln-OH, CAS# 39537-23-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Glu(OtBu)-NH2 ? HCl, CAS# 108607-07-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Glu(OtBu)-NH2 · HCl, CAS# 108607-07-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
h-ala-glu-asp-arg-oh, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
h-ala-glu-asp-gly-oh, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
h-ala-glu-asp-oh, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Glu-OH, CAS# 13187-90-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Gly-Ala-Ala-OH, CAS# 245730-24-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Gly-Glu-Gly-Leu-Ser-Ser-Pro-Phe-Trp-Ser-Leu-Ala-Ala-Pro-Gln-Arg-Phe-NH2, CAS# 99588-52-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Gly-Gly-Gly-Gly-OH, CAS# 20296-73-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Gly-Gly-Gly-OH, CAS# 5123-42-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Gly-NH2 · HCl, CAS# 71431-66-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Gly-Pro-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Gly-Ser-Glu-OH, CAS# 61756-28-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Gly-Tyr-NH2, CAS# 325691-41-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-His-Ala-OH, CAS# 146321-25-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-His-Lys-OH, CAS# 126828-32-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-His-Lys-OH; AHK, CAS# 126828-32-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-His-OH, CAS# 3253-17-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ile-OH, CAS# 29727-65-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Leu-Ala-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Leu-Lys-AMC;ALK-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Leu-Pro-Met-His-Ile-Arg-OH, CAS# 132160-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Leu-Tyr-Leu-βNA, CAS# 201985-44-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Lys-Leu-Arg-Glu-Arg-Leu-Lys-Gln-Arg-Gln-Gln-Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Ile-Leu-Phe-Leu-Gln-Glu-Gly-Gly-Leu-OH, CAS# 126947-95-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Met-OH, CAS# 14486-05-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-ALA-NH2.HCL, CAS# 33208-99-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-NH2·HCl, CAS# 33208-99-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-NHME.HCL, CAS# 61275-22-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-NHME2.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-OBzl·HCl, CAS# 5557-83-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-OBzl·TosOH, CAS# 42854-62-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-OcHex·HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-OEt·HCl, CAS# 1115-59-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-OiPr·HCl, CAS# 39825-33-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-OiPr·HCl, CAS# 62062-65-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-ol, CAS# 310399,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-OMe.HCl, CAS# 6306-52-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-OMe·HCl, CAS# 2491-20-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-OtBu·HCl, CAS# 13404-22-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe(4-fluoro)-Arg-Cha-homoArg-Tyr(3-iodo)-NH2;, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe(4-fluoro)-Arg-Cha-homoArg-Tyr-NH2;, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-Ala-OH, CAS# 54865-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-Gly-OH, CAS# 20807-28-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-Lys-AMC, CAS# 120928-02-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-Lys-AMC;AFK-AMC, CAS# 120928-02-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-NH2 · HCl, CAS# 60240-16-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-OH, CAS# 3061-90-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-pNA · HCl, CAS# 145090-14-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-Pro-OH, CAS# 34327-70-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-Pro-pNA, CAS# 201732-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Phe-Pro-βNA · HCl, CAS# 749831-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-pNA · HCl, CAS# 31796-55-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-PNA.HCL, CAS# 31796-55-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-pNA·HCl, CAS# 31796-55-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-4MβNA · HCl, CAS# 76496-07-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-AFC;, CAS# 125791-92-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-AFC;AP-AFC, CAS# 125791-92-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-Ala-Arg-βNA, CAS# 201985-59-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-Ala-OH, CAS# 61430-14-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-Ala-βNA, CAS# 201985-58-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-Arg-Gly-Asp-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-Gly-OH, CAS# 36301-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-Leu-OH, CAS# 132365-81-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-NH2 · HCl, CAS# 76399-73-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-OH, CAS# 13485-59-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-OMe · HCl, CAS# 71067-42-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-Phe-OH, CAS# 94885-46-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-pNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-pNA, CAS# 60189-44-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-Tyr-Ala-OH, CAS# 89045-46-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Pro-Val-EDANS, CAS# 396077-59-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Ser-OH, CAS# 3303-41-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Thr-OH, CAS# 24032-50-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Trp-Ala-OH, CAS# 126310-63-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Trp-OH, CAS# 16305-75-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Tyr-Ala-OH, CAS# 81075-03-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Tyr-NH2 · HCl, CAS# 38678-78-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Tyr-OEt · HCl, CAS# 13260-91-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Tyr-OH, CAS# 3061-88-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Val-Leu-OH, CAS# 93414-38-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Ala-Val-NH2 · HCl, CAS# 151266-67-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Halcinonide, CAS# 3093-35-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Halfenprox, CAS# 111872-58-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Allo-Thr-OH, CAS# 28954-12-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Halobetasol propionate, CAS# 66852-54-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Halofantrine hydrochloride, CAS# 36167-63-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Halofuginone, CAS# 55837-20-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Halostachin, CAS# 495-42-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Halosulfuron-methyl, CAS# 100784-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HALOXYFOP, CAS# 69806-34-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Haloxyfop-2-ethoxymethyl, CAS# 87237-48-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HALOXYFOP-METHYL, CAS# 69806-40-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
haloxyfop-R-methyl, CAS# 72619-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Haloxyl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-All-D-Ala-OH, CAS# 96886-55-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-All-L-Ala-OH, CAS# 96886-56-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Et-L-Ala-OH, CAS# 3059-97-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Asp(tBu)-OH, CAS# 1231709-25-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Asp-OH, CAS# 14603-76-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Leu-OH, CAS# 29589-63-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-DL-Phe-OH, CAS# 1132-26-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-DL-Trp-OMe, CAS# 114524-80-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-DL-Val-OH, CAS# 26287-62-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Phe(3-Br)-OH, CAS# 1212321-90-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Phe(3-I)-OH, CAS# 457652-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Phe(3-NO2)-OH, CAS# 1215092-13-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Phe(4-Br)-OH, CAS# 752971-41-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Trp-OH*0.5H2O, CAS# 56452-52-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Tyr-OH, CAS# 672-86-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-D-Val-OH, CAS# 53940-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Asp(tBu)-OH, CAS# 1217977-71-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Asp-OH, CAS# 3227-17-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Cys-OH*HCl, CAS# 148766-37-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Leu-OH, CAS# 105743-53-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Phe(2-Br)-OH, CAS# 1212180-27-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Phe(3-I)-OH, CAS# 457653-01-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Phe(3-NO2)-OH, CAS# 1231709-24-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Phe(4-Br)-OH, CAS# 747397-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Phe-OH, CAS# 23239-35-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Pro-OH, CAS# 42856-71-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Me-L-Val-OH, CAS# 53940-83-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Prg-D-Ala-OH, CAS# 1231709-27-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-alpha-Prg-L-Ala-OH, CAS# 403519-98-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Halquinol, CAS# 8067-69-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Hamburger Pentapeptide Analog, CAS# 131574-31-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Haptoglobin from pooled human plasma, CAS# 9087-69-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HA-pT-PPKKKRK, Phosphorylated;HA-pT-PPKKKRK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(Mtr)-OH.1/2H2O, CAS# 80745-10-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(Mtr)-OH·1/2H2O, CAS# 80745-10-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(NO2)-OH, CAS# 2149-70-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(NO2)-OMe·HCl, CAS# 51298-62-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(NO2)-Phe-OMe · HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(NO2)-pNA · HBr, CAS# 29028-61-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(Pbf)-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(Pbf)-2-Chlorotrityl Resin?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(Pbf)-CTC Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(Pbf)-OH, CAS# 200115-86-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(Pbf)-OMe·HCl, CAS# 257288-19-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(Pmc)-OH, CAS# 112160-37-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg(Tos)-OH, CAS# 4353-32-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Ala-NH2 · 2 HCl, CAS# 121185-76-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Ala-OH, CAS# 40968-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-AMC Hydrochloride salt, CAS# 70274-89-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-AMC.2HCL, CAS# 113712-08-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-4MβNA · 3 HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-AMC, CAS# 263843-55-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-Arg-Ala-Asp-Asp-Ser-Asp-Asp-Asp-Asp-Asp-OH, CAS# 154444-98-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH, CAS# 165893-48-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-Arg-Arg-Arg-Arg-OH, CAS# 96337-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-Arg-Arg-OH, CAS# 26791-46-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-Arg-OH, CAS# 6418-87-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-Gly-Asp-Met-Glu-OH, CAS# 328946-37-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-ARG-ARG-LEU-ILE-GLU-ASP-ASN-GLU-TYR-THR-ALA-ARG-GLY-OH, CAS# 81493-98-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-NH2 · 3 HCl, CAS# 114736-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-OH, CAS# 15483-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Arg-βNA · 3 HCl, CAS# 100900-26-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Asn-Ile-Ala-Glu-Ile-Ile-Lys-Asp-Ile-OH, CAS# 120180-27-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Asn-NH2, CAS# 68040-98-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Asp-OH, CAS# 15706-88-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-D-Asp-OH, CAS# 275354-61-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Gln-Arg-Arg-AMC, CAS# 243466-39-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Gln-OH, CAS# 2483-17-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Glu-OH, CAS# 15706-89-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Gly-NH2 · sulfate, CAS# 34367-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Gly-OH · HCl, CAS# 105241-88-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Gly-Tyr-Ala-Leu-Gly-OH, CAS# 59587-24-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-His-NH2, CAS# 244765-93-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Ile-OH, CAS# 62632-70-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Leu-OH, CAS# 1188-24-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Lys(DABCYL)-Thr-Ser-Gly-Pro-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH, CAS# 742080-61-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Lys-Arg-Thr-Leu-Arg-Arg-Leu-OH, CAS# 152246-44-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Lys-Gly-Asp-Ile-Lys-Ser-Tyr-pNA, CAS# 204450-29-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Lys-OH, CAS# 40968-46-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Met-NH2, CAS# 121185-77-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Met-OH, CAS# 45243-23-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-NH2.2HCl, CAS# 14975-30-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-NHME.2HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-NHME2.2HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Nle-Nle-ACC, CAS# 884005-69-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-OEt·2HCl, CAS# 36589-29-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-OH, CAS# 74-79-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Ome.2HCl, CAS# 26340-89-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-OMe·2HCl, CAS# 26340-89-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-OtBu.2HCl, CAS# 87459-72-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Phe-Ala-OH, CAS# 67368-27-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Phe-OBzl · sulfate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Phe-OH, CAS# 2047-13-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-pNA·2HCl, CAS# 40127-11-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Pro-Lys-Pro-Leu-Ala-SBzl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Pro-NH2 · 2 HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Pro-OH, CAS# 2418-69-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Pro-OMe · HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Pro-pNA, CAS# 112898-06-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Pro-pNA, CAS# 157054-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Ser-Arg-His-Phe-OH, CAS# 105931-70-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Ser-OH, CAS# 70921-62-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Thr-NH2 · 2 HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Trp-NH2 · 2 HCl, CAS# 281659-95-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Trp-OH, CAS# 25615-38-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Tyr-NH2 · 2 HCl, CAS# 128245-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Tyr-OH, CAS# 74863-12-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Val-Leu-(?)-Phe-Glu-Ala-Nle-NH2, CAS# 167875-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-Val-OH, CAS# 2896-20-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-ε-aminocaproyl-Arg-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn(Mtt)-OH, CAS# 144317-20-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn(Trt)-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn(Trt)-2-Chlorotrityl Resin?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn(Trt)-CTC Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn(Trt)-OH, CAS# 132388-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn(Trt)-OH·H2O, CAS# 132388-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn(Trt)-OtBu, CAS# 1998700-98-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-AMC Trifluoroacetate salt, CAS# 115047-89-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-AMC.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-Arg-Asn-Phe-Leu-Arg-Phe-NH2, CAS# 149471-12-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-Arg-Cys-Ser-Gln-Gly-Ser-Cys-Trp-Asn-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-betaNA, CAS# 3313-39-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-Glu-OH, CAS# 20917-58-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-NHME.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-NHME2.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-OH, CAS# 70-47-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-Ome.HCl, CAS# 57461-34-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-OtBu, CAS# 25456-86-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-PNA.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-Pro-Glu-Tyr(PO3H2)-OH, CAS# 290810-63-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-Pro-Thr-Asn-Leu-His-OH (fleshfly), CAS# 154277-65-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asn-Val-OH, CAS# 145314-87-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(Ala-OH)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(AMC)-OH, CAS# 133628-73-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(Gly-OH)-OH, CAS# 3790-52-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(His-OH)-OH, CAS# 20223-80-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(Leu-OH)-OH, CAS# 14650-26-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(Lys-OH)-OH, CAS# 56523-60-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-AMC · HCl, CAS# 219138-15-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-AMC.HCL, CAS# 219138-15-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-NH2·HCl, CAS# 199118-68-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-NHME.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-NHME2.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-ASP(OBZL)-OBZL.HCL, CAS# 6327-59-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-OBzl·HCl, CAS# 6327-59-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-OBzl·TosOH, CAS# 2886-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-OH, CAS# 2177-63-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-OtBu·HCl, CAS# 94347-11-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OBzl)-PNA.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OcHex)-OH, CAS# 112259-66-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OEt)-OEt·HCl, CAS# 16115-68-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OMe)-OH, CAS# 2177-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OMe)-OH·HCl, CAS# 16856-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OMe)-OMe·HCl, CAS# 32213-95-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OMe)-OtBu·HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-2-Chlorotrityl Resin?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-AMC.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-CTC Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-NHME.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-NHME2.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-OH, CAS# 3057-74-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-OMe·HCl, CAS# 2673-19-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-OtBu.HCl, CAS# 1791-13-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-OtBu·HCl, CAS# 1791-13-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(OtBu)-PNA.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(Phe-OH)-OH, CAS# 13433-10-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp(pNA)-OH · HCl, CAS# 201732-79-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-ASP(TBU)-OME, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-ASP(TBU)-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Ala-His-Lys-OH, CAS# 111543-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Ala-Ser-Gly-Glu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Ala-βNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-AMC, CAS# 219138-13-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Arg-Asn-Phe-Leu-Arg-Phe-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Arg-Gly-Asp-Ser-OH, CAS# 151997-53-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Arg-Leu-Asp-Ser-OH, CAS# 145880-23-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-asp-arg-oh, CAS# 270467,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH, CAS# 64315-16-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-OH, CAS# 82048-97-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Ser-OH, CAS# 91999-74-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Arg-βNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Asn-Gln-OH, CAS# 286465-87-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Asp-Asp-Asp-OH, CAS# 145224-95-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Asp-Asp-OH, CAS# 107208-63-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Asp-OH, CAS# 58471-53-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Gln-OH, CAS# 13433-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Glu-OH, CAS# 1554998,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Gly-OH, CAS# 3790-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Gly-Pro-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Leu-NH2, CAS# 17193-68-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Leu-OH, CAS# 3062-14-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Lys-OH, CAS# 5891-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-OBzl, CAS# 7362-93-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-OH, CAS# 56-84-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-OMe, CAS# 17812-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-OtBu, CAS# 4125-93-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Phe-NH2, CAS# 5241-71-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Phe-OH, CAS# 13433-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-pNA · HCl, CAS# 154564-03-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Pro-Gln-Phe-Tyr-OH, CAS# 793658-58-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Pro-Lys-Lys-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Pro-Lys-Lys-Glu-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Pro-pNA, CAS# 60189-48-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-asp-ser-oh, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Trp-OH, CAS# 71835-79-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-Val-OH, CAS# 13433-04-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Asp-β-Ala-OH, CAS# 13433-02-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HATPPKKKRK, 5-FAM labeled;5-FAM-HATPPKKKRK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HATPPKKKRK, 5-TMR labeled;5-TMR-HATPPKKKRK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HATPPKKKRK, Biotinylated;Biotin-HATPPKKKRK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HATPPKKKRK;HATPPKKKRK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HATU, CAS# 148893-10-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HAUS augmin-like complex subunit 3 (154-162), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
Hawthorn berry extract, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-b-Ala-AMC · TFA, CAS# 201847-54-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-b-Ala-pNA · HBr, CAS# 111196-17-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBcAg (HBV) (18 - 27), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBcAg (HBV) (18-27)??;FLPSDFFPSV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
hBD-1, β-Defensin-1, human;DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK(Disulfidebridge:5-34,12-27,17-35), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
hBD-3, β-Defensin-3, human;GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK(Disulfidebridge:11-40,18-33,23-41), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
hBD-4, β-Defensin-4, human;ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK(Disulfidebridge:6-33:13-27:17-34), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-beta-(3-Benzothienyl)-D-Ala-OH, CAS# 111139-55-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-beta-(3-Pyridyl)-D-Ala-OMe · 2 HCl, CAS# 197088-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-beta,beta-Dicyclohexyl-DL-Ala-OH, CAS# 274262-70-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-beta-Ala-betaNA · HBr, CAS# 201985-01-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-beta-HAsp-OH*HCl, CAS# 336182-10-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-beta-tBu-DL-Ala-OH, CAS# 106247-35-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Bpa-OH, CAS# 104504-45-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBTU, CAS# 94790-37-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV core (107 - 115), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV Core (107-115)??;CLTFGRETV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV core protein (128-140), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV core14, (HBA31), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV env (183–191), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV env (335 - 343), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV polymerase (455 - 463), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV Seq1 aa: 63-71, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV Seq1 aa: 93-100, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV Seq2 aa: 179-186, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV Seq2 aa: 208-216, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBV Seq2 aa: 28-39, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBVcore14, (HBA31)??;STLPETTVVRR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBVenv (183–191)??;FLLTRILTI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBVenv (335-343)??;WLSLLVPFV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBVpol455? HBV polymerase (455-463);GLSRYVARL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBVpol502, HBV polymerase (502 - 510), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBVpol502, HBV polymerase (502-510)??;KLHLYSHPI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBVpol655, HBV polymerase (655 - 663), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HBVpol655, HBV polymerase (655-663)??;ALMPLYACI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
hCG1811882, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cha-NH2, CAS# 145232-34-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cha-OH, CAS# 27527-05-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cha-Ome.HCl, CAS# 17193-39-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Chg-OH, CAS# 14328-51-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Chg-OH, CAS# 5664-29-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Chg-OMe.HCl, CAS# 14328-63-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Chg-OMe·HCl, CAS# 14328-63-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cit-AMC, CAS# 93753-78-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cit-AMC · HBrH-Orn(carbaMoyl)-AMC · HBr, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cit-AMCH-Orn(carbaMoyl)-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cit-OH, CAS# 372-75-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cit-Ome·2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cit-Phe-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCKFWW, CAS# 172546-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cpa-OH, CAS# 6232-19-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Crt-2Cl(Trt)-Cl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
hCT (Calcitonin),?Human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HC-Toxin synthetase 1, CAS# 148413-54-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCTU, CAS# 330645-87-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV (Hepatitis C Virus) NS3/4A Protease Substrate;Ac-DE-Dap(QXL520)-EE-Abu-ψ-[COO]AS-C(5-FAMsp)-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV Core Protein (107-114), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV Core Protein (1-20)??;MSTNPKPQRKTKRNTNRRPQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV Core Protein (19-25), CAS# 153299-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV Core Protein (59-68), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV NS3/4A Protease Substrate Hydrolysis Product 1;Ac-DE-Dap(QXL520)-EE-Abu, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV NS3/4A Protease Substrate Hydrolysis Product 2;Lac-Ser-Cys(5-FAMsp)-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV NS4A Protein (21-34) (JT strain), CAS# 176260-88-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV NS4A Protein (22-33) (FDA strain), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV NS4A Protein (22-34) (H strain), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV NS4A Protein: 18-40: JT strain, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV NS4A Protein: 21-34: JT strain, CAS# 176260-88-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV Nucleoprotein (88-96), CAS# 171926-86-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV Peptide Aa: 257-266, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV Peptide Aa: 35-44, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV Peptide Aa:131-140, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV Protease Substrate (RET S1);Ac-DE-D(Edans)-EE-Abu-ψ-[COO]-AS-K(Dabcyl)-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV, NS4A-Like Peptide??;KKGSVVIVGRIVLSGKPAIIPKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV-1 e2 Protein (484 - 499), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV-1 e2 Protein (484-499)??;PYCWHYPPKPCGIVPA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV-1 e2 Protein (554 - 569), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HCV-1 e2 Protein (554-569)??;WMNSTGFTKVCGAPPC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-(?)-Val-(?)-Phe-Met-OH, CAS# 149759-96-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Acm)-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Acm)-AMC.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Acm)-NH2.HCl, CAS# 88530-32-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Acm)-NH2·HCl, CAS# 88530-32-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Acm)-NHME.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Acm)-NHME2.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Acm)-OH·H2O, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Acm)-OH·HCl, CAS# 28798-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Acm)-PNA.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Bzl)-AMC, CAS# 80173-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Bzl)-Gly-OH, CAS# 7669-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Bzl)-OH, CAS# 421492,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Bzl)-ol, CAS# 85803-43-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Bzl)-OMe.HCl, CAS# 16741-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(carbamoyl)-OH, CAS# 2072-71-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Dpm)-OH, CAS# 5191-80-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Me)-OH, CAS# 1187-84-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(pMeOBzl)-OH, CAS# 2544-31-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(tBu)-OH·HCl, CAS# 212457,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(tBu)-OtBu·HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Trt)-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Trt)-2-Chlorotrityl Resin?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Trt)-AMC.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Trt)-CTC Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Trt)-NH2, CAS# 166737-85-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Trt)-NHME.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Trt)-NHME2.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Trt)-OH, CAS# 328542,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Trt)-PNA.HCL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Z)-OH, CAS# 1625-72-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys(Z)-OH·HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-4-Abz-Met-OH, CAS# 156707-43-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys-OH, CAS# 166184-23-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-CYS-ASP-PRO-GLY-TYR-ILE-GLY-SER-ARG-NH2, CAS# 110590-61-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-Asp-Pro-Gly-Tyr-Ile-Gly-Ser-Arg-OH, CAS# 110590-60-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-Gly-OH, CAS# 19246-18-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-OEt.HCl, CAS# 868-59-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-OH.HCl, CAS# 52-90-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-OMe.HCl, CAS# 18598-63-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-OMe·HCl, CAS# 18598-63-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-Thr-Thr-His-Trp-Gly-Phe-Thr-Leu-Cys-OH, CAS# 244082-19-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Cys-Val-2-Nal-Met-OH, CAS# 158022-12-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-2Nal-OH, CAS# 76985-09-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-2-Pal.2HCl, CAS# 37535-52-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-3Pal-OH*2HCl, CAS# 70702-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-3-Pal-Ome.2HCl, CAS# 197088-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-4-Pal-OH·2HCl, CAS# 174096-41-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Dab·2HBr, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Daba(Boc)-OH, CAS# 10270-94-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Daba-OH.HBr, CAS# 1758-80-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Abu-OH, CAS# 2623-91-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Abu-OtBu · HCl, CAS# 313994-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Abu-OtBu.HCl, CAS# 313994-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-2-Chlorotrityl Resin?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Ala-Ala-OH, CAS# 5874-89-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Ala-OH, CAS# 1115-78-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-AMC · TFA, CAS# 201847-52-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-CTC Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH, CAS# 286842-36-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-D-Ala-D-Ala-D-Ala-D-Ala-OH, CAS# 10491-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-D-Ala-D-Ala-D-Ala-OH, CAS# 926-78-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-D-Ala-D-Ala-OH, CAS# 1114-94-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-D-Ala-OH, CAS# 923-16-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-D-Ala-OMe · HCl, CAS# 105328-90-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-D-Ala-βNA · HCl, CAS# 741235-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-D-Glu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-D-Phe-OH hydrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Gln-octadecyl ester · HCl, CAS# 153508-74-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Gln-OH, CAS# 205252-36-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Gly-Gly-OH, CAS# 77286-90-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Gly-OH, CAS# 3997-90-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Leu-Lys-AMC, CAS# 104881-72-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Leu-OH, CAS# 67113-60-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-NH2·HCl, CAS# 71810-97-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-OBzl.TosOH, CAS# 41036-32-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-OBzl·TosOH, CAS# 41036-32-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-OH, CAS# 338-69-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Ome.HCl, CAS# 14316-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-OMe·HCl, CAS# 14316-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-OtBu.HCl, CAS# 59531-86-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-OtBu·HCl, CAS# 59531-86-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Phe-OH, CAS# 3061-95-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-pNA · HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Ala-Pro-OH, CAS# 61430-12-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-ALK-AMC, CAS# 104881-72-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Allo-Ile-OH, CAS# 319-78-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Allo-Thr-OH, CAS# 24830-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-AllylGly-OH, CAS# 54594-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Dapa(Boc)-Ome.HCl, CAS# 114559-25-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Dapa-OH.HCl, CAS# 1482-97-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Dapa-OH·2HBr, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Dapa-OH·HBr, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-Dap-OH*HCl, CAS# 54897-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg(Mtr)-OH, CAS# 200114-52-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg(NO2)-OH, CAS# 66036-77-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg(Pbf)-2-Chlorotrityl Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg(Pbf)-2-Chlorotrityl Resin?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg(Pbf)-CTC Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg(Pbf)-OH, CAS# 200116-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg(Pmc)-OH, CAS# 191869-60-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg-Gly-Asp-Trp-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg-NH2.2HCl, CAS# 203308-91-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg-OH, CAS# 157-06-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg-OH HCl, CAS# 627-75-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg-OH*HCl, CAS# 627-75-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg-OH·HCl, CAS# 627-75-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg-OMe·2HCl, CAS# 78851-84-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Arg-Phe-OH, CAS# 133410-92-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asn(Trt)-2-Chlorotrityl Resin?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asn(Trt)-CTC Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asn(Trt)-OH·H2O, CAS# 200192-49-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asn(Trt)-OtBu·HCl, CAS# 1998701-13-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asn-OH·H2O, CAS# 2058-58-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp, CAS# 1783-96-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(Obzl)-Obzl.TosOH, CAS# 4079-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OBzl)-OBzl·TosOH, CAS# 4079-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OBzl)-OH, CAS# 13188-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OEt)-OEt·HCl, CAS# 112018-26-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OMe)-OH · HCl, CAS# 21394-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OMe)-OH·HCl, CAS# 21394-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OMe)-OMe·HCl, CAS# 69630-50-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OtBu)-2-Chlorotrityl Resin?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OtBu)-AFC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OtBu)-CTC Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OtBu)-OH, CAS# 64960-75-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OtBu)-OMe·HCl, CAS# 63329-02-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OtBu)-OtBu.HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp(OtBu)-OtBu·HCl, CAS# 135904-71-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp-Obzl, CAS# 6367-42-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp-OH, CAS# 1783-96-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp-Ome, CAS# 65414-78-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Asp-OtBu.HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Aza-OH*HCl, CAS# 105928-88-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Bip(4,4')-OH·HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Bip-OH, CAS# 170080-13-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HDBTU, CAS# 164861-52-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
HDCBS, CAS# 54970-72-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.
H-D-Cha-OH, CAS# 58717-02-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.