| NA, CAS# 1007601-96-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 682745-43-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 1174161-83-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 1126-50-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 945716-97-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 790241-30-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 1126641-10-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 332013-24-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 332013-28-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 937286-43-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NA, CAS# 147818-98-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAAG, Spaglumic acid, CAS# 3106-85-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nabumetone, CAS# 42924-53-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-AC-DL-Phe(4-F), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl [pClDPhe1,2,DTrp3,DArg6,DAla10]-LH-RH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl Carnosine, CAS# 56353-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl Cholecystokinin, CCK (26-30), Sulfated, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl Cholecystokinin, CCK (26-31), Non-Sulfated, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl Cholecystokinin, CCK (26-31), Sulfated, CAS# 89911-65-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl dipeptide-1, CAS# 95231-32-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl, ACTH (1-17), human, CAS# 197906-63-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl, a-TGF: 34-43, Methyl Ester, rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-beta-alanyl-L-histidyl-L-seryl-L-histidine, CAS# 820959-17-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-beta-glucosaminyl-N-acetylmuramyl-alanylisoglutamine, CAS# 70280-03-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-cholera toxin (50-64)-3-amide, CAS# 132177-90-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-D-alanine, CAS# 19436-52-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-demethylmuramyl-alanyl-isoglutamine, CAS# 60355-77-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-DL-Alanine, CAS# 1115-69-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-DL-Leucine, CAS# 99-15-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-DL-Methionine, CAS# 1115-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-DL-phenylalanine, CAS# 2901-75-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-DL-Serine, CAS# 97-14-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-DL-tryptophan, CAS# 87-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-DL-tryptophane, CAS# 87-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-D-mannosamine, CAS# 7772-94-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-D-tryptophan, CAS# 138798,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyle-D-Leucine, CAS# 19764-30-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-gastrin releasing peptide (20-26) ethyl ester, CAS# 122001-05-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-gastrin releasing peptide ethyl ester, CAS# 122000-99-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-glycine, CAS# 543-24-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-alanine, CAS# 97-69-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-carnosine, CAS# 56353-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-cysteine, CAS# 616-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-Glutamic acid, CAS# 1188-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-Glutamine, CAS# 2490-97-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-Hydroxyproline, CAS# 39966-33-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-isoleucine, CAS# 3077-46-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-leucine, CAS# 1188-21-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-lysine, CAS# 1946-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-phenylalanine, CAS# 2018-61-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-prolinamide, CAS# 16395-58-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-Proline, CAS# 68-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-thiaproline, CAS# 54323-50-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-tryptophan, CAS# 1218-34-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-tyrosine, CAS# 537-55-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ACETYL-L-TYROSINE ETHYL ESTER, CAS# 840-97-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-L-Valine, CAS# 96-81-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-Lys-Octreotide, CAS# 173606-11-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetylmuramyl-aminobutyryl-isoglutamine, CAS# 66112-58-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetylnornicotine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-Phe-Octreotide, CAS# 83795-61-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-S-(2-carbamoylethyl)-L-Cysteine, CAS# 81690-92-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Acetyl-thiomuramyl-alanyl-isoglutamine, CAS# 83375-11-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAD-dependent protein deacetylase sirtuin-2 (192-200), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NADH Inhibitor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nadifloxacin, CAS# 124858-35-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NADP-dependent malic enzyme (224-232), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nafamostat mesylate, CAS# 82956-11-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nafarelin, CAS# 86220-42-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nafarelin, CAS# 76932-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nafarelin Acetate, CAS# 76932-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nafarelin; Nafarelin acetate, CAS# 86220-42-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nafcillin sodium salt monohydrate, CAS# 7177-50-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAFRONYL, CAS# 31329-57-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAFRONYL OXALATE, CAS# 474972,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naftifine, CAS# 65472-88-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAFTIFINE HCL, CAS# 65473-14-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naftopidil, CAS# 57149-07-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naktiivql nanopeptide, CAS# 119980-12-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naled, CAS# 300-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nalidixic acid, CAS# 389-08-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nalmefene hydrochloride, CAS# 58895-64-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naloxone hydrochloride, CAS# 357-08-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naloxone hydrochloride dihydrate, CAS# 51481-60-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ALPHA-CBZ-ARG-ARG-PRO-PHE-HIS-STA-ILE-HIS-N-EPSILON-BOC-LYS METHYL ESTER, CAS# 93287-54-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nalpha-FMOC-L-Tryptophan, CAS# 35737-15-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nalpha-Fmoc-Ndelta-Boc-L-ornithine, CAS# 109425-55-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nalpha-Fmoc-Ndelta-trityl-L-glutamine, CAS# 132327-80-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-alpha-FMOC-Nepsilon-BOC-L-Lysine, CAS# 71989-26-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naltrexone, CAS# 16590-41-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naltrexone hydrochloride, CAS# 16676-29-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAM, CAS# 65-82-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Aminopiperidine, CAS# 2213-43-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nandrolone, CAS# 434-22-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nandrolone Decanoate, CAS# 360-70-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NANDROLONE PHENYLPROPIONATE, CAS# 62-90-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nandrolone propionat, CAS# 7207-92-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAP, CAS# 211439-12-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAP/ NAPVSIPQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAP;NAPVSIPQ, CAS# 211439-12-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naphathoquine Phosphate, CAS# 173531-58-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naphazoline hydrochloride, CAS# 550-99-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naphthol green B, CAS# 19381-50-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Napropamid, CAS# 15299-99-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naproxen, CAS# 22204-53-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NAPROXEN SODIUM, CAS# 26159-34-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naproxol, CAS# 26159-36-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naratriptan, CAS# 121679-13-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NARATRIPTAN HYDROCHLORIDE (125 MG)F0C36099%8MG/MG(AI), CAS# 143388-64-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Naringenin, CAS# 480-41-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NARINGIN, CAS# 10236-47-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NARINGIN DIHYDROCHALCONE, CAS# 18916-17-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nateglinide, CAS# 105816-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NATNVIFSRCRDEMF M WD repeat domain 16 (145-175), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Natriuretic peptide, CAS# 2625553,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Natriuretic peptide, brain, CAS# 114471-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Natriuretic peptide, C-type, CAS# 127869-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nattokinase, CAS# 133876-92-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nazumamide A, CAS# 138949-86-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Benzoyl-(2R,3S)-3-amino-2-hydroxy-3-phenyl-propionic acid, CAS# 132201-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Benzoyl-(2S,3R)-3-amino-2-hydroxy-3-phenyl-propionic acid, CAS# 54323-80-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Benzylglycine ethyl ester, CAS# 6436-90-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Benzyloxycarbonyl-D-alanine, CAS# 26607-51-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Benzyloxycarbonyl-D-proline, CAS# 6404-31-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Benzyloxycarbonyl-glycyl-glycine;, CAS# 2566-19-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Benzyloxycarbonyl-L-glutamic acid;Cbz-Glu-OH, CAS# 1155-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-beta-Aminoethyl-Gly-OH, CAS# 24123-14-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(2,3-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(2-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(2-trifluoromethyl-phenyl)-propionic acid, CAS# 1217762-48-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(3,4-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(3,5-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(3-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(3-trifluoromethyl-phenyl)-propionic acid, CAS# 1217758-46-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(4-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(4-methyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-(4-trifluoromethyl-phenyl)-propionic acid, CAS# 1217733-31-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-m-tolyl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-naphthalen-1-yl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-naphthalen-2-yl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-3-phenyl-propionic acid, CAS# 145514-62-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-2-hydroxy-4-phenyl-butyric acid, CAS# 77171-41-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-3-(2-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-3-(3-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-Amino-3-(4-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2R,3R)-3-hydroxy-3-o-tolyl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amimo-2-hydroxy-3-(3,4-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-(2,3-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-(2-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-(2-trifluoromethyl-phenyl)-propionic acid, CAS# 959577-29-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-(3,5-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-(3-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-(3-trifluoromethyl-phenyl)-propionic acid, CAS# 959574-99-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-(4-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-(4-trifluoromethyl-phenyl)-propionic acid, CAS# 959582-10-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-m-tolyl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-naphthalen-1-yl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-naphthalen-2-yl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-o-tolyl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-3-phenyl-propionic acid, CAS# 59937-41-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-4-phenyl-butyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-2-hydroxy-5-methyl-hexanoic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-3-(2-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-3-(3-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-3-Amino-3-(4-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-(2S,3S)-Amino-2-hydroxy-3-(4-methyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-4-oxo-L-proline tert-butyl ester, CAS# 166410-05-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-4-oxo-Pro.Ome, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-cis-4-Hydroxy-L-proline, CAS# 87691-27-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-cis-4-Hydroxy-L-proline methyl ester, CAS# 102195-79-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-D-Prolinamide, CAS# 54503-10-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-BOC-L-Arginine hydrochloride, CAS# 35897-34-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-BOC-L-PROLINOL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-L-pyroglutaMic acid, CAS# 53100-44-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-L-tert-Leucine, CAS# 62965-35-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-L-tert-leucine, CAS# 114676-69-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-N'-xanthyl-L -GlutaMine, CAS# 55260-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-S-Trityl-L-cysteine, CAS# 21947-98-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Boc-trans-4-Hydroxy-L-proline methyl ester, CAS# 74844-91-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NBT, CAS# 298-83-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| n-Butyloxycarbonyl-Dap-OH, CAS# 188016-53-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-BZ-Val-Gly-Arg PNA HC1, CAS# 64815-80-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-BZ-Val-Gly-ArgPNAHC1, CAS# 64815-80-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NC3 CLAC-P (430-443), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Carbobenzyloxy-L-alanine;Z-L-Alanine, CAS# 1142-20-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Cbz-cis-4-Fluoro-L-prolinonitrile, CAS# 518047-78-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Cbz-D-aspartic Acid, CAS# 78663-07-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Cbz-Hydroxy-L-proline, CAS# 13504-85-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Cbz-L-Phenylalanine, CAS# 1161-13-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-CBZ-L-Proline, CAS# 1148-11-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-CBZ-L-Valine, CAS# 1149-26-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-CBZ-trans-4-Hydroxy-D-prolinol, CAS# 1448706-36-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-cis-2,6-Dimethylpiperidinocarbonyl-β-tBu-Ala-D-Trp(1-methoxycarbonyl)-D-Nle-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Coumaroyldopamine, CAS# 103188-46-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Cyclohexylmaleimide, CAS# 1631-25-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Dodecanoyl-glycine, CAS# 7596-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NDP-MSH, 5-TAMRA-labeled;5-TMR-SYS-Nle-EHfRWGKPV-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NEAYVHDAPVRSLN, CAS# 143305-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-E-A-Y-V-H-D-A-P-V-R-S-L-N, CAS# 143305-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nebivolol, CAS# 99200-09-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nebivolol Hydrochloride, CAS# 152520-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neburon, CAS# 555-37-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Necrofibrin Hexapeptide, human;GAVSTA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Necrofibrin, human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Necrofibrin, rat, CAS# 123402-49-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nectofibrin Hexapeptide (rat), CAS# 123402-49-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nedaplatin, CAS# 95734-82-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nefazodone hydrochloride, CAS# 82752-99-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nefiracetam, CAS# 77191-36-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NEFOPAM, CAS# 13669-70-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nefopam hydrochloride, CAS# 23327-57-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nelarabine, CAS# 121032-29-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nelipepimut-S, CAS# 160212-35-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nemadectin, CAS# 102130-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neochamaejasmin, CAS# 90411-13-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neoendorphin (1-5), α-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neohesperidin, CAS# 13241-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neohesperidin Dihydrochalcone, CAS# 20702-77-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neo-Kyotorphin, CAS# 83759-54-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neo-Kyotorphin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neoline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neomycin sulfate, CAS# 1405-10-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neosperidin dihydrochalcone, CAS# 20702-77-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neotame, CAS# 165450-17-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nepadutant, CAS# 183747-35-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nepafenac, CAS# 78281-72-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nephilatoxin NPTX-11, CAS# 119613-54-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nephilatoxin NPTX-9, CAS# 114355-42-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nephritogenoside, CAS# 81276-22-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nepicastat, CAS# 173997-05-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nepicastat hydrochloride, CAS# 170151-24-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-epsilon-Carbobenzyloxy-L-lysine;H-Lys(Cbz)-OH, CAS# 1155-64-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nequinate, CAS# 13997-19-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neratinib, CAS# 698387-09-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NES Topoisomerase II alpha (1017 - 1028), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NES Topoisomerase II alpha (1017-1028)??;DILRDFFELRLK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesfatin-1 (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesfatin-1 (huMan) Nucleobindin-2 (25-106) (huMan), NUCB2 (25-106) (huMan), DNA-Binding Protein NEFA (25-106) (huMan), Gastric Cancer Antigen Zg4 (25-106) (huMan), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesfatin-1 (mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesfatin-1 (Mouse) Nucleobindin-2 (25-106) (Mouse), NUCB2 (25-106) (Mouse), DNA-Binding Protein NEFA (25-106) (Mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesfatin-1 (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesfatin-1 (rat) Nucleobindin-2 (1-82) (rat), NUCB2 (1-82) (rat), DNA-Binding Protein NEFA (1-82) (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesiritide, CAS# 124584-08-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesiritide [USAN:INN], CAS# 124584-08-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesiritide Acetate, CAS# 114471-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesiritide Acetate (BNP-32) Brain Natriuretic Pept, CAS# 114471-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesiritide citrate, CAS# 189032-40-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nesirtide, CAS# 114471-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Ethoxycarbonyl-2-ethoxy-1,2-dihydroquinoline, CAS# 16357-59-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Ethyl-2-pyrrolidone, CAS# 2687-91-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Ethyl-D-glucamine, CAS# 14216-22-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Ethyl-N-(3-dimethylaminopropyl)-carbodiimide · HCl, CAS# 25952-53-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Netilmicin sulfate, CAS# 56391-57-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Ne-Trifluoroacetyl-L-lysine, CAS# 10009-20-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Netropsin dihydrochloride, CAS# 1438-30-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Netupitant, CAS# 290297-26-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Et-Val-Leu-anilide, CAS# 282726-22-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neural-Cadherin (76-85) amide (chicken), CAS# 127650-08-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuraminidase, CAS# 9001-67-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuroendocrine Regulatory Peptide-1 (human), CAS# 954420-50-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuroendocrine Regulatory Peptide-1 (huMan) NERP-1 (huMan), CAS# 954420-50-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuroendocrine Regulatory Peptide-1 (rat), CAS# 954420-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuroendocrine Regulatory Peptide-1 (rat) NERP-1 (rat), CAS# 954420-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuroendocrine Regulatory Peptide-2 (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuroendocrine Regulatory Peptide-2 (huMan) NERP-2 (huMan), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuroendocrine Regulatory Peptide-2 (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuroendocrine Regulatory Peptide-2 (rat) NERP-2 (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurogranin (28-43), CAS# 146554-17-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurogranin (30-45) (huMan), CAS# 146554-17-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurogranin 28-43 [AAKIQA-pS-FRGHMARKK], Phosphorylated;AAKIQA-pS-FRGHMARKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurogranin 28-43 [AAKIQASFRGHMARKK], 5-FAM labeled;5-FAM-AAKIQASFRGHMARKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurogranin 28-43 [AAKIQASFRGHMARKK], 5-TMR labeled;5-TMR-AAKIQASFRGHMARKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurogranin 28-43 [AAKIQASFRGHMARKK], Biotinylated;Biotin-AAKIQASFRGHMARKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurogranin 28-43 [AAKIQASFRGHMARKK], Biotinylated-LC;Biotin-LC-AAKIQASFRGHMARKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurogranin 28-43 [AAKIQASFRGHMARKK];AAKIQASFRGHMARKK, CAS# 146554-17-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A (4-10), CAS# 97559-35-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A (4-10), [?-Ala8]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A (4-10);DSFVGLM-NH2, CAS# 97559-35-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A (4-10)-[Ala5, β-Ala8], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A (4-10)-[Nle10], CAS# 110863-33-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A (4-10)-[Trp7,β-Ala8], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A (4-10)-[β-Ala8], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A / Substance K, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A NKA, Substance K, Neurokinin α, NeuroMedin L, CAS# 86933-74-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A(4-10) [Tyr5,D-Trp6,8,9,Arg10](MEN 10 207), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A: Substance K: Neuromedin L: NKA;HKTDSFVGLM-NH2, CAS# 86933-74-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A; Substance K; Neuromedin L; NKA, CAS# 86933-74-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin A-[Tyr0], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin B, CAS# 86933-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin B NKB, CAS# 86933-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin B[D-P2, D-W6, 8, Nle10] (Porcine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin B-[P7], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin B-[Tyr0], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin Receptor (393 - 407), rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinin Receptor (393-407), rat;KTMTESSFYSNMLA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurokinins, Neuromedins, Other Tachykinins and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin (B-30), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin (B-30);LSWDLPEPRSRAGKIRVHPRGNLWATGHFM-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin (U25), human, CAS# 312306-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin (U25), porcine, CAS# 98395-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin (U-25), porcine;FKVDEEFQGPIVSQNRRYFLFRPRN-NH2, CAS# 98395-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin (U8), porcine, CAS# 98395-75-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin (U-8), porcine;YFLFRPRN-NH2, CAS# 98395-75-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NeuroMedin B, CAS# 87096-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin B (Human, Porcine, Rat), CAS# 87096-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin B, porcine, CAS# 87096-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin B;GNLWATGHFM-NH2, CAS# 87096-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin C, CAS# 81608-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin C, porcine, CAS# 81608-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin C;GNHWAVGHLM-NH2, CAS# 81608-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin C-[Ser2], CAS# 136058-54-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin N, CAS# 92169-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin N (Porcine), CAS# 92169-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin N;KIPYIL-NH2, CAS# 92169-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin S (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NeuroMedin S (huMan) NMS (huMan), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin S (Mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin S (rat), CAS# 843782-19-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NeuroMedin S (rat) NMS (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin S, human??;ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin U (Rat), CAS# 117505-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin U, rat, CAS# 117505-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin U, rat;YKVNEYQGPVAPSGGFFLFRPRN-NH2, CAS# 117505-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin U-23 (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NeuroMedin U-23 (rat) NMU-23, CAS# 117505-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin U-25 (human), CAS# 312306-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NeuroMedin U-25 (huMan) NMU-25 (huMan), CAS# 312306-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NeuroMedin U-25 (porcine), CAS# 98395-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NeuroMedin U-8 (porcine), CAS# 98395-75-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuromedin U-9 (Guinea Pig), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuron Specific Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuronostatin-13 (human, canine, porcine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuronostatin-13 (human, canine, porcine), CAS# 1096485-24-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuronostatin-13 (mouse, rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuronostatin-19 (human, canine, porcine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuronostatin-19 (mouse, rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide AF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide AF (hNPAF), Human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide AF (hNPAF), Human??NEW;AGEGLNSQFWSLAAPQRF-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide AF (human), CAS# 192387-38-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide AF (huMan) A-18-F-aMide (huMan), NPAF (huMan), CAS# 192387-38-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide AF (huNPAF)(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide B-23 (NPB-23) / L7 (Human)-[Des-Br], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide B-29 (NPB-29) (Human)-[Des-Br], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide DF2, CAS# 149471-11-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide EI (human, mouse, rat), CAS# 125934-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide EI (huMan, Mouse, rat) MCH Precursor (131-143) (huMan, rat), NEI (huMan, Mouse, rat), MCH Precursor (132-144) (Mouse), Neuropeptide EI (huMan, Mouse, rat), ProMelanin-Concentrating HorMone (111-123) (Mouse), ProMelanin-Concentrating HorMone (, CAS# 125934-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide EI (NEI), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide EI, NEI, rat;EIGDEENSAKFPI-NH2, CAS# 125934-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide F, CAS# 136697-70-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide F, CAS# 142191-57-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide F (Monieza expansa), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide F;PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2, CAS# 136697-70-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide FF (5-8), CAS# 152050-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide FF (huNPFF) (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide FF F-8-F-NH2, NPFF, F-8-F-aMide, CAS# 99566-27-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide FF Morphine Modulating Neuropeptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide FF Morphine Modulating Neuropeptide F-8-F-NH2, CAS# 99566-27-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide FF-amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide GE, CAS# 134748-04-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide GE (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide GE (Mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide GE / NGE (Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide K (1-24), CAS# 125408-80-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide K, porcine, CAS# 106441-70-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide K, porcine;DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2, CAS# 106441-70-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide NPW-23 (Human)??;WYKHVASPRYHTVGRAAGLLMGL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide NPW-30 (Human)??;WYKHVASPRYHTVGRAAGLLMGLRRSPYLW, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (1-10) (human), CAS# 904910-39-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (huMan) NPS (huMan), CAS# 412938-67-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (NPS) (Chicken), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (NPS) (Chimpanzee, Canine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (NPS) (Human), CAS# 412938-67-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (NPS) (Mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (NPS) (Mouse, 1-15), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (NPS) (Rat), CAS# 412938-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (NPS) (Rat, 1-15), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (NPS) (Rat, Mouse)-[Tyr10], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S (rat) NPS (rat), CAS# 412938-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S, NPS, human;SFRNGVGTGMKKTSFQRAKS, CAS# 412938-67-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S, NPS, mouse;SFRNGVGSGAKKTSFRRAKQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide S, NPS, rat;SFRNGVGSGVKKTSFRRAKQ, CAS# 412938-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide SF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide SF (human), CAS# 192387-39-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide VF (124-131) (human), CAS# 311309-27-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide VF (124-131) (huMan) V-8-F-NH2, NPVF, CAS# 311309-27-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide VF (56-92) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide VF Precursor (108-125) amide (rat), CAS# 420088-80-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-23 (human), CAS# 383415-79-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-23 (huMan) NPW-23 (huMan), CAS# 383415-79-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-23 (NPW-23) (Porcine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-23 (NPW-23) (Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-23 (NPW-23) / L8 (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-23 (rat), CAS# 383415-89-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-23 (rat) rPPL8 (42-64), Preproprotein L8 (42-64) (rat), rL8, NPW-23 (rat), CAS# 383415-89-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-23, NPW23, porcine??;WYKHTASPRYHTVGRAAGLLMGL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-30 (human), CAS# 383415-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-30 (huMan) NPW-30 (huMan), hPPL8 (33-62), Preproprotein L8 (33-62) (rat), hL8C, CAS# 383415-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-30 (NPW-30) (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-30 (NPW-30) (Procine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-30 (NPW-30) (Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-30 (rat), CAS# 383415-90-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-30 (rat) Preproprotein L8 (42-71) (rat), rL8C, rPPL8 (42-71), NPW-30 (rat), CAS# 383415-90-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide W-30, NPW30, rat??;WYKHVASPRYHTVGRASGLLMGLRRSPYLW, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, CAS# 82785-45-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (1-24) aMide (huMan, rat), CAS# 131448-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (1-24) amide(human, rat), CAS# 131448-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (1-24) amide, human, rat;YPSKPDNPGEDAPAEDMARYYSAL-NH2, CAS# 131448-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (1-27), CAS# 133361-35-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (13-36) (huMan, rat), CAS# 122341-40-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (13-36) (porcine), CAS# 113662-54-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (13-36), human, CAS# 122341-40-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (13-36), human, rat , FAM-labeled;FAM-PAEDMARYYSALRHYINLITRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (13-36), human, rat , TAMRA-labeled;TAMRA-PAEDMARYYSALRHYINLITRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (13-36), human, rat, [Leu31,Pro34]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (13-36), human, rat;PAEDMARYYSALRHYINLITRQRY-NH2, CAS# 122341-40-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (13-36), porcine, [Leu31,Pro34]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (13-36),human, CAS# 122341-40-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (18-36), CAS# 114495-97-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (18-36), CAS# 98264-90-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (18-36), porcine, CAS# 114495-97-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (20-36), CAS# 112602-67-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (22-36), CAS# 119019-65-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (22-36), porcine;SALRHYINLITRQRY-NH2, CAS# 119019-65-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (2-36) (huMan, rat), CAS# 123139-39-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (2-36) (human,rat), CAS# 123139-39-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (2-36) (porcine), CAS# 102961-52-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (2-36), amide, porcine, CAS# 102961-52-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (2-36), human, rat;PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, CAS# 123139-39-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (2-36), porcine;PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2, CAS# 102961-52-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (24-36) amide, N-acetyl-(leu(28,31))-, CAS# 155709-24-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (26-36), CAS# 113676-81-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (27-36), [D-Tyr27&36,D-Thr32]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (27-36),rat;[DTyr27,36,D-Thr32]-NPY (27-36),rat-[D-Tyr27,36, D-Thr32], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (32-36) amide, cys-, CAS# 132880-12-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (3-36) (huMan, rat), CAS# 150138-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (3-36) (porcine), CAS# 143863-88-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (3-36), human, CAS# 150138-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (3-36), human, rat, FAM-labeled;FAM-SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (3-36), human, rat, TAMRA-labeled;TAMRA-SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (3-36), human, rat;SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, CAS# 150138-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (3-36), porcine;SKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2, CAS# 143863-88-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (free acid) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (free acid) (huMan, rat) NPY (free acid) (huMan, rat), CAS# 99575-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (human)-[D-Trp32], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (human, rat), CAS# 90880-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (human, rat) Acetate, CAS# 90880-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (human, rat) Acetate 200 μg/vial (Clinalfa basic), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (huMan, rat) NPY (huMan, rat), CAS# 90880-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) (Porcine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) (Porcine)-[D-Trp32], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) (Porcine, 13-36), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) (Porcine, 16-36), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) (Porcine, 18-36), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) (Porcine, 20-36), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) (Porcine, 22-36), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) (Porcine, 2-36), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) (Porcine, 3-36), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (NPY) and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (pig), CAS# 83589-17-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (porcine), CAS# 82785-45-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (porcine) NPY (porcine), CAS# 83589-17-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y (porcine)-[Ala31,Aib32], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y(13-36) (human, rat)-[Leu31,Pro34], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y(13-36), porcine;PAEDLARYYSALRHYINLITRQRY-NH2, CAS# 113662-54-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y(18-36), porcine;ARYYSALRHYINLITRQRY-NH2, CAS# 98264-90-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y(NPY)Free Acid (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y(porcine)-[Leu31,Pro34], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, ahx(5-24), gamma-glu(2)-epsilon-lys(30)-, CAS# 133970-32-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, biotinylated, human;Biotin-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, CAS# 213779-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, human, Free Acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, human, rat, CAS# 99575-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, human, rat, [Leu31,Pro34]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, human, rat, Biotinyl-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, human, rat, FAM-labeled;FAM-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, human, rat;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, CAS# 99575-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, human; [D-Trp34]-NPY, human-[D-Trp34], CAS# 99575-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, human-[Thr30], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, leu(31)-pro(34)-, CAS# 125580-28-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, N(epsilon,7)-biotinyl-lys(7)-, CAS# 142724-98-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, nle(4)-, CAS# 107949-91-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, porcine, [D-Trp32]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, porcine, [Leu31,Pro34]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, porcine, [Pro34]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, porcine, Biotinyl-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, porcine, Free Acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, porcine;YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2, CAS# 82785-45-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, pro(34)-, CAS# 138874-38-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y, trp(32)-, CAS# 153549-78-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y-Lys(Biotin), FAM-labeled;FAM-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYK(Biotin), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y-Lys(Biotin), human, rat: NPY-Lys(Biotin), human, rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y-Lys(Biotin), human, rat;, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y-Lys(Biotin), human, rat; NPY-Lys(Biotin), human, rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide Y-Lys(Biotin),human, rat; NPY-Lys(Biotin), human, rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neuropeptide γ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin, CAS# 55508-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (1-11), CAS# 74032-89-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (1-6), CAS# 87620-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (1-8), CAS# 80887-44-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (8-13), CAS# 60482-95-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (8-13) (LANT-6)-[Lys8, Asn9], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (8-13), N-Acetyl, CAS# 74853-69-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (8-13);RRPYIL, CAS# 60482-95-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (8-13)-[Lys8,Lys9], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (8-13, Acetyl), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (9-13), CAS# 60482-96-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (Frog), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin (Human, Bovine, Canine), CAS# 55508-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin, guinea pig, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin: 1-6, CAS# 87620-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin;Pyr-LYENKPRRPYIL, CAS# 55508-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin-[D-Phe11], CAS# 64088-66-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin-[D-Trp11], CAS# 100929-52-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin-[D-Tyr11], CAS# 64088-62-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin-[Trp11], CAS# 75644-95-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotensin-related hexapeptide, CAS# 85213-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neurotrophic Factor for Retinal Cholinergic Neurons, CAS# 156707-52-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neutral red, CAS# 553-24-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neutrophil activating peptide 2, CAS# 121337-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Neutrophil defensin 3, CAS# 136661-76-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nevirapine, CAS# 129618-40-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NFAT Inhibitor, CAS# 249537-73-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NFF-2;Mca-RPKPYA-Nva-WM-K(Dnp)-NH2, CAS# 158584-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NFF-3;Mca-RPKPVE-Nva-WR-K(Dnp)-NH2, CAS# 158584-09-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-(2,3-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-(2-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-(2-trifluoromethyl-phenyl)-propionic acid, CAS# 1217682-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-(3,4-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-(3,5-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-(3-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-(3-trifluoromethyl-phenyl)-propionic acid, CAS# 1217817-77-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-(4-methyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-(4-trifluoromethyl-phenyl)-propionic acid, CAS# 1217777-82-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-m-tolyl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-naphthalen-1-yl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-naphthalen-2-yl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-o-tolyl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-3-phenyl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-2-hydroxy-4-phenyl-butyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-3-(2-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-3-(3-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-3-Amino-3-(4-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2R,3R)-hydroxy-3-(4-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-(2,3-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-(2-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-(2-trifluoromethyl-phenyl)-propionic acid, CAS# 959575-82-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-(3,5-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-(3-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-(3-trifluoromethyl-phenyl)-propionic acid, CAS# 959581-13-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-(4-methoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-(4-methyl-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-(4-trifluoromethyl-phenyl)-propionic acid, CAS# 959574-18-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-m-tolyl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-naphthalen-1-yl-propionic acid., CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-naphthalen-2-yl-propionic acid., CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-o-tolyl-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-3-phenyl-propionic acid, CAS# 596096-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-4-phenyl-butyric acid, CAS# 210754-59-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-2-hydroxy-5-methyl-hexanoic acid, CAS# 361161-57-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-3-(2-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-3-(3-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-(2S,3S)-3-Amino-3-(4-fluoro-phenyl)-2-hydroxy-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-3-(2S,3S)-3-Amino-2-hydroxy-3-(3,4-dimethoxy-phenyl)-propionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-L-Asparagine, CAS# 119062-05-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Fmoc-N'-trityl-L-histidine, CAS# 109425-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl -Met-Ala-Ser, CAS# 17351-32-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl -Nle-LF-Nle-YK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl-Leu-OH, CAS# 6113-61-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl-Met-Leu-Phe, CAS# 1490132,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl-Met-Leu-Phe-Lys, CAS# 67247-11-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-FORMYL-MET-LEU-P-IODO-PHE, CAS# 105931-59-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl-MIFL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl-MLF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl-MLFI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl-MLFK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl-MLIF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys, CAS# 71901-21-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Glycylglycine, CAS# 556-50-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-glycyl-L-leucine, CAS# 869-19-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NGR Peptide 1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NGR Peptide 1;CNGRCGGklaklakklaklak-NH2(Disulfidebridge:1-5), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NGR Peptide 2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NGR Peptide 2;CNGRCGGLVTT(Disulfidebridge:1-5), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NGR Peptide 3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NGR Peptide 3;CNGRC-NH2(Disulfidebridge:1-5), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NGR Peptide 4;CNGRCGGkklklllkll(Disulfidebridge:1-5), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NH2-Cys-Phe-cyclo(Orn-Pro-D-Cha-Trp-Arg), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Hippuryl-His-Leu hydrate, CAS# 207386-83-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NHS-Biotin, CAS# 35013-72-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Hydroxysulfosuccinimide sodium salt, CAS# 106627-54-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicarbazin, CAS# 330-95-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicardipine hydrochloride, CAS# 54527-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicergoline, CAS# 27848-84-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nic-Gly-OH, CAS# 583-08-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Niclosamide, CAS# 1420-04-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicorandil, CAS# 65141-46-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicosulfuron, CAS# 111991-09-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinamide, CAS# 98-92-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotine, CAS# 22083-74-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotine N-oxide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinic acid, CAS# 59-67-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl dipeptide-22, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl dipeptide-23, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl dipeptide-24, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl dipeptide-26, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl Hexapeptide-44, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl Hexapeptide-45, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl Octapeptide-13, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl Octapeptide-9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl Pentapeptide-20, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl Pentapeptide-33, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl Tripeptide-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nicotinoyl Tripeptide-35, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nifalatide, CAS# 73385-60-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nifedipine, CAS# 21829-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Niflumic acid, CAS# 4394-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nifuratel, CAS# 4936-47-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nifuroxazide, CAS# 965-52-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nifursol, CAS# 16915-70-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NIGERICIN SODIUM SALT, CAS# 28380-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nigericin sodium salt, CAS# 28643-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nigrosine alcohol soluble, CAS# 2229843,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nilotinib, CAS# 641571-10-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nilotinib hcl monohydrate, CAS# 923288-90-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nimodipin, CAS# 66085-59-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nimustine hydrochloride, CAS# 55661-38-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Ninhydrin, CAS# 485-47-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NIP-OSU, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nisoldipine, CAS# 63675-72-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitazoxanide, CAS# 55981-09-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitenpyram, CAS# 120738-89-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitenpyram, CAS# 150824-47-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NITRENDIPINE, CAS# 39562-70-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitric Oxide Synthase (724-739) Blocking Peptide, Rat Brain, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitrocaphane, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitrofen, CAS# 1836-75-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitrofurantoin, CAS# 67-20-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitrofurantoin1-Hydrate, CAS# 17140-81-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitroso R salt, CAS# 525-05-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitrothal-isopropyl, CAS# 10552-74-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitroxinil, CAS# 1689-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nitroxoline, CAS# 4008-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nizatidine, CAS# 76963-41-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nizofenone, CAS# 54533-85-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nle13, Glu14 Motilin, human, porcine, CAS# 50881-15-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Abz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2, CAS# 396716-07-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Abz-Lys-Pro-Leu-Gly-OH, CAS# 316364-29-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Aib-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Aib-OH, CAS# 2566-34-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Ala-OH.HCl, CAS# 3913-67-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-allo-Ile-OBzl · p-tosylate, CAS# 201544-39-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-D-Ala-OH·HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-D-His-OH · HCl, CAS# 200927-06-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-DL-Ala-OH.HCl, CAS# 600-21-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-D-Leu-OBzl·Tos, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-DL-Leu-OH, CAS# 2566-33-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-DL-Phe-OMe · HCl, CAS# 16975-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-DL-Val-OH, CAS# 2566-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-D-Tyr-OH, CAS# 178357-84-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-D-Val-OH·HCl, CAS# 210830-32-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-GRGDSP, CAS# 133525-11-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-His-OH · HCl, CAS# 17451-62-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-His-OMe · HCl, CAS# 118384-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Leu-OBzl·HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Lys(Z)-OH, CAS# 201016-22-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Lys-Arg-Pro-Trp-Ile-Leu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Nle-OH, CAS# 17343-27-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Nva-OH, CAS# 19653-78-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Orn-OH · HCl, CAS# 16748-29-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Phe7-Neurokinin B, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Ser(tBu)-OH, CAS# 197632-83-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methoxy-N,3-dimethyl-3H-imidazo[4,5-b]pyridine-6-carboxamide, CAS# 1186310-78-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-methoxy-N-methyl-1-(triisopropylsilyl)-1H-pyrrolo[2,3-b]pyridine-5-carboxamide, CAS# 944937-28-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-methoxy-N-methyl-1H-pyrrolo[2,3-b]pyridine-5-carboxamide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-methoxy-N-methyl-2-pivalamidoisonicotinamide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methoxy-N-methylacetamide, CAS# 78191-00-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Thr-OH, CAS# 2812-28-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methyl-3-nitropyridin-2-amine, CAS# 4093-88-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methyl-D-alanine, CAS# 29475-64-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methyl-D-aspartic acid, CAS# 6384-92-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methyldepsipeptide, CAS# 148156-31-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methyl-DL-alanine, CAS# 600-21-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methyl-L-alanine, CAS# 3913-67-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methyl-L-glutamine, CAS# 3081-62-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methyl-N-[3-[[[2-[(2-oxo-2,3-dihydro-1H-indol-5-yl)amino]-5-trifluoromethylpyrimidin-4-yl]amino]methyl]pyridin-2-yl]methanesulfonamide, CAS# 717907-75-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Methylparoxetine, CAS# 110429-36-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-METHYLPIPERAZINE, CAS# 109-01-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Trp-OH, CAS# 526-31-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Tyr1,N-Me-Arg7,D-Leu-NHEt8)-Dynorphin A (1-8), CAS# 103613-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Val-Leu-anilide, CAS# 194351-54-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Val-OH·HCl, CAS# 2480-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Me-Val-Pro-Ome·HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-n-Butyl-Val-Leu-anilide, CAS# 282729-30-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin, CAS# 170713-75-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin (1-13) amide, CAS# 178064-02-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin (1-13) aMide Orphanin FQ (1-13) aMide, CAS# 178064-02-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin (1-13) Amide, [Phe1-ψ(CH2-NH)-Gly2]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin (1-13)-NH2/ Orphanin FQ, CAS# 178064-02-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin / Orphanin FQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin Antagonist, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin Orphanin FQ, CAS# 170713-75-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nociceptin(85-119)-Prepro / Nocistatin-35 (Human, Rat, Mouse)/Orphanin Pro FQ /, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nocistatin, CAS# 208253-85-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nocistatin (bovine), CAS# 208253-85-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nocistatin (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nocistatin / [Tyr0]-PNP-3 (Bovine)[Tyr0], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nocistatin;EQKQLQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nocistatin-41 / PNP-2/3 (Mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nocistatin-41 / PNP-3-8P (Bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Octyl pyrrolidone, CAS# 2687-94-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Octyl-D-glucamine, CAS# 23323-37-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nolatrexed Hydrochloride, CAS# 152946-68-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Oleoylethanolamine, CAS# 111-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nomegestrol, CAS# 58691-88-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nomegestrol 17-acetate, CAS# 58652-20-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Non-?-Amyloid Component of Alzheimer's Disease: NAC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonaarginine, CAS# 143413-47-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Non-Ab Component of Alzheimer's Disease Amyloid, CAS# 154040-19-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NONADECANEDIOIC ACID, CAS# 6250-70-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide, CAS# 158563-45-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-1, CAS# 158563-45-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-1/Melitane, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-11, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-13, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-14, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-15, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-17, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-18, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-19, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-20, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-21, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-22, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-23, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-24, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-25, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonapeptide-9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nonathymulin, CAS# 63958-90-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Non-Aβ Component of Alzheimer's Disease Amyloid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Non-Aβ Component of Alzheimer's Disease Amyloid, CAS# 154040-19-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Non-Aβ CoMponent of AlzheiMer's Disease AMyloid NAC, CAS# 154040-19-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Non-beta-Amyloid Component of Alzheimer’s Disease (NAC);EQVTNVGGAVVTGVTAVAQKTVEGAGSIIAAATGFV, CAS# 154040-19-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Noopept, CAS# 157115-85-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NOOPEPT(GVS-111), CAS# 157115-85-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Noradrenaline bitartrate, CAS# 69815-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Norcantharidin, CAS# 1294030,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Noreximide, CAS# 1614166,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Norfenefrine hydrochloride, CAS# 15308-34-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Norfloxacin, CAS# 70458-96-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Norfloxacin hydrochloride, CAS# 104142-93-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Norfloxacin Lactate Injection, CAS# 97867-34-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Norgestomet, CAS# 25092-41-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Norgestrel, CAS# 6533-00-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NORTROPINONE HCL, CAS# 14383-51-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Norvaline| H-Nva-OH, CAS# 6600-40-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Norvoncomycin hydrochloride, CAS# 213997-73-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NOSCAPINE HYDROCHLORIDE, CAS# 912-60-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NOTA-NOC acetate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NOTA-Octreotide trifluoroacetate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Notch 1 (1735-1752), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NOVOBIOCIN (200 MG)H0D3271012UG/MG(DR), CAS# 303-81-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NOVOBIOCIN SODIUM SALT, CAS# 1476-53-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Noxiustoxin, CAS# 143074-44-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NP-1, CAS# 88086-41-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NP-3A, CAS# 134090-73-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NP-3B, CAS# 88402-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NPF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NPF;KRS-pY-EEHIP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Phenylmethoxycarbonyl-3-aminopropanol, CAS# 65564-05-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Phosphorylleucyltryptophan, CAS# 56361-75-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nph-peptide, CAS# 84311-50-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Phthaloyl-Phenylalanine, CAS# 5123-55-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-P-N-A-N-P-N-A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NPQ4 protein, Arabidopsis, CAS# 149255-48-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-proCT Amino-terminal Procalcitonin, CAS# 118277-01-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-P-TOSYL-GLY-PRO-ARG P-NITROANILIDE ACETATE SALT, CAS# 86890-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NPV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NPV??;FQQLFLNTL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NPY (Porcine)-[Leu31,Pro34], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NRTN (Neurturin),?Human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NS2(114 - 121), Influenza, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NS2(114-121), Influenza??;RTFSFQLI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NS4A-NS4B Hepatitis Virus C, NS3 Protease Inhibitor 1;Ac-DEMEEC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Succinyl-Ile-Ile-Trp-AMC, CAS# 133525-12-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Sulfo-glucosamine sodium salt, CAS# 38899-05-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NTA, CAS# 139-13-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NTB (Naltriben), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-tert-butyl-1H-indazole-7-carboxamide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NTproBNP(1-76), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NUAK family SNF1-like kinase 2 (446-455), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuarimol, CAS# 63284-71-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NubO (68–75), Ndufa4 (68–75), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NubO (68–75), Ndufa4 (68–75)??;VNVDYSKL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Export Signal, NES HIV Rev??;LQLPPLERLTLD, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Export Signal, NES MAPKK??;ALQKKLEELELD, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Export Signal, NES p53??;FRELNEALELKD, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Export Signal, NES, Dok - 1 (348 - 359), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Export Signal, NES, Dok-1 (348-359)??;LLKAKLTDPKED, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Export Signal, NES, PKI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Export Signal, NES, PKI??;ELALKLAGLDIN, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Factor NF-KB Inhibitor SN50, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear fast red, CAS# 6409-77-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Localiation Signal Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear Localiation Signal Peptide;PKKKRKV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear transcription factor Y subunit gamma (275-282), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear transcription factor Y subunit gamma (28-37), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nuclear-encoded Humanin [HN(N)] (Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nucleoprotein (265-273), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Vinyl-2-pyrrolidone, CAS# 88-12-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NVP-BHG7124-Methyl-3-[[1-methyl-6-(3-pyridinyl)-1H-pyrazolo[3,4-d]pyrimidin-4-yl]amino]-N-[3-(trifluoromethyl)phenyl]benzamide, CAS# 940310-85-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NY-CO-13 (139-147), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NY-CO-13(187-197), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NY-ESO-1 (155-163), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NY-ESO-1 (157-165), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NY-ESO-1 (161-180), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| NY-ESO-1 peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nystatin, CAS# 1400-61-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-Z-S-phenyl-L-cysteine, CAS# 159453-24-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α -Boc-D-2,3-diaminopropionic acid, CAS# 76387-70-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α -Boc-L-2,3-diaminopropionic acid, CAS# 73259-81-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α -Fmoc-D-2,3-diaminopropionic acid hydrochloride, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α -Fmoc-L-2,3-diaminopropionic acid, CAS# 181954-34-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α –Fmoc-N-β-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-D-2,3-diaminopropionic acid, CAS# 210830-03-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α –Fmoc-N-β-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-L-2,3-diaminopropionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α,e-di-Boc-L-lysine dicyclohexylamine salt, CAS# 15098-69-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α,N-im-di-Fmoc-L-histidine, CAS# 98929-98-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α,N-β-di-Boc-L-2,3-diaminopropionic acid dicyclohexylamine salt, CAS# 201472-68-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α,N-β-di-Fmoc-D-2,3-diaminopropionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α,N-β-di-Fmoc-L-2,3-diaminopropionic acid, CAS# 201473-90-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α,N-δ-di-Z-L-ornithine, CAS# 2274-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α,N-ε-di-Fmoc-L-lysine, CAS# 78081-87-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α,N-ε-di-Z-L-lysine, CAS# 405-39-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-N-ε-allyoxycarbonyl-L-lysine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-N-ε-Boc-D-lysin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Acetyl-DL-Tryptophan, CAS# 87-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Acetyl-D-Tryptophan, CAS# 138798,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Acetyl-L-glutamine, CAS# 2490-97-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Acetyl-L-histidine monohydrate, CAS# 39145-52-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Acetyl-L-lysine, CAS# 1946-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Acetyl-L-Tryptophan, CAS# 1218-34-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Allyloxycarbonyl-N-δ-Boc-L-ornithine dicyclohexylamine salt, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Allyloxycarbonyl-N-ε-Boc-Dlysine dicyclohexylamine salt, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Benzyl-D-Valine methyl ester hydrochloride, CAS# 210917-86-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nα-Boc-D-tryptophan, CAS# 5241-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-D-Tryptophan, CAS# 5241-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-L-lysine, CAS# 13734-28-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-L-ornithine, CAS# 21887-64-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-L-Tryptophan, CAS# 13193-14-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-im-tosyl-L-histidine dicyclohexylamine salt, CAS# 65057-34-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-in-Boc-L-tryptophan, CAS# 144599-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-in-formyl-L-tryptophan, CAS# 47355-10-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-β-2,4-dintrophenyl-L-2,3-diamiopropionic acid, CAS# 214750-67-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-β-allyloxycarbonyl-D-2,3-diaminopropionic acid dicyclohexylamine salt, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-β-allyloxycarbonyl-L-2,3-diaminopropionic acid, CAS# 161561-83-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-β-Fmoc-L-2,3-diamiopropionic acid, CAS# 122235-70-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-γ-allyloxycarbonyl-D-2,4 diaminobutyric acid dicyclohexylamine salt, CAS# 350820-59-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-γ-Fmoc-D-2,4-diaminobutyricacid, CAS# 131570-57-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-γ-Fmoc-L-2,4-diaminobutyric acid, CAS# 117106-21-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-γ-Z-D-2,4-diaminobutyric acid dicyclohexylamine salt, CAS# 101854-42-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-γ-Z-L-2,4-diaminobutyric acid dicyclohexylamine salt, CAS# 16947-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-δ-allyloxycarbonyl-D-ornithine, CAS# 214750-74-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-δ-Boc-L-ornithine, CAS# 109425-55-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-δ-Fmoc-D-ornithine, CAS# 163336-15-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-δ-Fmoc-L-ornithine, CAS# 150828-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-δ-xanthyl-L-glutamine, CAS# 55260-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-δ-Z-L-lysine, CAS# 2389-45-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-δ-Z-L-ornithine, CAS# 2480-93-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-δ-Z-L-ornithine N-carboxyanhydride, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-ε-Fmoc-L-lysine, CAS# 84624-27-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Boc-N-ω-nitro-L-arginine, CAS# 2188-18-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc -L-histidine, CAS# 116611-64-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-D-tryptophan, CAS# 86123-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-im-trityl-D-histidine, CAS# 135610-90-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-im-trityl-L-histidine, CAS# 109425-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-in-Boc-L-tryptophan, CAS# 143824-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-β-2,4-dinitrophenyl-D-2,3-diaminopropionic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-β-allyloxycarbonyl-L-2,3-diaminopropionic acid, CAS# 188970-92-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-β-Boc-D-2,3-diaminopropionic acid, CAS# 198544-42-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-β-Boc-L-2,3-diaminopropionic acid, CAS# 162558-25-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-β-Z-L-2,3-diaminopropionic acid, CAS# 204316-36-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-γ-1-(4,4-dimethyl-2,6-dioxocyclohex-1 -ylidene)-3-methylbutyl-L-2,4-diaminobutyric acid, CAS# 607366-21-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-γ-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)-3-methylbutyl-D-2,4-diaminobutyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-γ-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-D-2,4-diaminobutyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-γ-allyloxycarbonyl-D-2,4-diaminobutyric acid, CAS# 387824-78-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-γ-allyloxycarbonyl-L-2,4-diaminobutyric acid, CAS# 204316-32-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-γ-Boc-D-2,4-diaminobutyricacid, CAS# 114360-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-δ-methyltrityl-D-lysine, CAS# 198544-94-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-δ-methyltrityl-L-lysine, CAS# 167393-62-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-ε-2-chloro-Z-L-lysine, CAS# 133970-31-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-ε-allyoxycarbonyl-D-lysine, CAS# 214750-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-ε-allyoxycarbonyl-L-lysine, CAS# 146982-27-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Fmoc-N-ε-Boc-D-lysine, CAS# 92122-45-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-methyl-L-Phenylalanine hydrochloride, CAS# 66866-67-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Methyl-L-valine, CAS# 2480-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-D-lysine, CAS# 70671-54-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-D-tryptophan, CAS# 2279-15-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-L-2,3-diaminopropionic acid, CAS# 35761-26-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-L-glutamine, CAS# 2650-64-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-L-histidine, CAS# 14997-58-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-L-ornithine, CAS# 2640-58-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-L-tryptophan benzyl ester, CAS# 69876-37-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-N-β-Boc-L-2,3-diaminopropionic acid, CAS# 16947-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-N-β-Fmoc-L-2,3-diaminopropionic ac, CAS# 142855-80-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-N-γ-Boc-L-2,4-diaminobutyric acid dicyclohexylamine salt, CAS# 3350-13-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-N-δ-trityl-L-glutamine, CAS# 132388-60-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-N-δ-xanthyl-L-glutamine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-N-ε-Boc-D-lysine, CAS# 66845-42-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-Z-N-ε-Boc-L-lysine, CAS# 2389-60-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-α-ε-di-Z-D-lysine dicyclohexylamine salt, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-δ-Trityl-L-glutamine, CAS# 102747-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-δ-Z-L-ornithine, CAS# 3304-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ε-2-chloro-Z-D-lysine, CAS# 201014-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ε-2-chloro-Z-L-lysine, CAS# 42390-97-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ε-Boc-D-lysine, CAS# 310202-69-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ε-Boc-L-lysine, CAS# 2418-95-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ε-Boc-L-lysine 4-nitroanilide, CAS# 172422-76-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ε-Boc-L-lysine methyl ester hydrochloride, CAS# 2389-48-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ε-Trifluoroacetyl-L-lysine, CAS# 10009-20-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ε-Z-L-lysine, CAS# 1155-64-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| N-ε-Z-L-lysine benzyl ester hydrochloride, CAS# 6366-70-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Nτ-Methyl-His-OH, CAS# 332-80-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| o-Acetylephedrine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| O-Acetyl-L-serine hydrochloride, CAS# 66638-22-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obatoclax mesilate, CAS# 803712-79-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| O-Benzyl-D-serine, CAS# 10433-52-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| O-Benzyl-D-tyrosine, CAS# 65733-15-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| O-Benzyl-L-serine, CAS# 4726-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| O-Benzyl-L-tyrosine, CAS# 16652-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obestatin (11-23) Human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obestatin (11-23) Rat, Mouse, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obestatin (huMan), CAS# 1081110-72-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obestatin (Human, Monkey), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obestatin (rat), CAS# 869705-22-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obestatin, human, CAS# 1081110-72-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obestatin, human??;FNAPFDVGIKLSGVQYQQHSQAL-NH2, CAS# 1081110-72-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obestatin, rat, mouse, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obestatin, rat, mouse??;FNAPFDVGIKLSGAQYQQHGRAL-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Obtustatin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| o-Cresolphthalein, CAS# 596-27-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| o-Cresolphthalein complexon, CAS# 2411-89-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Ocriplasmin, CAS# 1048016-09-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| OCTADECANEDIOIC ACID, CAS# 871-70-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octadecaneuropeptide, CAS# 95237-86-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octadecanoyl chloride, CAS# 112-76-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octaneuropeptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| OCTAPAMINE HCL, CAS# 770-05-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide 1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide 2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-11, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-13, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-14, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-15, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-16, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-17, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-18, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-19, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octapeptide-9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octreotide, CAS# 83150-76-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octreotide, CAS# 79517-01-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octreotide acetate, CAS# 83150-76-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octreotide Acetate, CAS# 79517-01-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octreotide Acid (Octreotate);fCFwKTCT(Disulfidebridge:2-7), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octreotide Impurtiy, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octreotide; Octreotide acetate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Octyl thioglucoside, CAS# 85618-21-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| ODANACATIB, CAS# 603139-19-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| o-Dianisidine dihydrochloride, CAS# 20325-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Odorinol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Oestradiol 17-heptanoate, CAS# 4956-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Ofloxacin, CAS# 82419-36-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Ofloxacin Hydrochloride, CAS# 118120-51-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Ofurace, CAS# 58810-48-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| OGP, CAS# 29836-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Oil red O, CAS# 1320-06-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Olanzapine, CAS# 132539-06-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Olaparib, CAS# 763113-22-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |
| Oligomycin, CAS# 1404-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C. |