EOS-Peptide-28

EOS Med Chem is one of TOP Med-chemical company, special in FDA 2015-2018 new API and Intermediates commercial & GMP production.

Use EOS Med Chem GMP & ISO plant, custom synthesis your need chemicals.

All Intermediates we could supply CMC & DMF OPEN list. Form change, Impurity research, Change route, Improve purity.

Welcome to Site Audit.

2018, EOS Med Chem got China TOP100 New Drug Manu.

Parathyroid Hormone (70-84)， human, CAS# 213533-86-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (Human)( 1-34)(PTH), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (Human， 1-31 Amide), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (Human， 1-44), CAS# 85568-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (Human， 39-68), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (Human， 39-84), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (Human， 69-84), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (PTH) (Bovine， 1-34), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (PTH) (Human， 1-38), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (PTH) and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone (PTH)(44-68)(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone Related Peptide: 107-111, CAS# 138949-73-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone(1-34)， bovine, CAS# 12583-68-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone: 39-68， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone: 39-84， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone: 69-84， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid hormone-related protein (3-34), CAS# 118689-25-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP) (Chicken， 1-36 Amide)-[Tyr36], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP) (Human， 1-34 Amide)-[Tyr34], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP) (Human， 1-37), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP) (Human， 38-64 Amide), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP) (Human， 67-86 Amide), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP) (Human， 7-34 Amide)-[Asn10.Leu11], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP) (Human， 7-34 Amide)-[Leu11，D-Trp12], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP) (Human， Rat， Mouse， 1-34), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP)(107-111)(Human， Rat， Mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parathyroid Hormone-Related Protein (PTH-RP)(140-173)(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parbendazole, CAS# 14255-87-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PARECOXIB SODIUM, CAS# 198470-85-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PARICALCITOL, CAS# 131918-61-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parocoxib, CAS# 198470-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Paromomycin sulfate salt, CAS# 1263-89-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parotid salivary histidine-rich polypeptide, CAS# 117233-32-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Paroxetine hydrochloride, CAS# 78246-49-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

paroxetine hydrochloride, CAS# 110429-35-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Parthenolide, CAS# 20554-84-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pasiniazid, CAS# 2066-89-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pasireotide, CAS# 396091-73-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pazopanib, CAS# 444731-52-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pazufloxacin, CAS# 127045-41-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PAZUFLOXACIN MESILATE, CAS# 163680-77-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PAZUFLOXACIN MESYLATE, CAS# 136905-87-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PB1(703 - 711)， Influenza, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PB1(703-711)， Influenza??;SSYRRPVGI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PBAN-1 (Bombyx mori), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

P-beta, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pbf-Cl, CAS# 154445-78-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pbf-NH2, CAS# 378230-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PCC (88-104);KAERADLIAYLKQATAK, CAS# 86579-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PCFwKTCK(Disulfide bridge 2 - 7), CAS# 485803-62-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PCP4 protein， human, CAS# 106494-08-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PCPG, CAS# 6212-33-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PD 142893, CAS# 155893-16-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PD 153035 HYDROCHLORIDE, CAS# 153436-54-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PD0332991 Isethionate, CAS# 827022-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PD-1/PD-L1 Inhibitor 3, CAS# 1629654-95-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PD-1/PD-L1 Inhibitor 4, CAS# 1629655-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PD-145065, CAS# 153049-49-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PD-151242, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PD-153，035;NSC 669364, CAS# 175178-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PDGF Antagonist, CAS# 143784-00-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PDGF β-Receptor (719-723) (phosphorylated), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PDGF β-Receptor (739-746) (phosphorylated), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PDGFRtide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pectolyase Y-23, CAS# 9032-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pedal peptide, CAS# 119758-47-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pedibin Precursor (hydra), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pefloxacin, CAS# 70458-92-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pefloxacin mesylate, CAS# 70458-95-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peginesatide, CAS# 910576-32-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pE-H-P-G-K, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pelargonoyl cyclic decapeptide polymyxin M(1), CAS# 77554-83-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pelargonoyl-cyclic decapeptide polymyxin B(1), CAS# 76721-93-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PELITINIB, CAS# 257933-82-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pemetrexed disodium, CAS# 150399-23-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pemetrexed disodium, CAS# 137281-23-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pemetrexed disodium hydrate, CAS# 357166-30-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pemirolast potassium, CAS# 100299-08-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pen2W2F, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Penciceovir, CAS# 39809-25-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Penconazole, CAS# 66246-88-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pencycuron, CAS# 66063-05-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pendimethalin, CAS# 40487-42-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Penethamate, CAS# 3689-73-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Penetratin, CAS# 329306-46-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Penetratin - Arg, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Penicillin G Na salt, CAS# 69-57-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Penicillin G Potassium salt, CAS# 113-98-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Penicillin V potassium salt, CAS# 132-98-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Penoxsulam, CAS# 219714-96-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentadecanedioic acid, CAS# 1460-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pentadecapeptide BPC, CAS# 137525-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentafluoro-DL-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentafluoro-D-Phenylalanine, CAS# 40332-58-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentafluoro-L-Phenylalanine, CAS# 34702-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentagastrin, CAS# 5534-95-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentagastrin 50 μg/vial (Clinalfa basic), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PENTAPEPTIDE-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-11, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-13, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-14, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-15, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-16, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-17, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-18, CAS# 64963-01-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-18/Leuphasyl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-19, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-2, CAS# 110590-65-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-20, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-21, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-22, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-23, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-230 cysteinamide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-24, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-25, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-26, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-27, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-28, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-29, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-29 cysteinamide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-3, CAS# 9087-70-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-3, CAS# 135679-88-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-3, CAS# 725232-44-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-30, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-31, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-32, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-33, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-34, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-34 Trifluoroacetate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-35, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-36, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-37, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-38, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-39, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-4, CAS# 149128-48-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-48, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentapeptide-9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentazocine, CAS# 359-83-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentazocine hydrochloride, CAS# 64024-15-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentigetide, CAS# 62087-72-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentobarbital sodium, CAS# 57-33-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentostatin, CAS# 53910-25-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pentreotide trifluoroacetate, CAS# 138661-02-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep - 1 - Cysteamine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep 4A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep 4A;GSVVIVGRIILSGR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep 4AK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep 4AK;KKKGSVVIVGRIILSGR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep-1: Chariot (Non-Covalent Delivery of Peptides and Proteins);KETWWETWWTEWSQPKKKRKV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PEP1;SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep1-AGL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep1-TGL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep2-AVKI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep2-EVKI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep2m, CAS# 243843-42-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep2-SVKE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep2-SVKI, CAS# 328944-75-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep4c, CAS# 243843-43-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pep-7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PEPC, CAS# 9067-77-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pepstatin, CAS# 26305-03-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pepstatin A, CAS# 26305-03-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptidase, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 31D, CAS# 122289-52-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 399, CAS# 150398-24-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 46, CAS# 192122-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 6A, CAS# 73549-32-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 7140, CAS# 159440-06-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 7172, CAS# 159440-07-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 7194, CAS# 159440-08-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 7196, CAS# 159440-09-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 74, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 74, CAS# 132116-39-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 78, CAS# 132116-62-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 810, CAS# 156371-22-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide 8A, CAS# 137051-72-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide A (Tyrosine Kinase Inhibitor);VAPSDSIQAEEWYFGKITRRE, CAS# 131023-24-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide B， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide C20W, CAS# 123045-86-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide C24W, CAS# 133850-19-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

peptide CK+, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

peptide E, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide E (adrenal medulla), CAS# 78355-50-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide E-3200-dalton Adrenal (Bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide F, CAS# 75718-92-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide F (22-34) (bovine， ovine), CAS# 88878-74-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide F (22-34) (bovine， ovine) Prepro-Enkephalin A (125-137) (bovine， ovine), CAS# 88878-74-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide F (Bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide F， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide G, CAS# 100179-05-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide histidine isoleucine, CAS# 96849-38-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide histidine valine 42, CAS# 111366-38-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide I, CAS# 141039-76-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide I (aplysia), CAS# 109050-14-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide II (aplysia), CAS# 101849-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide kpr, CAS# 41961-57-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide M, CAS# 110652-62-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide MB-35, CAS# 133515-60-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide methionine-tyrosine, CAS# 135316-81-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide nucleic acid， T10-lysine, CAS# 139166-85-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide oostatic hormone, CAS# 128439-50-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide p(1-24), CAS# 121501-21-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide P15-1 STMMSRSHKTRSHHV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide P-2 (Androctonus mauretanicus mauretanicus reduced), CAS# 96520-99-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide permease, CAS# 97599-47-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide phi-(1-27)-glycine, CAS# 123746-44-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide phi， phe(4)-, CAS# 109275-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide PV, CAS# 38249-87-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide pva, CAS# 114472-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide S 42, CAS# 57997-72-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide Standard 1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide T, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide T, CAS# 106362-33-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide T, CAS# 106362-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide T amide, CAS# 113021-67-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide tyrosine phenylalanine, CAS# 144527-25-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide U6, CAS# 142609-55-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide VF13N, CAS# 142649-36-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY, CAS# 106388-42-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (13-36) (canine， Mouse， porcine， rat), CAS# 86895-09-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (13-36)， porcine;SPEELSRYYASLRHYLNLVTRQRY-NH2, CAS# 86895-09-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (3-36), CAS# 123583-37-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (3-36) (canine， Mouse， porcine， rat), CAS# 126339-09-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (3-36) (huMan), CAS# 123583-37-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (3-36) (human) Acetate, CAS# 123583-37-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (3-36)， human;IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, CAS# 123583-37-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (canine， Mouse， porcine， rat), CAS# 81858-94-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (huMan), CAS# 118997-30-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (human) Acetate, CAS# 118997-30-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (human)-[Leu31，Pro34], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (PYY) (3-36)(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (PYY) (Porcine， Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (PYY) (Porcine， Rat， 13-36), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY (PYY)Y2R agonist Food-intake Inhibitor (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide yy human, CAS# 118997-30-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY Human (3-36), CAS# 126339-09-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY(3-36)， PYY， human, CAS# 123583-37-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY， Human, CAS# 118997-30-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY， human， FAM-labeled;FAM-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY， human， TAMRA-labeled;TAMRA-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY， human;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, CAS# 118997-30-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY， porcine;YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide YY， PYY， human-[Pro34], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide ε, CAS# 120253-69-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptide-gly-leu-amide, CAS# 102068-15-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptidoglycan pentapeptide-mDap3, CAS# 73715-37-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peptidoglycan synthetase, CAS# 2608716,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peramivir, CAS# 229614-55-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peramivir Trihydrate, CAS# 1041434-82-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PeraMpanel, CAS# 380917-97-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pergolide Mesylate Salt, CAS# 66104-23-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Perifosine (KRX-0401), CAS# 157716-52-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Perilipin-2 (129-137), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Perindopril Erbumine, CAS# 82834-16-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Perindopril erbumine, CAS# 107133-36-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Permethrin, CAS# 52645-53-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Perospirone hydrochloride, CAS# 129273-38-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Peroxiredoxin-5， mitochondrial (163-172), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PEST Domain of p105;DSGVETS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pexiganan, CAS# 147664-63-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pexiganan acetate, CAS# 172820-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PF, CAS# 13589-02-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PF 02341066 hydrochloride, CAS# 1415560-69-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PF-046915022-Amino-8-[trans-4-(2-hydroxyethoxy)cyclohexyl]-6-(6-methoxy-3-pyridinyl)-4-methylpyrido[2，3-d]pyrimidin-7(8H)-one, CAS# 1013101-36-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PF-562271 benzenesulfonate salt, CAS# 939791-38-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PFR-AMC, CAS# 65147-21-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PGC - 1α (205–216)， Proliferator - activated Receptor Coactivator - 1 α (205–216), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PGLa, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pGlu-Arg-Lys-Lys-Arg-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pGlu-Arg-Thr-Lys-Arg-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pGlu-Lys-Gln-Thr-Arg-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pGlu-Lys-Lys-Lys-Arg-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pGlu-Pro-Arg-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PgtP protein， Salmonella typhimurium, CAS# 119129-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHA-P, CAS# 9008-97-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phe-Ala-Ala-Gly-Arg-Lys-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phe-Arg-Leu-Lys-Gly-Gly-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phe-Arg-β-naphthylamide, CAS# 100929-99-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phe-Met-Arg-Phe-NH2;FMRF-NH2, CAS# 152165-14-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenacetin, CAS# 62-44-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenazopyridine hydrochloride, CAS# 136-40-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenethyl caffeate, CAS# 104594-70-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenformin hydrochloride, CAS# 834-28-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenidone, CAS# 92-43-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pheniramine maleate, CAS# 132-20-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenmedipham, CAS# 13684-63-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenobarbital sodium, CAS# 57-30-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenol, CAS# 108-95-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenol red, CAS# 143-74-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenol red sodium salt, CAS# 34487-61-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenolphthalein, CAS# 28376,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenolphthalein test paper, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenolphthalexone, CAS# 25296-54-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenosafranine, CAS# 81-93-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenothiazine, CAS# 92-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenothrin, CAS# 26002-80-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenoxybenzamine hydrochloride, CAS# 63-92-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phentolamine mesilate, CAS# 65-28-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylac-Gln-OH, CAS# 28047-15-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylalanine-free protein 115 120 125, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylalanyl-arginyl-phenylalanine, CAS# 49864-46-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylalanyl-arginyl-valyl-phenylalanine, CAS# 144548-33-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylalanyl-glycyl-histidyl-statyl-alanyl-phenylalanine methyl ester, CAS# 112317-45-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylalanyl-glycyl-valyl-statyl-alanyl-phenylalanine methyl ester, CAS# 112317-46-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylalanyl-leucyl-arginyl-phenylalanine, CAS# 122075-70-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylalanyl-leucyl-phenylalanyl-glutaminyl-prolyl-glutaminyl-arginyl-phenylalaninamide, CAS# 99566-27-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHENYLEPHRINE BASE, CAS# 59-42-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylephrine hydrochloride, CAS# 61-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylephrine hydrogentartrate, CAS# 17162-39-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylfluorone, CAS# 975-17-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenylphosphonic acid, CAS# 1571-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHENYTION, CAS# 57-41-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phenytoin sodium, CAS# 630-93-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phe-Pro-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta， Heliothis zea), CAS# 122071-54-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pheromone Biosynthesis-Activating Neuropeptide (PBAN Hez) (Heliothis zea), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pheromone biosynthesis-activating neuropeptide II, CAS# 131571-11-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pheromone-biosynthesis-activating neuropeptide I, CAS# 123583-27-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pheromonotropin (Pseudaletia separata), CAS# 141281-40-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHF6, CAS# 329897-62-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHG, CAS# 83960-30-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ph-Gly-OH, CAS# 103-01-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHI (1-27)-Gly(Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHI， porcine, CAS# 80458-29-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHI， rat, CAS# 96849-38-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHI-27 (porcine), CAS# 80458-29-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHI-27 (rat), CAS# 96849-38-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHI-27(Human), CAS# 87403-73-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHI-27(Procine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phleomycin from Streptomyces verticillus, CAS# 11006-33-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phloretin, CAS# 60-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phloroglucinol, CAS# 108-73-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHLOROGLULINOL DIHYDRATE, CAS# 6099-90-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phloxine B, CAS# 18472-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHM (156-170) (Prepro VIP), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHM-27 (huMan), CAS# 87403-73-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHM-27/PHI， human, CAS# 87403-73-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHM-VIP Space Peptide (PHM (111-122) / Prepro VIP), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphatase Substrate, CAS# 333338-18-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphatase Substrate;LKRA-pT-LG-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphate Acceptor Peptide, CAS# 65189-71-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

phosphatidylserine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphodiesterase I from Crotalus adamanteus venom, CAS# 9025-82-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphodiesterase II from bovine spleen, CAS# 9068-54-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphoglucose isomerase, CAS# 9001-41-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phospholipase A2 Activating Peptide, CAS# 137314-60-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphomolybdic acid hydrate, CAS# 51429-74-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphomycin calcium salt, CAS# 26016-98-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphomycin disodium salt, CAS# 26016-99-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphoramidon disodium salt, CAS# 119942-99-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphoric Aci Di-T-Butyl exter chloromethyl ester, CAS# 229625-50-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphorylase Kinase b-Subunit Fragment (420-436), CAS# 150829-21-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphorylase Kinase β-Subunit FragMent (420-436), CAS# 150829-21-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphorylated MBP Peptide Substrate;APR-pT-PGGRR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphorylated Protein Kinase C Substrate 1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphorylated Protein Kinase C Substrate 2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

phosphorylated， Histone H1-derived peptide， FAM-labeled??;5-FAM-GGGPA-pT-PKKAKKL-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

phosphorylcholine, CAS# 107-73-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phosphotungstic acid hydrate, CAS# 12501-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

photosystem II， psbL subunit, CAS# 147651-82-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PHT-4274-Dodecyl-N-1，3，4-thiadiazol-2-ylbenzenesulfonamide, CAS# 1191951-57-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phthaloyl-glycine, CAS# 4702-13-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phthaloyl-L-Phenylalanine, CAS# 5123-55-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phthalylsulfathiazole, CAS# 85-73-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phyllolitorin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phyllomedusin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phylloseptin-L2, CAS# 1100546-22-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PhysalaeMin, CAS# 2507-24-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Physalaemin C-terminal heptapeptide, CAS# 13198-06-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytase from wheat, CAS# 9001-89-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 2， PC2， Biotinylated??;Biotin-LC-(γE-C)2-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 2， PC2， HiLyte Fluor? 488 labeled??;HiLyteFluor?488-LC-(γE-C)2-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 2， PC2;(γE-C)2-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 3， PC3， Biotinylated??;Biotin-LC-(γE-C)3-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 3， PC3， HiLyte Fluor? 488 labeled??;HiLyteFluor?488-LC-(γE-C)3-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 3， PC3;(γE-C)3-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 4， PC4， Biotinylated??;Biotin-LC-(γE-C)4-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 4， PC4， HiLyte Fluor? 488 labeled??;HiLyteFluor?488-LC-(γE-C)4-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 4， PC4;(γE-C)4-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 5， PC5;(γE-C)5-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin 6， PC6;(γE-C)6-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytochelatin-4， biotinylated??;Biotin-LC-(γE-C)4-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Phytotoxin PKZh 1 (Verticillium dahliae peptide moiety) 27, CAS# 80902-44-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PI, CAS# 25535-16-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Picloram, CAS# 6607,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PICOLINAFEN, CAS# 137641-05-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Picoplatin, CAS# 181630-15-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pidotimod, CAS# 121808-62-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PikaMilione, CAS# 62936-56-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pikamilone, CAS# 34562-97-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PILSICAINIDE, CAS# 88069-67-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pim-1 substrate peptide;AKRRRLSA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pimaricin, CAS# 7681-93-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pimavanserin, CAS# 706779-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pimecrolimus, CAS# 137071-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PIMOBENDAN, CAS# 74150-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pinealon(Glu-Asp-Arg), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pinobanksin, CAS# 548-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pioglitazone, CAS# 111025-46-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PIOGLITAZONE HCL, CAS# 112529-15-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pioglitazone IMpurity B, CAS# 144809-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pip-AcOH*HCl, CAS# 51052-78-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperacillin, CAS# 61477-96-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperacillin sodium salt, CAS# 59703-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperalin, CAS# 3478-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperaquine phosphate, CAS# 85547-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperazine ferulate, CAS# 171876-65-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperazine hydrogen phosphate monohydrate, CAS# 1951-97-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperazine phosphate, CAS# 14538-56-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperazine， anhydrous, CAS# 110-85-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperidine， 4-(4-chlorophenyl)-4-[4-(1H-pyrazol-4-yl)phenyl]-4-(4-Chlorophenyl)-4-[4-(1H-pyrazol-4-yl)phenyl]piperidine, CAS# 857531-00-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperidine-4-carboxylic acid, CAS# 498-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperonyl?butoxide, CAS# 18693,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piperophos, CAS# 24151-93-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PIPES, CAS# 5625-37-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PIPES sesquisodium salt, CAS# 100037-69-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piracetam, CAS# 7491-74-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pirarubicin, CAS# 72496-41-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pirenzepine, CAS# 28797-61-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pirenzepine hydrochloride, CAS# 29868-97-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PIRIBEDIL, CAS# 622744,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pirimcarb, CAS# 23103-98-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pirimiphos-ethyl, CAS# 23505-41-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pirimiphos-methyl, CAS# 29232-93-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pirlimycin, CAS# 79548-73-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Piroxicam, CAS# 36322-90-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pitavastatin, CAS# 147511-69-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pitavastatin Calcium, CAS# 147526-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pitavastatin Calcuim, CAS# 147526-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pituitary adenylate cyclase-activating peptide, CAS# 137061-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pituitary adenylate cyclase-activating peptide-38 (human), CAS# 124123-15-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pixantrone, CAS# 144510-96-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pizotifen, CAS# 15574-96-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PIZOTIFEN MALATE, CAS# 1201595,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PK, CAS# 9001-59-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKA Inhibitor Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKA Inhibitor Substrate;GRTGRRN-pS-IHDIL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKA Regulatory Subunit II Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKA Substrate， Catalytic Subunit;GRTGRRNSI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKA Substrate;GRGLSLSR, CAS# 57836-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKA， PKC， MAPKAP-K1 Substrate [RRRLSSLRA-NH2]， 5-FAM labeled;5-FAM-RRRLSSLRA-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKA， PKC， MAPKAP-K1 Substrate [RRRLSSLRA-NH2]， 5-TMR labeled;5-TMR-RRRLSSLRA-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKA， PKC， MAPKAP-K1 Substrate [RRRLSSLRA-NH2]， Biotinylated;Biotin-RRRLSSLRA-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKA， PKC， MAPKAP-K1 Substrate [RRRLSSLRA-NH2];RRRLSSLRA-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC (19-31)， myristoylated;Myristoyl-RFARKGALRQKNV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC (19-36): PKC Selective Inhibitor Protein;RFARKGALRQKNVHEVKN, CAS# 113731-96-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC (530-558);LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2, CAS# 122613-29-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC Substrate [RRGR-pT-GRGRRGIFR]， Phosphorylated;RRGR-pT-GRGRRGIFR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC Substrate [RRGRTGRGRRGIFR]， 5-FAM labeled;5-FAM-RRGRTGRGRRGIFR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC Substrate [RRGRTGRGRRGIFR]， 5-TMR labeled;5-TMR-RRGRTGRGRRGIFR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC Substrate [RRGRTGRGRRGIFR]， Biotinylated;Biotin-RRGRTGRGRRGIFR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC Substrate [RRGRTGRGRRGIFR];RRGRTGRGRRGIFR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC Substrate 2;VRKRTLRRL, CAS# 105802-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKC Substrate Derived from EGF Receptor;KRTLRR, CAS# 121284-21-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCe pseudosubstrate derived peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCe pseudosubstrate derived peptide， TAMRA-labeled??;5-TAMRA-ERMRPRKRQGSVRRV-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCe pseudosubstrate derived peptide??;ERMRPRKRQGSVRRRV-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCδ Substrate [RFAVRDMRQ-pT-VAVGVIKAVDKK]， Phosphorylated;RFAVRDMRQ-pT-VAVGVIKAVDKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCδ Substrate [RFAVRDMRQTVAVGVIKAVDKK]， 5-FAM labeled;5-FAM-RFAVRDMRQTVAVGVIKAVDKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCδ Substrate [RFAVRDMRQTVAVGVIKAVDKK]， 5-TMR labeled;5-TMR-RFAVRDMRQTVAVGVIKAVDKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCδ Substrate [RFAVRDMRQTVAVGVIKAVDKK]， Biotinylated;Biotin-RFAVRDMRQTVAVGVIKAVDKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCδ Substrate [RFAVRDMRQTVAVGVIKAVDKK];RFAVRDMRQTVAVGVIKAVDKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCμ Substrate [AALVRQM-pS-VAFFFK]， Phosphorylated;AALVRQM-pS-VAFFFK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCμ Substrate [AALVRQMSVAFFFK]， 5-FAM labeled;5-FAM-AALVRQMSVAFFFK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCμ Substrate [AALVRQMSVAFFFK]， 5-TMR labeled;5-TMR-AALVRQMSVAFFFK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCμ Substrate [AALVRQMSVAFFFK]， Biobinylated;Biotin-AALVRQMSVAFFFK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKCμ Substrate [AALVRQMSVAFFFK];AALVRQMSVAFFFK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKG Substate [RKRSRAE]， 5-FAM labeled;5-FAM-RKRSRAE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKG Substate [RKRSRAE]， 5-TMR labeled;5-TMR-RKRSRAE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKG Substate [RKRSRAE]， Biotinylated;Biotin-RKRSRAE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKG Substate [RKRSRAE]， Phosphorylated;RKR-pS-RAE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKG Substate [RKRSRAE];RKRSRAE, CAS# 81187-14-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKI Inhibitor (6-22)， amide;TYADFIASGRTGRRNAI-NH2, CAS# 121932-06-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PKI-tide, CAS# 126370-52-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLA2, CAS# 9001-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Plasminogen Activator Inhibitor 1 (PAI-1), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet Factor 4, CAS# 37270-94-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet Factor 4 (58-70) (huMan), CAS# 82989-21-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet Membrane Glycoprotein IIB Peptide (296-306), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet-Derived Growth Factor ?-Receptor (719-723);pY-VPML, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet-Derived Growth Factor ?-Receptor (739-746);pY-MAPYDNY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet-Derived Growth Factor Receptor Substrate 1: PDGF Receptor Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet-Derived Growth Factor Receptor Substrate 1; PDGF Receptor Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet-Derived Growth Factor Receptor Substrate 1;N-pY-ISKGSTFL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet-Derived Growth Factor Receptor Substrate 2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platelet-Derived Growth Factor Receptor Substrate 2;SVL-pY-TAVQPNE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Platinum dioxide, CAS# 1314-15-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

plecanatide, CAS# 467426-54-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pleiotrophin, CAS# 134034-50-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Plerixafor, CAS# 110078-46-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pleurocidin 2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pleuromulin, CAS# 125-65-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Plicamycin, CAS# 18378-89-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Plifenate, CAS# 21757-82-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Plitidepsin, CAS# 137219-37-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLM derived peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLM derived peptide， TAMRA-labeled??;5-TAMRA-IRRLSTRRR-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLM derived peptide??;IRRLSTRRR-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLP, CAS# 41468-25-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLP (139-151);HSLGKWLGHPDKF, CAS# 122018-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLP 184-199, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLP 190-209, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLP 41-58, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

plsl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PLSRTLSVAAKK, CAS# 105802-84-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMAP-23, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pmap-37, CAS# 166801-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMEL (25-33), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pml-RARalpha fusion protein, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pMOG (44-54)??;FSRVVHLYRNG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMP, CAS# 89-25-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMP-C peptide， insect, CAS# 140880-00-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMP-D1 peptide， Locusta migratoria, CAS# 140880-45-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMP-D2 peptide， insect, CAS# 140879-98-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMX 205, CAS# 514814-49-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMX-205; Hydrocinnamate, CAS# 514814-49-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMX-53, CAS# 219639-70-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PMX-53| AcF-(OPdChaWR) ，AcF-(OPdChaWR) |AcF-(OP(D-Cha)WR), CAS# 219639-70-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pneumadin (human), CAS# 130918-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pneumadin (rat), CAS# 130918-90-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pneumocandin A0, CAS# 539823-80-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pneumocandin B0, CAS# 135575-42-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PNP-ALPHA-D-GLC, CAS# 3767-28-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PNP-BETA-D-GLC, CAS# 2492-87-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PNP-BETA-D-GLCA, CAS# 10344-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PNPG, CAS# 7493-95-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PNPG, CAS# 3150-24-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PNP-Nag, CAS# 3459-18-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PODOPHYLLIN, CAS# 9000-55-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polaprezinc, CAS# 107667-60-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polistes Mastoparan, CAS# 74129-19-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

POLOXAMER 188, CAS# 2594628,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pol-RFamide, CAS# 119116-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Poly(A) polymerase gamma (724-734), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Poly(gamma-glutamylcysteinyl)glycine, CAS# 112480-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

poly(hexamethylenebiguanide) hydrochloride, CAS# 32289-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

POLYANILINE, CAS# 25233-30-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polybia-MP1 trifluoroacetate salt, CAS# 872043-01-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polycarbophil, CAS# 9003-97-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polycystic kidney disease 1 protein (4192-4202), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polydatin, CAS# 27208-80-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Poly-D-lysine hydrobromide, CAS# 27964-99-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyetherurethaneurea-polypeptide block copolymer, CAS# 153312-31-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polygalacturonic acid, CAS# 25990-10-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polygalacturonic acid sodium salt, CAS# 9049-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Poly-gamma-benzyl-L-glutamate, CAS# 25014-27-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polygeline, CAS# 66455-30-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyglutamic acid, CAS# 25513-46-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Poly-IC-poly-L-lysine, CAS# 34354-71-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyinosinic acid-polycytidylic acid, CAS# 24939-03-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyinosinic–polycytidylic acid sodium salt, CAS# 42424-50-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

POLY-L-GLUTAMIC ACID 2'000-15'000, CAS# 25513-46-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Poly-L-lysine hydrobromide, CAS# 25988-63-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polylysine, CAS# 25104-18-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polymyxin B, CAS# 1404-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polymyxin B heptapeptide, CAS# 142563-40-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polymyxin B nonapeptide, CAS# 86408-36-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polymyxin B octapeptide, CAS# 142563-39-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polymyxin B sulfate, CAS# 1405-20-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polymyxin B2, CAS# 34503-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polymyxin E1， 1-de(N(sup 2)-(6-methyl-1-oxooctyl)-L-2，4-diaminobutanoic acid)-2-(N-(1-oxo-2-phenylbutyl)-L-threonine)-， hydrochloride, CAS# 52438-36-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polymyxin E1， 1-de(N(sup 2)-(6-methyl-1-oxooctyl)-L-2，4-diaminobutanoic acid)-2-(N-(2-naphthalenylcarbonyl)-L-threonine)-， hydrochloride, CAS# 52438-37-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polymyxin E1， 1-de(N(sup 2)-(6-methyl-1-oxooctyl)-L-2，4-diaminobutanoic acid)-2-(N-(phenoxyacetyl)-L-threonine)-， hydrochloride, CAS# 52396-34-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyoma peptide antigen MT162-176, CAS# 122560-16-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polypeptide antibiotic 26A， hydrochloride, CAS# 102647-28-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polypeptide M5， E coli, CAS# 110278-05-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyphemusin 1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyphemusin II-Derived Peptide, CAS# 229030-20-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyphenol oxidase, CAS# 2594228,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyprenic, CAS# 81485-25-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polypyrimidine tract-binding protein 1 isoform b (359-373), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polystyrene Resin, CAS# 9003-53-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polystyrene resin, CAS# 9003-70-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Polyvinylpyrrolidone cross-linked, CAS# 25249-54-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pomalidomide, CAS# 19171-19-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pompilidotoxin， ?-, CAS# 216064-36-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ponatinib, CAS# 943319-70-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ponatinib tris-hydrochloride, CAS# 1232836-25-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ponceau 2R, CAS# 3761-53-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ponceau S, CAS# 6226-79-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

POPSO, CAS# 68189-43-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

POPSO-2Na, CAS# 108321-07-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Posaconazole, CAS# 171228-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium Candrenoate, CAS# 102731,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium citrate, CAS# 866-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium clavulanate, CAS# 61177-45-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium gluconate, CAS# 299-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium L-lactate, CAS# 85895-78-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium oxonate, CAS# 2207-75-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium pyrophosphate, CAS# 7320-34-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium Sodium Pehydroandroandrographolide Succinate, CAS# 6700-42-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium sorbate, CAS# 24634-61-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potassium trichloroammineplatinate (II), CAS# 13820-91-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Potato extract, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

POTE ankyrin domain family member F (795-804), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Povidone iodine, CAS# 25655-41-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

powdered posterior pitultary, CAS# 127317-03-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pp60 c-src (521-533), CAS# 198754-34-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pp60 c-src (521-533) (phosphorylated), CAS# 149299-77-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pp60 C-SRC Carboxy-Terminal Phosphoregulatory Peptide Phosphorylated, CAS# 149299-77-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pp60(v-SRC) Autophosphorylation Site， Phosphorylated;RRLIEDNE-pY-TARG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pp60(v-SRC) Autophosphorylation Site， Protein Tyrosine Kinase Substrate, CAS# 81493-98-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pp60(v-SRC) Autophosphorylation Site， Tyrosine Phosphopeptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pp60(v-SRC) Autophosphorylation Site;RRLIEDNEYTARG, CAS# 81493-98-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pp60C-SRC Carboxy-Terminal Phosphoregulatory Peptide， Phosphorylated;TSTEPQ-pY-QPGENL, CAS# 149299-77-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pp60C-SRC Carboxy-Terminal Phosphoregulatory Peptide;TSTEPQYQPGENL, CAS# 198754-34-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PR, CAS# 2418-74-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pradimotide, CAS# 908587-83-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pralatrexate, CAS# 146464-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PRALIDOXIME IODIDE, CAS# 94-63-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prallethrin, CAS# 23031-36-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prallethrin, CAS# 204244-85-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pralmorelin, CAS# 158861-67-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PRAME epitope (PRA300-309) Tumor-associated antigen;ALYVDSLFFL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pramipexole, CAS# 104632-26-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pramipexole, CAS# 191217-81-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pramipexole dihydrochloride, CAS# 104632-25-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pramlintide, CAS# 151126-32-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pramlintide Acetate, CAS# 196078-30-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pramlintide Acetate, CAS# 151126-32-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pramoxine hydrochloride, CAS# 637-58-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pranlukast, CAS# 103177-37-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prasugrel, CAS# 150322-43-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PRASUGREL HYDROCHLORIDE, CAS# 389574-19-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pravastatin, CAS# 81093-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pravastatin sodium, CAS# 81131-70-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Praziquantel, CAS# 55268-74-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prazosin hydrochloride, CAS# 19237-84-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preangiotensinogen (11-14) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preangiotensinogen (11-14) (human), CAS# 102813-98-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PREDNICARBATE, CAS# 73771-04-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PREDNISOLONE, CAS# 50-24-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prednisolone 21-trimethylacetate, CAS# 1107-99-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prednisolone phosphate sodium, CAS# 125-02-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prednisolone sodium succinate, CAS# 1715-33-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prednisolone Valeroacetate, CAS# 72064-79-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prednisolone-21-acetate, CAS# 52-21-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prednisone, CAS# 19420,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prednisone 21-acetate, CAS# 125-10-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pregabalin, CAS# 148553-50-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pregnenolone, CAS# 145-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pregnenolone acetate, CAS# 1778-02-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro- Atrial Natriuretic Factor (104-116)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro CCK fragment， V-9-M;VPVEAVDPM, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro Corticotropin Releasing Factor (125-151)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro TRH (160-169), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro TRH (178-199), CAS# 122018-92-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro TRH (53-74), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro TRH (83-106), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro VIP (111-122) (huMan), CAS# 123025-94-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro VIP (111-122) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro VIP (156-170) (huMan), CAS# 107902-86-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro VIP (81-122) (huMan), CAS# 111366-38-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro VIP (81-122) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro VIP/PHM: 111-122, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro VIP/PHM: 156-170, CAS# 107902-86-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro VIP: 81-122， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-adrenomedullin (153 - 185)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-adrenomedullin (153 -185)(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-adrenomedullin (153-185)， human;SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-adrenomedullin (45-92)， human;ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-ANF: 104-116， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Atrial Natriuretic Factor (104-123) (human), CAS# 112160-83-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Atrial Natriuretic Factor (104-123) (huMan) pro-hANF (79-98)， Kaliuretic Peptide (huMan)， Prepro-Atrial Natriuretic Factor (103-122) (bovine), CAS# 112160-83-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Atrial Natriuretic Factor (26-55) (human), CAS# 112160-82-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Atrial Natriuretic Factor (26-55) (huMan) Prepro-hANF (26-55) Cardiodilatin-Related Peptide (huMan), CAS# 112160-82-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Atrial Natriuretic Factor (56-92) (human), CAS# 112199-06-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Atrial Natriuretic Factor (56-92) (huMan) Prepro-hANF (56-92) (huMan), CAS# 112199-06-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preprocecropin B protein， insect, CAS# 97444-97-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-CNP: 1-27， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-CNP: 30-50， porcine， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preproenkephalin B (186-204)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preprogalanin 28-67， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PREPROGLUCAGON 78-108 HUMAN, CAS# 106612-94-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Nerve Growth Factor (99-115) (mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Neuromedin S (70-103) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-NeuroMedin S (70-103) (huMan) Prepro-NMS (70-103) (huMan), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Neuromedin S (70-103)(human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Neuromedin U (104-136) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Neuromedin U (104-136) (human)-[Leu116], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preproneuropeptide Y, CAS# 92307-59-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepropeptide gla， frog, CAS# 102619-51-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preprotachykinin B (50-79), CAS# 148597-04-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-thyrotropin releasing hormone (160-169), CAS# 122018-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-TRH (178-199), CAS# 122018-92-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prepro-Urotensin II (102-125) (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preprovasoactive intestinal peptide, CAS# 81032-41-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preprovasoactive intestinal peptide (111-122), CAS# 123025-94-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preptin (human), CAS# 315197-69-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Preptin (rat), CAS# 315197-73-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pre-S1 (12-32), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pre-S2 (1-26), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Presenilin-1 (331-349)-Cys (human， mouse), CAS# 317335-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Presenilin-1 (331-349)-Cys (human， mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Presenilin-2 N-Terminal Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pressinoic Acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pressinoic acid, CAS# 35748-51-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Présure. 10. 145-148, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pretilachlor, CAS# 51218-49-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pretrypsinogen signal sequence peptide, CAS# 104582-22-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prezatide copper, CAS# 89030-95-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prezatide copper acetate, CAS# 130120-57-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prilocaine, CAS# 721-50-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Primaquine diphosphate, CAS# 63-45-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Primisulfuron-methyl, CAS# 86209-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prion Peptide (106-126)， Human, CAS# 148439-49-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prion Protein (106 - 126), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prion Protein (106-126) (huMan), CAS# 148439-49-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prion Protein (106-126) (human) (scrambled), CAS# 150469-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prion Protein (118-135) (human), CAS# 202121-03-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prion Protein Fragment (106-126)， Human, CAS# 148439-49-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pristinamycin, CAS# 270076-60-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PRISTINAMYCIN, CAS# 11006-76-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pro - ε - Tx1X/12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ProadrenoMedullin (1-20) (huMan) PAMP, CAS# 150238-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proadrenomedullin (12-20) (human), CAS# 186027-43-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin (12-20) human;KWNKWALSR-NH2, CAS# 186027-43-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proadrenomedullin (12-20)(Human), CAS# 186027-43-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proadrenomedullin (45-92) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proadrenomedullin (45-92) (human), CAS# 166798-69-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proadrenomedullin (45-92)(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin (45-92), human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proadrenomedullin (PAMP) (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proadrenomedullin (PAMP) (Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin N20(Human), CAS# 150238-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin N20(Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin N20， human, CAS# 150238-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin N20， porcine;ARLDVAAEFRKKWNKWALSR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin N20， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin N20， rat;ARLDTSSQFRKKWNKWALSR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proadrenomedullin N-terminal 20 Peptide (Human， 9-20), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin: 153-185， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Adrenomedullin: 45-92， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proadrenomedullin-12 (PAMP-12) (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PRO-ASP-VAL-ASP-HIS-VAL-PHE-LEU-ARG-PHE-AMIDE, CAS# 121801-61-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Probenecid, CAS# 57-66-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Probenecid sodium, CAS# 23795-03-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Probucol, CAS# 23288-49-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Procalcitonin, CAS# 56645-65-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-calcitonin gene-related peptide, CAS# 95077-07-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Procaterol Hydrochloride, CAS# 81262-93-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Procathepsin B (26-50) (rat), CAS# 317331-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Procathepsin B (36-50) (rat), CAS# 317331-26-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prochloraz, CAS# 67747-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Procolipase activation peptide, CAS# 117830-79-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Procollagen Type I (212-216), CAS# 149128-48-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Procollagen α1 (1187-1218) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Procollagen-lysine 1， 2-oxoglutarate 5-dioxygenase 1 (388-401), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Cortistatin (28-47), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Cortistatin (51-81), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proctolin, CAS# 100930-02-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PROCTOLIN, CAS# 57966-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proctolin;RYLPT, CAS# 100930-02-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Procymidone, CAS# 32809-16-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prodynorphin (228-240)， porcine, CAS# 85006-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prodynorphin (228-256)， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prodynorphin: 228-256, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Profenofos, CAS# 41198-08-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

proFIX18, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

proFIX18??;TVFLDHENANKILNRPKR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

proFIX28, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

proFIX28??;TVFLDHENANKILNRPKRYNSGKLEEFV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proflavine hydrochloride, CAS# 952-23-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Progeline, CAS# 64577-63-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Progesterone, CAS# 57-83-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Glu-Gln-Pro-Leu-Thr(PO3H2)-Pro-Val-Thr-Asp-Leu-Ala-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Glu-Gln-Pro-Leu-Thr-Pro-Val-Thr-Asp-Leu-Ala-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proglumide, CAS# 6620-60-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Gly-Ser-Leu-PNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Programmed cell death 1 ligand 1 (15-23), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin (31-65)， human, CAS# 11097-48-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin (31-65)， human， Tyr-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin (33-65)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin C - Peptide (31 - 63)， porcine, CAS# 28152-90-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin C - peptide (55 - 89)， human, CAS# 33017-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin C-peptide, CAS# 59112-80-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin C-Peptide (31-63) (porcine), CAS# 28152-90-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin C-Peptide (31-63)， porcine;RREAENPQAGAVELGGGLGGLQALALEGPPQKR, CAS# 28152-90-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin C-Peptide (55-89) (huMan), CAS# 11097-48-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin C-peptide (55-89)， human, CAS# 33017-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin C-peptide (55-89)， human;RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR, CAS# 33017-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin C-peptide (human), CAS# 33017-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proinsulin-like growth factor II (117-156), CAS# 108688-27-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prokineticin 1 (PK1) (Human， 81-105)-[Cys(Acm)96], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prokineticin 1(PK1)(75-105)[Cys(Acm78，96](Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prokineticin 1(PK-1)(75-105)[Cys78，96，80，86](Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prokineticin 2 (PK2) (Human， 89-108)-[Cys(Acm)94], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prokineticin 2(PK2)(82-108)(Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prokineticin 2(PK-2)(82-108)[Cys(Acm)86，94](Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (12-31)， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (12-31)， bovine;TPDINPAWYAGRGIRPVGRF-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (12-31)， human, CAS# 235433-36-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (12-31)， rat, CAS# 222988-10-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (12-31)， rat;TPDINPAWYTGRGIRPVGRF-NH2, CAS# 222988-10-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (1-31)， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (1-31)， bovine;SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (1-31)， human;SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2, CAS# 235433-36-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (1-31)， HumanPrRP-31, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (1-31)， rat, CAS# 215510-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide (1-31)， rat;SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2, CAS# 215510-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide-20 (PrRP-20)， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptide-31 (PrRP-31)， bovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin Releasing Peptides and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing hormone (Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing Peptide (12-31) (huMan), CAS# 235433-36-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing Peptide (12-31) (rat), CAS# 222988-10-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing Peptide (1-31) (huMan), CAS# 215510-22-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing Peptide (1-31) (rat), CAS# 215510-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing Peptide-20 (PrRP-20) (Bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing Peptide-20 (PrRP-20) (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing Peptide-20 (PrRP-20) (Rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing Peptide-31(PrRP-31) (Bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolactin-Releasing Peptide-31(PrRP-31) (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proline, CAS# 147-85-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prolyl Endopeptidase Inhibitor II, CAS# 108708-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Promecarb, CAS# 2631-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PROMESTRIENE, CAS# 39219-28-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Promethazine hydrochloride, CAS# 58-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prometon, CAS# 1610-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prometryn, CAS# 7287-19-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pronase E, CAS# 9036-06-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proneuropeptide Y, CAS# 108317-02-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-opiomelanocortin human joining peptide(77-109), CAS# 124222-22-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-opiomelanocortin joining peptide(14-23), CAS# 88389-69-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-opiomelanocortin joining peptide(77-97), CAS# 123723-76-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-opiomelanocortin joining peptide(79-108), CAS# 83296-42-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-osteocalcin, CAS# 104645-98-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propachlor, CAS# 1918-16-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PROPAFENONE HCL, CAS# 34183-22-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propamocarb, CAS# 24579-73-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propamocarb?hydrochloride, CAS# 25606-41-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proparacaine hydrochloride, CAS# 1452000,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propargite, CAS# 2312-35-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propazine, CAS# 139-40-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propetamphos, CAS# 31218-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propham, CAS# 122-42-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propiconazole, CAS# 60207-90-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propineb, CAS# 12071-83-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propionyl-Amyloid β-Protein (31-34) amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propionyl-Amyloid β-Protein (31-34) amide, CAS# 256419-86-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propionyl-Beta-Amyloid (31-34)， amide;Propionyl-IIGL-NH2, CAS# 256419-86-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propionyl-L-carnitine hydrochloride, CAS# 119793-66-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propionyl-neuropeptide Y, CAS# 114453-28-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propisochlor, CAS# 86763-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propitocaine hydrochloride, CAS# 1786-81-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propiverine Hydrochloride, CAS# 54556-98-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propofol, CAS# 2078-54-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propranolol hydrochloride, CAS# 318-98-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Pro-pNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

proPT18, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

proPT18??;HVFLAPQQARSLLQRVRR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

proPT28, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

proPT28??;HVFLAPQQARSLLQRVRRANTFLEEVRK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propyl chloroformate, CAS# 109-61-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propyl Gallate, CAS# 121-79-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propylene carbonate, CAS# 108-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Propyphenazone, CAS# 479-92-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

propyzamide, CAS# 23950-58-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prosaptide 769P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prosaptide 769P;CaFLVKEVTKLIDNNKTEKEIL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prosaptide TX14(A), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prosaptide TX14(A);TaLIDNNATEEILY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prosaptide， wild type, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prosaptide， wild type;TKLIDNNKTEKEIL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

prosomatostatin, CAS# 74315-46-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Somatostatin (1-32) / N-Terminal Prepro-Somatostatin (Porcine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prosomatostatin (1-32)， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prosomatostatin cryptic peptide, CAS# 105655-57-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostaglandin E1, CAS# 745-65-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostaglandin F2a tris salt, CAS# 38562-01-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostate Specific Antigen (146-154), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostate Specific Antigen-1 (153-161), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostate-specific antigen (165-174), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostate-specific antigen (178-187), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostate-Specific Antigen， PSA propeptide;APLILSR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostatic acid phosphatase (112-120), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostatic acid phosphatase (18-26), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prostatic acid phosphatase (299-307), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

prosulfocarb, CAS# 52888-80-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prosulfuron, CAS# 94125-34-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protamine sulfate, CAS# 53597-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protease - Activated Receptor - 4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protease - Activated Receptor2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protease Activated Receptor - 2， PAR - 2 Agonist， amide, CAS# 190383-13-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protease S Aureus, CAS# 66676-43-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protease Substrates, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protease-Activated Receptor2(PAR2) Agonist??;SLIGRL-NH2, CAS# 171436-38-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protease-Activated Receptor-2， PAR-2 Agonist， amide;SLIGKV-NH2, CAS# 190383-13-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protease-Activated Receptor-4， PAR-4 Agonist， amide;AYPGKF-NH2, CAS# 352017-71-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protease-Activated Receptor-4， PAR-4 Agonist， amide;GYPGKF-NH2, CAS# 245443-52-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proteasome inhibitor I, CAS# 158442-41-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protected meropenem, CAS# 96036-02-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein disulfide-isomerase, CAS# 37318-49-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein enabled homolog (443-451), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein enabled homolog (502-510), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein G B1 Domain (41-56), CAS# 160291-75-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PROTEIN KINASE A INHIBITOR 14-22 AMIDE， CELL-PERMEABLE， MYRISTOYLATED, CAS# 201422-03-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase A Substrate, CAS# 57836-10-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C (19-31), CAS# 121545-65-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C (19-36), CAS# 113731-96-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C (19-36); Protein Kinase C Selective Inhibitor Protein, CAS# 113731-96-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C (530-558), CAS# 122613-29-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C (alpha) Peptide, CAS# 159939-84-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C Substrate, CAS# 105802-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C substrate from EGF Receptor, CAS# 121284-21-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C Substrate， Glycogen Synthase (1-8), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C: 19-35 Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C: 660-673, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C: alpha Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C: beta Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C: gamma Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C? Peptide Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase C|? Translocation Inhibitor Peptide， Negative Control, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase Cε Peptide Substrate [ERMRPRKRQG-pS-VRRRV]， Phosphorylated;ERMRPRKRQG-pS-VRRRV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase Cε Peptide Substrate [ERMRPRKRQGSVRRRV]， 5-FAM labeled;5-FAM-ERMRPRKRQGSVRRRV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase Cε Peptide Substrate [ERMRPRKRQGSVRRRV]， 5-TMR labeled;5-TMR-ERMRPRKRQGSVRRRV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase Cε Peptide Substrate [ERMRPRKRQGSVRRRV]， Biotinylated;Biotin-ERMRPRKRQGSVRRRV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase Cε Peptide Substrate [ERMRPRKRQGSVRRRV];ERMRPRKRQGSVRRRV, CAS# 120253-69-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase G Substrate [QKRPRRKDTP]， 5-FAM labeled;5-FAM-QKRPRRKDTP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase G Substrate [QKRPRRKDTP]， 5-TMR labeled;5-TMR-QKRPRRKDTP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase G Substrate [QKRPRRKDTP]， Biotinylated;Biotin-QKRPRRKDTP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase G Substrate [QKRPRRKDTP]， Phosphorylated;QKRPRRKD-pT-P, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase G Substrate [QKRPRRKDTP];QKRPRRKDTP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase G Substrate; G-Subtide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase Inhibitor (5-24);TTYADFIASGRTGRRNAIHD, CAS# 99534-03-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase Inhibitor Cdk2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein kinase inhibitor peptide, CAS# 128022-93-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein kinase inhibitor peptide (1-31), CAS# 124695-91-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein kinase inhibitor peptide (6-24), CAS# 136058-52-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase p34 (cd2) Substrate [ADAQHATPPKKKRKVEDPKDF]， 5-FAM labeled;5-FAM-ADAQHATPPKKKRKVEDPKDF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase p34 (cd2) Substrate [ADAQHATPPKKKRKVEDPKDF]， 5-TMR labeled;5-TMR-ADAQHATPPKKKRKVEDPKDF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase p34 (cd2) Substrate [ADAQHATPPKKKRKVEDPKDF]， Biotinylated;Biotin-ADAQHATPPKKKRKVEDPKDF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase p34 (cd2) Substrate [ADAQHATPPKKKRKVEDPKDF]， Phosphorylated;ADAQHA-pT-PPKKKRKVEDPKDF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase p34 (cd2) Substrate [ADAQHATPPKKKRKVEDPKDF];ADAQHATPPKKKRKVEDPKDF, CAS# 135546-44-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase p34(cd2) Substrate; CSH 103, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Kinase Related Peptides, CAS# 119386-39-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein MSP3-LSP, CAS# 956173-48-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein OS-9 (438-446), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein phosphatase 1 regulatory subunit 3B (172-180), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX2 (101-111), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX2 (19-34), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX2 (37-54), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX2 (41-49), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX2 (45-58), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX2 (45-59), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX4 (151-170), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX4 (161-180), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX4 (31-50), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX4 (41-60), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX4 (51-70), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein SSX4 (61-80), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein timeless homolog (848-856), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase 1B Substrate [ELEF-pY-MDYE-NH2]， 5-FAM labeled;5-FAM-ELEF-pY-MDYE-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase 1B Substrate [ELEF-pY-MDYE-NH2]， 5-TMR labeled;5-TMR-ELEF-pY-MDYE-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase 1B Substrate [ELEF-pY-MDYE-NH2]， Acetylated;Ac-ELEF-pY-MDYE-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase 1B Substrate [ELEF-pY-MDYE-NH2]， Biotinylated;Biotin-ELEF-pY-MDYE-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase 1B Substrate [ELEF-pY-MDYE-NH2];ELEF-pY-MDYE-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase Substrate I [END-pY-INASL]， 5-FAM labeled;5-FAM-END-pY-INASL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase Substrate I [END-pY-INASL]， 5-TMR labeled;5-TMR-END-pY-INASL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase Substrate I [END-pY-INASL]， Biotinylated;Biotin-END-pY-INASL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase Substrate I [END-pY-INASL];END-pY-INASL, CAS# 148851-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein Tyrosine Phosphatase Substrate I [ENDYINASL]， Biotinylated， Non phosphorylated;Biotin-ENDYINASL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protein τ Fragment (187-204), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proteinase K, CAS# 39450-01-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proteinase(Bacillus subtilis), CAS# 2598337,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proteolipid Protein (184-199), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proteolipid Protein (190-209), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proteolipid Protein (41-58), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-TGF-a, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-TGF-α;HADLLAVVAASQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prothiofos, CAS# 34643-46-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-Thr-Ser-Tyr-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protionamide, CAS# 14222-60-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protirelin, CAS# 24305-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Pro-TNF-α (71-82)， human;SPLAQAVRSSSR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proton pump polypeptide 116K, CAS# 135846-03-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Protonectin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proto-oncogene PIM1 (191-199), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Proto-Oncogene Tyrosine Protein Kinase Src Fragment IG-11， FITC-labeled;FITC-LC-IEDNEYTARQG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Prototype of RGD-containing peptide， FITC-labeled;FITC-LC-GRGDSP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

pro-ε-Tx1X/12??;LKRTIRTRLNIR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PrP (106-114);KTNMKHMAG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PrP (106-126);KTNMKHMAGAAAAGAVVGGLG, CAS# 148439-49-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PrP (113-126);AGAAAAGAVVGGLG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PrP (127-147);GYMLGSAMSRPIIHFGSDYED, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PrP (57-64);WGQPHGGG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PrP (89-106);WGEGGGTHSEWNKPSSKPK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PRRS-PQGAB-C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PRRS-PQGAB-M, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PRRS-PQGAB-N, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

PRRS-RSAB-C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.