EOS-Peptide-13

EOS med chem is the only manufacturer that provides excellent quality chemistry products and services at affordable rates. The experts working here are highly trained to handle these chemicals used in the creation of medicines used for treating various life-threatening diseases. We are into the manufacturing of chemical products after doing a deep research for the same.

EOS team of experts holds the work experience of more than ten years, and therefore we can assure you about the quality and superiority of the products and services we offer to all our valued clients around the globe. At present, this organization is listed among the most leading pharmaceutical suppliers around the world. We always supply products keeping the affordability in mind.

Caspase-3 Substrate V， Fluorogenic, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Caspase-5-derived FSP (67-75), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Caspase-9 Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Caspofungin, CAS# 162808-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Caspofungin Acetate, CAS# 179463-17-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Caspofungin acetate [USAN:BAN:JAN], CAS# 179463-17-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CATALASE, CAS# 2593710,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Catch-Relaxing Peptide (CARP), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Catch-Relaxing Peptide (CARP);AMPMLRL-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CATESTATIN, CAS# 142211-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Catestatin (human), CAS# 197151-46-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CATH_BRALE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin antimicrobial peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin antimicrobial peptide precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-3.4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-5 ， Antibacterial peptide BMAP-28 ， Myeloid antibacterial peptide 28, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-AL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-AM, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-B1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-BF antimicrobial peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-BF-15, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-PY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelicidin-related antimicrobial peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelin-related antimicrobial peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathelin-related peptide SC5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin D and E Substrate??;Mca-GKPILFFRLK(Dnp)-r-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin G (77 - 83), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin G (77-83) amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin G (77-83);HPQYNQR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin G Inhibitor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin G(1-5), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin L Substrate;FITC-LC-Glu-Lys-Ala-Arg-Val-Leu-Ala-Glu-Ala-Ala-Lys(DABCYL)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin S substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin S substrate.??;Ac-KQKLR-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cathepsin X (314-325), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cationic antimicrobial protein, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBD-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CbnA Induction Factor;SINSQIGKATSSISKCVFSFFKKC(Disulfidebridge:16-24), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CB-TH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz -Val-OH, CAS# 1149-26-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-(R)-3-Aminoisobutyric acid, CAS# 132696-46-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2，3-Dichloro-L-Phenylalanine, CAS# 1270300-72-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2，3-Difluoro-D-Phenylalanine, CAS# 1270295-87-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2，4，6-Trifluoro-D-Phenylalanine, CAS# 1270295-78-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2，4-Difluoro-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2，5-Dichloro-L-Phenylalanine, CAS# 1270285-84-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2，5-Difluoro-L-Phenylalanine, CAS# 1270292-28-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2，5-Dimethy-D-Phenylalanine, CAS# 1270300-37-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2，5-Dimethy-L-Phenylalanine, CAS# 1270292-32-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2，6-Dichloro-L-Phenylalanine, CAS# 1270296-58-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2-Bromo-L-Phenylalanine, CAS# 1270295-82-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2-Cyano-D-Phenylalanine, CAS# 1177756-06-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2-Cyano-L-Phenylalanine, CAS# 1177621-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2-Iodo-D-Phenylalanine, CAS# 1270296-45-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-2-Methy-D-Phenylalanine, CAS# 1177506-89-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-3，4-Dimethy-D-Phenylalanine, CAS# 1270300-38-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-3，5-Difluoro-D-Phenylalanine, CAS# 1270290-58-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-3，5-Dimethy-D-Phenylalanine, CAS# 1270292-41-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-3-Bromo-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-3-Methoxy-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-3-Methy-D-Phenylalanine, CAS# 1177767-37-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-3-Trifluoromethyl-D-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-4-Iodo-L-Phenylalanine, CAS# 220400-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-4-Nitro-D-Phenylalanine, CAS# 117402-88-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-4-Trifluoromethyl-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Abu-OH, CAS# 42918-86-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Ala-His-OH, CAS# 79458-92-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-ALPHA-ALLYL-D-GLY, CAS# 127474-54-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-ALPHA-ALLYL-L-GLY, CAS# 78553-51-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Asp-OH;N-Carbobenzyloxy-L-aspartic acid, CAS# 1152-61-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-CL, CAS# 501-53-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-Cl ， Z-Cl, CAS# 501-53-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-D-Cit-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-D-Glu, CAS# 63648-73-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-D-Glu-Obzl;Z-D-glutamic acid 1-benzyl ester, CAS# 65706-99-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-D-Homocitrulline, CAS# 218938-56-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-D-Homoleu-OH z-D-Hle-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-D-Ile-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-DL-3-Aminoisobutyric acid, CAS# 101642-77-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-D-Leu-OH, CAS# 28862-79-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-D-Norleu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-D-Norval-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-D-Pro-OH, CAS# 6404-31-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-D-Trp, CAS# 2279-15-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-D-Valine, CAS# 1685-33-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Gln-OH;N-Carbobenzyloxy-L-glutamine, CAS# 2650-64-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Glycine-Proline, CAS# 65022-15-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Gly-OH;N-Carbobenzyloxyglycine, CAS# 1138-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Gly-Pro, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-L-3-Aminobutyric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-L-Arg, CAS# 1234-35-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Leu-OH;N-Carbobenzyloxy-L-leucine, CAS# 2018-66-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-L-Gly, CAS# 1138-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-L-HABA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-L-Homoleu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-L-Norleu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-L-Norval-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-L-Phe, CAS# 1161-13-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-L-Pyroglutamic acid, CAS# 32159-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-L-Threonine, CAS# 19728-63-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-L-Tryptophan, CAS# 7432-21-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Lysine(Isopropyl)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-Met-Lys-Arg-Leu-AMC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-OSU, CAS# 13139-17-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-Pentafluoro-L-Phenylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-R-3-Aminoisobutyric acid, CAS# 132696-46-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CBZ-S-Phenyl-L-Cysteine, CAS# 82611-65-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-γ-Aminobutyric acid, CAS# 5105-78-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cbz-ε- Aminocaproic acid, CAS# 1947-00-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CC Chemokine Receptor 3 Fragment I， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CC Chemokine Receptor 3 Fragment I， amide;MTTSLDTVETFGTTSYYDDVGLLCEKADTR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CC Chemokine Receptor 3 Fragment II, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CC Chemokine Receptor 3 Fragment II， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CC Chemokine Receptor 3 Fragment II， amide;MTTSLDTVETFGTTSYYDDVGLLC-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CC Chemokine Receptor 3 Fragment II;MTTSLDTVETFGTTSYYDDVGLLC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cc-CATH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cc-CATH3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CcD1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cc-GRP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CCK Flanking Peptide (Non-Sulfated), CAS# 198483-37-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CCK Octapeptide (CCK-8)， non-sulphated, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CCK Octapeptide (CCK-8)， sulphated, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CCK-33 (Human), CAS# 96827-04-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CCK-4 Acetate, CAS# 35144-91-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CCK-4 Acetate 50 μg/vial (Clinalfa basic), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CCL27, CAS# 167114-91-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cc-LTP1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CCMV Gag-(7-25), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CD natriuretic peptide, CAS# 344901-86-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CD20 (188-196), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CD36 (93-110)-Cys, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CD36 Peptide P (93-110), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CD59 glycoprotein precursor (106-114), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cdc2 peptide (9-19), CAS# 142570-54-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cdc2 Substrate;Ac-SPGRRRRK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cdc2(6-20)NH2, CAS# 136688-17-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDC25C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDC25C??;KKKVSRSGLYRSPSMPENLNRPR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cdc25C-derived peptide??;5-FAM-VSRSGLYRSPSMPENLNRPR-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDI, CAS# 530-62-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cdk2/Cyclin Inhibitory Peptide I, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cdk2/Cyclin Inhibitory Peptide II, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK4/6 inhibitor, CAS# 1256963-02-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK4-R24C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK5 Substrate [PK-pT-PKKAKKL]， Phosphorylated;PK-pT-PKKAKKL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK5 Substrate [PKTPKKAKKL]， 5-FAM labeled;5-FAM-PKTPKKAKKL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK5 Substrate [PKTPKKAKKL]， 5-TMR labeled;5-TMR-PKTPKKAKKL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK5 Substrate [PKTPKKAKKL]， Biotinylated;Biotin-PKTPKKAKKL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK5 Substrate [PKTPKKAKKL];PKTPKKAKKL, CAS# 164669-07-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK7tide derived peptide， FAM-labeled??;5-FAM-FLAKSFGSPNRAYKK-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK7tide， TAMRA labeled??;5-TAMRA-YSPTSPSYSPTSPSYSPTSPS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDK7tide??;YSPTSPSYSPTSPSYSPTSPS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDPKS， Syntide analog, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDPKS， Syntide analog??;PLRRTLSVAA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CDR-H3/C2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEA (605-613), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEA ， CAP-1， Carcinoembryonic Antigen;, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEA Related， QYSWFVNGTF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEA Related， QYSWFVNGTF;QYSWFVNGTF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEA Related， TYACFVSNL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEA Related， TYACFVSNL;TYACFVSNL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEA， CAP-1-6-D， [Asp6] - Carcinoembryonic Antigen, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEA， CAP-1-6-D， [Asp6]-Carcinoembryonic Antigen;YLSGADLNL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEACAM5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEC1_DROVI Cecropin-1 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEC3_DROVI Cecropin-3 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEC4_BOMMO Cecropin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CECA1_DROSI Cecropin-A1 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CECC_DROTK Cecropin-C precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CECD_BOMMO Cecropin-D precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CECE_BOMMO Antibacterial peptide enbocin precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin, CAS# 80802-79-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin (antibacterial peptide), CAS# 80802-79-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin A, CAS# 80451-04-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin A (1-7)-Melittin A (2-9) amide, CAS# 157606-25-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin A (1-7)-Melittin A (2-9) aMide CAMEL0， Cecropin A (1-8)-Melittin A (3-9) aMide， CM15, CAS# 157606-25-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin A (1-8)-Melittin (1-18) amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin A;KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, CAS# 80451-04-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin AD protein， insect, CAS# 116811-00-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin A-melittin hybrid peptide [CA(1-7)M(2-9)NH2], CAS# 157606-25-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin B, CAS# 80451-05-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin B， Free Acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin B;KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2, CAS# 80451-05-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin P1, CAS# 125667-96-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin P1 (porcine), CAS# 125667-96-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-A, CAS# 80451-04-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-A precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-A1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-A1 ， Cecropin-A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-A1/A2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-A2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-B, CAS# 80451-05-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-B1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-B2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-C type 1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-D, CAS# 83652-32-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-D-like peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-P2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-P3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cecropin-P4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cediranib, CAS# 288383-20-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cediranib Maleate, CAS# 857036-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF Control Peptide Pool;, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF1， Influenza Matrix Protein M1 (58-66);GILGFVFTL, CAS# 141368-69-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF10， Epstein-Barr Virus LMP2 (426-434);CLGGLLTMV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF11， Epstein-Barr Virus BMLF1 (280-288);GLCTLVAML, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF12， Epstein-Barr Virus latent NA3B (399-408)， AVF;AVFDRKSDAK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF14， Epstein-Barr Virus Rta Protein (28-37);DYCNVLNKEF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF15， Epstein-Barr Virus Lytic Cycle Protein BZLF-1(190-197);RAKFKQLL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF16， Epstein-Barr Virus latent NA-3A (337-347);FLRGRAYGL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF17， Epstein-Barr Virus latent NA-3A (158-166);QAKWRLQTL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF18， Epstein-Barr Virus latent NA-3C (258-266);RRIYDLIEL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF19， Epstein-Barr Virus latent NA-3A (458-466);YPLHEQHGM, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF2， Influenza Virus PA (46-54);FMYSDFHFI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF20， Cytomegalovirus， CMV pp65 (495-503);NLVPMVATV, CAS# 153045-21-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF21， Cytomegalovirus， CMV pp65 (417-426);TPRVTGGGAM, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF22， Cytomegalovirus， CMV pp65 (378-389);SDEEEAIVAYTL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF23， Cytomegalovirus， CMV pp65 (123-131);IPSINVHHY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF24， Influenza Virus PB1 Peptide (591-599);VSDGGPNLY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF25， Influenza Virus NP (44-52);CTELKLSDY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF26， Influenza Virus NP (265-274);ILRGSVAHK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF27， Epstein-Barr Virus BRLF-1 lytic (148-156);RVRAYTYSK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF28， Epstein-Barr Virus latent NA-3A (603-611);RLRAEAQVK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF29， Epstein-Barr Virus latent NA-3B (416-424);IVTDFSVIK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF3， Influenza Virus M1 (13-21);SIIPSGPLK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF30， Epstein-Barr Virus BRLF1 (134-142);ATIGTAMYK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF31， Epstein-Barr Virus latent NA-3A (379-387);RPPIFIRRL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF32， Epstein-Barr Virus latent NA-3C (281-290);EENLLDFVRF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF33， Cytomegalovirus， HCMV pp65;EFFWDANDIY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF4， Influenza Virus NP (342-351);RVLSFIKGTK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF5， Influenza Virus NP (91-99);KTGGPIYKR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF6， Influenza Virus NP;LPFDKTTVM, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF7， Influenza Virus NP (380-388);ELRSRYWAI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF8， Influenza Virus NP (383-391);SRYWAIRTR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEF9， Influenza Virus M1 128-135;ASCMGLIY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefadroxil, CAS# 66592-87-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefapirin sodium, CAS# 24356-60-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefazedone, CAS# 56187-47-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefazedone sodium salt, CAS# 63521-15-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefazolin sodium salt, CAS# 27164-46-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefcapene pivoxil hydrochloride, CAS# 147816-24-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefdinir, CAS# 91832-40-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefditoren pivoxil, CAS# 117467-28-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefepime hydrochloride, CAS# 123171-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEFETAMET PIVOXIL HYDROCHLORIDE, CAS# 111696-23-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefetamet pivoxyl, CAS# 65243-33-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefixime, CAS# 79350-37-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefmenoxime, CAS# 65085-01-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefmenoxime hydrochloride, CAS# 75738-58-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefmetazole, CAS# 56796-20-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefmetazole sodium, CAS# 56796-39-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEFMINOX SODIUM, CAS# 92636-39-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefodizime sodium, CAS# 86329-79-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefodizme, CAS# 69739-16-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefonicid, CAS# 61270-58-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefonicid sodium, CAS# 61270-78-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEFOPERAZONE, CAS# 62893-19-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefoperazone sodium, CAS# 62893-20-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefoselis sulfate, CAS# 122841-12-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefotaxime, CAS# 63527-52-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefotaxime sodium, CAS# 64485-93-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefotetan Acid, CAS# 69712-56-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefotetan disodium, CAS# 74356-00-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefotiam, CAS# 61622-34-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cefotiam hexetil, CAS# 95761-91-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cefotiam hexetil hydrochloride, CAS# 95789-30-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefotiam hydrochloride, CAS# 66309-69-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefovecin, CAS# 234096-34-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefoxitin, CAS# 35607-66-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefoxitin sodium, CAS# 33564-30-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefozopran, CAS# 113359-04-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefozopran hydrochloride, CAS# 113981-44-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefpiramide acid, CAS# 70797-11-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefpiramide sodium, CAS# 74849-93-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefpirome sulfate, CAS# 98753-19-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefpodoxime Proxetil, CAS# 87239-81-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefprozil, CAS# 92665-29-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefprozil hydrate, CAS# 121123-17-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cefquinome, CAS# 84957-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefquinome sulfate, CAS# 118443-89-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefsulodine sodium, CAS# 52152-93-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftaroline fosamil, CAS# 866021-48-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftazidime, CAS# 72558-82-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftazidime, CAS# 78439-06-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefteram pivoxil, CAS# 82547-58-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftezole, CAS# 26973-24-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftezole sodium, CAS# 41136-22-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftibuten, CAS# 97519-39-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftibuten dihydrate, CAS# 118081-34-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftiofur hydrochloride, CAS# 103980-44-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftizoxime, CAS# 68401-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftizoxime alapivoxil, CAS# 135821-54-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftizoxime sodium, CAS# 68401-82-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftriaxone, CAS# 73384-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftriaxone sodium, CAS# 104376-79-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceftriaxone sodium, CAS# 74578-69-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefuroxime, CAS# 55268-75-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefuroxime 1-acetoxyethyl ester, CAS# 64544-07-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cefuroxime sodium, CAS# 56238-63-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Celecoxib, CAS# 169590-42-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Celestine blue B, CAS# 1562-90-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Celiprolol hydrochloride, CAS# 57470-78-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cell division cycle 45-like (556-564), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cell division cycle protein 27 homolog (760-771), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cell Penetrating ARF Peptide (26-44), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cellular tumor antigen p53, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cellular tumor antigen p53 (153-165), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cellular tumor antigen p53 (193-204), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cellular tumor antigen p53 (217-225), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cellular tumor antigen p53 (99-107), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cellulase, CAS# 9012-54-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cemandil sodium salt, CAS# 42540-40-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cenegermin, CAS# 1772578-74-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Centriolin (2174-2182), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Centrocin 1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Centrocin 2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Centrosome-associated protein 350 (2297-2305), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cephalexin monohydrate, CAS# 15686-71-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cephalonium, CAS# 5575-21-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cephalosporin C zinc salt, CAS# 59143-60-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cephalothin, CAS# 58-71-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEPHALOTHIN, CAS# 153-61-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEPHAPIRIN BENZATHINE, CAS# 97468-37-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CEPHRADINE, CAS# 38821-53-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceramides, CAS# 100403-19-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceratotoxin A, CAS# 150671-04-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceratotoxin B, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceratotoxin B, CAS# 150671-05-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceratotoxin-A, CAS# 150671-04-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceratotoxin-B, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceratotoxin-C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceratotoxin-D, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cerebellin, CAS# 94071-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cerebellin;SGSAKVAFSAIRSTNH, CAS# 94071-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cerebral peptide 2;FDFGFAGLDTYDAIHRALEQPARGTSNSGSGYNMLMKMQRH-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cereolysin, CAS# 72270-31-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ceritinib, CAS# 1032900-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetilistat, CAS# 282526-98-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CETIRIZIN DIHYDROCHLORIDE, CAS# 83881-52-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetirizine, CAS# 83881-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix, CAS# 145672-81-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix, CAS# 130143-01-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix, CAS# 120287-85-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix Acetate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix Acetate, CAS# 130143-01-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix acetate, CAS# 120287-85-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix Acetate， Cetrotide;, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix Acid;, CAS# 120287-85-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cetrorelix trifluoroacetate, CAS# 130289-71-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cevimelinehydrochloride, CAS# 153504-70-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CFP10 (71-85), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CFP10 (71–85)??;EISTNIRQAGVQYSR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CFTR (108-117)， Pseudomonas aeruginosa Inhibitor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CFTR (108-117)， Pseudomonas aeruginosa Inhibitor??;SYDPDNKEER, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGA 41-60, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGA 41-70, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGA 47-60, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGA 47-70, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGI-55 protein (21-31), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cgMolluscidin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cgp 15425, CAS# 76080-70-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cg-Prp, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP (22-37)， rat， [Tyr22]-α -, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP (32-37)， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP (chicken), CAS# 114679-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP (Human)-[C(Acm2，7)], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP (Human， 17-37), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP (Rat), CAS# 83651-90-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP (Rat， 30-37), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP (Rat， 31-37), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP (Rat， 8-37), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP， chicken, CAS# 114679-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP， human， [Cys(Acm)2&7]-α -, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CGRP， human， [Cys(Et)2&7]-α -, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ch Beta-Amyloid (30-16), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ch β-Amyloid (30-16)??;CTFVRTHIFCKEHQF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChaC1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChaC10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChaC11, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChaC2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChaC4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChaC7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChaC8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chain A， Cecropin A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chain A， Cyclic Pentapeptide Which Inhibits Hantavirus., CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chain A， E6-Bind Trp-Cage (E6apn1), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chain A， E6-Binding Zinc Finger (E6apc1), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chain A， E6-Binding Zinc Finger (E6apc2), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chain A， Hevein-Type Antifungal Peptide With A Unique 10-Cysteine Motif, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chain C， Co-Complex Structure Of Ns3-4a Protease With The Optimized Inhibitory Peptide Cp5-46a-4d5e, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CHAPS, CAS# 75621-03-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CHAPSO, CAS# 82473-24-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Characteristic MSH-Tetrapeptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Charybdotoxin, CAS# 95751-30-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Charybdotoxin，ChTX, CAS# 95751-30-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Charybdotoxin;Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS(Disulfidebridge:7-28，13-33and17-35), CAS# 95751-30-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chaulmrrgric acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChBac5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chelidamic acid, CAS# 138-60-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chelidonic acid, CAS# 99-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chemerin / TIG2 (Human， 135-154), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chemerin / TIG2 (Human， 145-157), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chemerin / TIG2 (Human， 29-67), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chemerin peptide 4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chemotactic Domain of Elastin, CAS# 92899-39-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chemotactic tetrapeptide, CAS# 112275-27-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chenodeoxycholic acid, CAS# 474-25-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chensinin-1CEb, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chensinin-3CE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CHES, CAS# 103-47-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chicago sky blue 6B, CAS# 259444,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chicken AvBD1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chicken AvBD12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chicken AvBD2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chicken AvBD4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chicken AvBD7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chicken CATH-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chicken Heterophil Peptide 2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chimeric Rabies Virus Glycoprotein Fragment (RVG - 9R), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chiniofon, CAS# 547-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chinomethionat, CAS# 196869,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chionodracine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chitin, CAS# 1398-61-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chitinase, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chitinase, CAS# 2593742,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chitin-binding protein 3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chitosan, CAS# 9012-76-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloramben, CAS# 133-90-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloramphenicol, CAS# 56-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloramphenicol glycinate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloramphenicol-alcohol, CAS# 23885-72-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloranocryl, CAS# 96671,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

chlorbenzuron, CAS# 57160-47-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorchinaldol, CAS# 72-80-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChlordehydroMethyl Testosterone Acetate, CAS# 855-19-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CHLORDIAZEPOXIDE HYDROCHLORIDE, CAS# 438-41-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorempenthrin, CAS# 54407-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorfenapyr, CAS# 122453-73-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorfenson, CAS# 80-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorfensulfide, CAS# 2274-74-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorfenvinphos, CAS# 470-90-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorfluazuron, CAS# 71422-67-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorhexidine acetate, CAS# 56-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorhexidine diacetate, CAS# 206986-79-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorhexidine Gluconate Solution, CAS# 18472-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorhexidine hydrochloride, CAS# 3697-42-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorimuron-ethyl, CAS# 90982-32-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlormadinone acetate, CAS# 302-22-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlormequat chloride, CAS# 999-81-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlormethine hydrochloride, CAS# 55-86-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloroac-DL-Phe-OH, CAS# 2142462,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloroac-D-Phe-OH, CAS# 137503-97-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloroaceto catechol, CAS# 99-40-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloroac-Tyr-OH, CAS# 1145-56-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloroambucil, CAS# 305-03-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorodiphenylphosphine, CAS# 1079-66-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorogenic acid, CAS# 327-97-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloromethyl isopropyl carbonate, CAS# 35180-01-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloromethyl pivalate, CAS# 18997-19-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorophacinone, CAS# 3691-35-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorophyll A, CAS# 479-61-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorophyll B, CAS# 519-62-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorophyllin, CAS# 11006-34-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloroplatinic acid, CAS# 16941-12-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorosulphonphenol S, CAS# 2103-73-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorothiazide, CAS# 58-94-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorotoluron, CAS# 15545-48-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorotoxin, CAS# 163515-35-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorotoxin (Cltx)?;MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2(Disulfidebridge:2-19，5-28，16-33，20-35), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorotoxin (free acid), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorotoxin Cltx (Egyptian scorpion), CAS# 163515-35-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorotriethylsilane, CAS# 994-30-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chloroxupon, CAS# 1982-47-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorphenamine Maleate, CAS# 113-92-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorpromazine hydrochloride, CAS# 69-09-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorpropham, CAS# 101-21-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorprothixene, CAS# 113-59-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorprothixene hydrochloride, CAS# 6469-93-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

chlorpyrifos-methyl, CAS# 5598-13-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorsulfuron, CAS# 64902-72-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlortalidone, CAS# 77-36-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorthal-dimethyl, CAS# 1861-32-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorthalonil, CAS# 1897-45-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlorzoxazone, CAS# 95-25-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chlozolinate, CAS# 84332-86-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CHMP7 protein， partial (48-62), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin (10-20);IKNLQSLDPSH, CAS# 100900-23-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin (1-21);KAPSGRVSMIKNLQSLDPSHR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin (26-33)， CCK8;DYMGWMDF-NH2, CAS# 25679-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin (26-33)， free acid;DYMGWMDF, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin (26-33)， non-sulphated, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin (26-33)， sulphated, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin (27-33), CAS# 20988-64-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin (CCK) and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin- 33， human, CAS# 96827-04-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin- 33， porcine, CAS# 67256-27-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin C-terminal flanking peptide, CAS# 101162-62-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Flanking Peptide， non-sulfated;SAEEYEYPS, CAS# 198483-37-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin hexapeptide, CAS# 21163-42-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide (1-2) (desulfated), CAS# 22840-03-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide (1-3) (desulfated), CAS# 121880-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide (1-4) (desulfated), CAS# 80790-40-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide (1-4) (sulfated), CAS# 25679-23-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide (1-5) (desulfated), CAS# 121880-96-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide (1-6) (desulfated), CAS# 198483-36-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide (2-8) (desulfated), CAS# 47910-79-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide (desulfated) CCK-8 (desulfated)， Sincalide (desulfated), CAS# 25679-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide (desulfated)，CCK-8 (desulfated)， Sincalide (desulfated), CAS# 25679-24-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide free acid (desulfated), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Octapeptide free acid (desulfated)，Sincalide (free acid) (desulfated), CAS# 103974-46-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin octapeptide， des-NH2-tyr, CAS# 79672-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin pentapeptide, CAS# 18917-24-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Precursor (107-115) (huMan) (desulfated), CAS# 198483-37-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin Precursor (24-32) (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin precursor C-terminal pentapeptide, CAS# 114942-10-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin， CCK (27-33)， CCK7;YMGWMDF-NH2, CAS# 47910-79-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin-33 (10-20) (bovine， porcine), CAS# 100900-23-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin-33 (10-20) (bovine， porcine) CCK-33 (10-20) (bovine， porcine)， CCK-39 (16-26) (bovine， porcine)， CCK-58 (35-45) (bovine， porcine), CAS# 100900-23-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin-33 (10-20) (bovine， porcine)，CCK-33 (10-20) (bovine， porcine), CAS# 100900-23-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin-33 (1-21) (porcine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin-33 (1-21) (porcine) CCK-58 (26-46) (porcine)， CCK-39 (7-27) (porcine)， CCK-33 (1-21) (porcine)， Cholecystokinin-21, CAS# 101831-07-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin-33 (1-21) (porcine)，CCK-33 (1-21) (porcine)，Cholecystokinin-21, CAS# 101831-07-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin-33 (human), CAS# 96827-04-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholecystokinin-33 (huMan) CCK-33 (huMan)， CCK-39 (7-39) (huMan)， CCK-58 (26-58) (huMan), CAS# 96827-04-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholera toxin， B subunit (50-64), CAS# 89157-28-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholesterol, CAS# 57-88-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholesterol esterase, CAS# 9026-00-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholesteryl acetate, CAS# 604-35-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholesteryl chloride, CAS# 910-31-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cholic acid, CAS# 81-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Choline bitartrate, CAS# 87-67-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Choline chloride, CAS# 67-48-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Choline Fenofibrate, CAS# 856676-23-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chondroitin sulfate A sodium salt, CAS# 39455-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chondroitin sulfate proteoglycan 4 (693-708), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chondroitin sulfate sodium salt, CAS# 2623363,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chondromodulin-I (319-327), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chondrosarcoma-associated gene 2/3 protein (34-48), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chonluten(Glu-Asp-Gly), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chorionic gonadotrophin, CAS# 9002-61-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chorionic Gonadotropin-β (109-119) amide (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chorionic Gonadotropin-β (109-119) amide (human)，hCG-β (109-119) amide, CAS# 165174-59-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chorionic Gonadotropin-β (109-145) (human)，hCG-β (109-145), CAS# 72979-70-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chorionic Gonadotropin-β(109-119) amide (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chorionic Gonadotropin-β(109-145) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chrombacin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chrome Blue K, CAS# 3270-25-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromeazurol S, CAS# 1667-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromofungin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromogranin A (324-337)， human, CAS# 115136-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromogranin A-derived peptide， WE-14, CAS# 115136-18-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromograninin A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ChroMostatin ChroMogranin A (124-143) (bovine), CAS# 133633-11-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromostatin， bovine, CAS# 133633-11-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromostatin， bovine;SDEDSDGDRPQASPGLGPGP, CAS# 133633-11-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromostatin， Chromogranin A (124-143) (bovine), CAS# 133633-11-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromotrope 2R, CAS# 839148,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromotropic acid, CAS# 148-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromotropic acid disodium salt dihydrate, CAS# 5808-22-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chromozym-tPA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CHRYSIN, CAS# 480-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chrysophsin-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chrysophsin-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chrysophsin-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chymostatin (microbial product), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chymotrypsin(bovine), CAS# 2594868,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Chymotrypsinogen A, CAS# 9035-75-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cianidanol, CAS# 154-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CIAP, CAS# 9001-78-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cibacron Blue F3G-A, CAS# 84166-13-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cicerarin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cicerin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cicerin (chickpea peptide), CAS# 470688-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ciclesonide, CAS# 126544-47-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ciclopirox, CAS# 29342-05-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ciclopirox ethanolamine, CAS# 41621-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cicloxilic acid, CAS# 57808-63-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cidofovir, CAS# 113852-37-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CIG, CAS# 86088-83-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cilastatin Sodium, CAS# 81129-83-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cilengitide, CAS# 188968-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cilnidipine, CAS# 132203-70-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cilofungin, CAS# 79404-91-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cilostazol, CAS# 73963-72-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cimaglermin alfa, CAS# 1350717-96-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ci-MAM-A24, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cimetidine hydrochloride, CAS# 70059-30-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CINACALCET, CAS# 226256-56-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cinacalcet Hydrochloride, CAS# 364782-34-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cinchocaine, CAS# 85-79-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cinchonidine, CAS# 485-71-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cinchonine, CAS# 118-10-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cinepazide maleate, CAS# 26328-04-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cinmethylin, CAS# 87818-31-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cinosulfuron, CAS# 94593-91-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ciprofibrate, CAS# 52214-84-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ciprofloxacin, CAS# 85721-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ciprofloxacin hydrochloride, CAS# 86483-48-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ciprofloxacin hydrochloride, CAS# 93107-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ciprofloxacin lactate, CAS# 97867-33-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ciprofloxaicin HCL, CAS# 86393-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Circulin-A, CAS# 5854-98-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Circulin-B, CAS# 20905-50-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Circulin-C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Circulin-D, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Circulin-E, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Circulin-F, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cis-1-(tert-Butoxycarbonyl)-4-ethylpyrrolidine-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cis-4-Hydroxy-DL-proline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cis-4-Hydroxy-D-proline, CAS# 2584-71-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cis-4-Hydroxy-L-proline, CAS# 618-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cisapride, CAS# 260779-88-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cisapride, CAS# 81098-60-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cisatracurium besylate, CAS# 96946-42-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CIS-BROMO-ESTER, CAS# 61397-56-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cis-Diamminediiodoplatinum, CAS# 15978-93-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CIS-OCTAHYDROPYRROLO[3，4-B]PYRIDINE, CAS# 151213-40-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cisplatin, CAS# 15663-27-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citalopram, CAS# 59729-33-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citalopram Hydrobromide, CAS# 59729-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citicoline sodium, CAS# 33818-15-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

citiolase, CAS# 1195-16-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citropin 2.1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citropin-1.1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citropin-1.1.3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citropin-1.2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citropin-1.3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citropin-2.1.3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citrulline, CAS# 372-75-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Citrulline Malate, CAS# 54940-97-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CJC-1295 (Without DAC), CAS# 863288-34-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CJC1295 with out DAC, CAS# 863288-34-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CJC1295 Without DAC, CAS# 863288-34-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CJC-1295 without DAC, CAS# 863288-34-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Jun-amino-terminal kinase-interacting protein 2 (683-692), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CK1tide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CK1tide??;HAAIGDDDDAYSITS-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CK2tide， FAM-labeled??;5-FAM-RRRADDSDDDDD-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cks 17, CAS# 99273-04-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CKS-17, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CKS-17 (7-12), CAS# 141975-99-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cladribine, CAS# 4291-63-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clarithromycin, CAS# 81103-11-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Class II sec-dependent bacteriocin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clavanin-A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clavanin-B, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clavanin-C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clavanin-D, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clavanin-E, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clavaspirin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clazamycin B, CAS# 71774-49-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CLEAP-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cleavage and polyadenylation specificity factor subunit 1 (1360-1369), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cleavage and polyadenylation specificity factor subunit 1 (250-258), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CLEBOPRIDE MALATE, CAS# 57645-91-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clemastine fumarate, CAS# 14976-57-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clenbuterol hydrochloride, CAS# 21898-19-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clethodim, CAS# 99129-21-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clevidipine butyrate, CAS# 167221-71-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clevudine, CAS# 163252-36-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cl-HOBt, CAS# 26198-19-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clindamycin Hydrochloride, CAS# 21462-39-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clindamycin palmitate hydrochloride, CAS# 25507-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clindamycin phosphate, CAS# 24729-96-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clinofibrate, CAS# 30299-08-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clioqunol, CAS# 130-26-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cliotide T1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cliotide T10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cliotide T12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cliotide T19, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cliotide T2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cliotide T3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cliotide T4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cliotide T7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CLIP(85–99), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CLIP(85–99)??;KPVSQMRMATPLLMR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clobetasol propionate, CAS# 25122-46-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clobetasone butyrate, CAS# 25122-57-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clocortolone Pivalate, CAS# 34097-16-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clodinafop-propafgyl, CAS# 105512-06-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clofarabine, CAS# 123318-82-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clofazimine, CAS# 2030-63-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clofenamic acid, CAS# 13278-36-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clofentezine, CAS# 74115-24-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clofibrate, CAS# 637-07-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clomazone, CAS# 81777-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clomipramine hydrochloride, CAS# 17321-77-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clonidine hydrochloride, CAS# 4205-91-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cloperastine hydrochloride, CAS# 14984-68-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clopidogrel, CAS# 113665-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clopidogrel Bisulfate, CAS# 120202-66-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clopidogrel hydrogen sulfate, CAS# 135046-48-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CLOPIDOGRELBESILATE, CAS# 744256-69-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clopidol, CAS# 2971-90-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cloprostenol sodium, CAS# 55028-72-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cloquintocet-methyl, CAS# 99607-70-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cloransulam-methyl, CAS# 147150-35-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clorprenaline, CAS# 3811-25-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clorprenaline hydrochloride, CAS# 6933-90-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clorsulon, CAS# 60200-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Closantel, CAS# 57808-65-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Closantel sodium, CAS# 61438-64-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clostripain from Clostridium histolyticum, CAS# 9028-00-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clotrimazole, CAS# 23593-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cloxacillin sodium, CAS# 7081-44-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Clozapine, CAS# 5786-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CLPP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CM-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cm-p1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CMPI, CAS# 14338-32-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-MT Peptide, CAS# 92237-18-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CMV Protease FRET Substrate I;[DABCYL-Arg-Gly-Val-Val-Asn-Ala-Ser-Ser-Arg-Leu-Ala-EDANS], CAS# 163265-38-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Myc Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

c-Myc peptide epitope;EQKLISEEDL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cn-AMP1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cn-AMP2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cn-AMP3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CNP-53 (Porcine， Rat， 1-29), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CNP-Afu, CAS# 157843-41-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CNTO 528 monoclonal antibody, CAS# 1018869-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CNV-38d(1-34), CAS# 52232-67-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CO-1686 (AVL-301), CAS# 1374640-70-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

COA, CAS# 85-61-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coagulation Factor XIIIa (190-230), CAS# 158455-48-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coagulin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cobicistat(GS-9350), CAS# 1004316-88-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coccinin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cockroach Myoactive Peptide I, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cockroach Myoactive Peptide II (MII), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cocoyl Hexapeptide-16, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cocoyl Pentapeptide-9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cod beta defensin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Codactide, CAS# 22572-04-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coenzyme R10, CAS# 303-98-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

COG 133, CAS# 514200-66-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coiled-coil and C2 domain-containing protein 2A isoform a (1275-1287), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coiled-coil domain-containing protein 110 (196-204), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coiled-coil domain-containing protein 110 (499-508), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coiled-coil domain-containing protein 110 (770-778), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colchicine, CAS# 64-86-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colesevelam hydrochloride, CAS# 182815-44-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colestipol HCl, CAS# 26658-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

colistimethate sodium, CAS# 8068-37-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

COLISTIN, CAS# 1066-17-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colistin A, CAS# 7722-44-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colistin B, CAS# 7239-48-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colistin heptapeptide, CAS# 75748-25-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colistin nonapeptide, CAS# 32530-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colistin nonapeptide hydrochloride, CAS# 52396-32-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colistin sulfate salt, CAS# 1264-72-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colivelin, CAS# 867021-83-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Collagen Binding Fragment, CAS# 94040-53-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Collagen hydrolysate， sodium salt solution, CAS# 92113-31-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Collagen Type II Fragment, CAS# 144703-90-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Collagen type IV alpha1 (531-543), CAS# 119953-02-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Collagen Type IV α3 Chain (185-203), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Colutellin-A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Combi-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Combi-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

COMBRETASTATIN A-4, CAS# 117048-59-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Combretastatin A4 disodium phosphate, CAS# 168555-66-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Complement anaphylatoxin C5a (37 - 53)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Complement anaphylatoxin C5a (37-53)， human??;RAARISLGPRCIKAFTE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Complement C3a， (70-77), CAS# 63555-63-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Complement C3a， (72-77), CAS# 66157-45-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Complement C3a， (Tyr-70-77), CAS# 125753-03-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Complex amino acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Compound proteinase, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Compstatin, CAS# 206645-99-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

COMU, CAS# 1075198-30-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ConA, CAS# 11028-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Conantokin G (free acid), CAS# 133628-78-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Conantokin G， Marine snail， Conus geographus, CAS# 93438-65-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Conantokin G;GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN-NH2, CAS# 133628-78-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Conantokin T， Marine snail， Conus tullpa, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Concanamycin A, CAS# 80890-47-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Congo red, CAS# 573-58-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coniine, CAS# 3238-60-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Conivaptan hydrochloride, CAS# 168626-94-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONJUGATED ESTROGENS, CAS# 12126-59-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ConMana, CAS# 610798-31-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Connective tissue-activating peptide, CAS# 69344-77-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Connexin Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Conolysin-Mt2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Conopressin S, CAS# 111317-90-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Conotoxin GV, CAS# 93438-65-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat -03;EPWKHPGSQPKTACT, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-01;MEPVDPRLEPWKHPG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-04;HPGSQPKTACTNCYC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-05;QPKTACTNCYCKKCC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-10;CFTTKGLGISYGRKK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-11;KGLGISYGRKKRRQR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-12;ISYGRKKRRQRRRAP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-13;RKKRRQRRRAPQDSQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-14;RQRRRAPQDSQTHQV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-15;RAPQDSQTHQVSLSK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-16;DSQTHQVSLSKQPAS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-17;HQVSLSKQPASQPRG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-18;LSKQPASQPRGDPTG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-19;PASQPRGDPTGPKES, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-20;PRGDPTGPKESKKKV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-21;PTGPKESKKKVERET, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-22;KESKKKVERETETDP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-23;KKVERETETDPVDQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-6;ACTNCYCKKCCFHCQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-7;CYCKKCCFHCQVCFT, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-8;KCCFHCQVCFTTKGL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CONSENSUS B Tat-9;HCQVCFTTKGLGISY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Contraceptive Tetrapeptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Contryphan, CAS# 183428-21-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coomassie brilliant blue G250, CAS# 6104-58-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coomassie brilliant blue R250, CAS# 6104-59-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copeptin (human), CAS# 78362-34-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copeptin (rat), CAS# 86280-64-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper gluconate, CAS# 527-09-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper Peptide, CAS# 49557-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper Peptide (GHK-Cu), CAS# 49557-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper Peptide / GHK-Cu, CAS# 49557-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper Peptide(GHK-Cu， GHK-Copper), CAS# 49557-75-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper quinolate, CAS# 10380-28-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper tripeptide-1, CAS# 89030-95-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper Tripeptide-1, CAS# 130120-57-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper Tripeptide-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper Tripeptide-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Copper Tripeptide-34 HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coprisin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corazonin， American Cockroach， Periplaneta americana, CAS# 122929-08-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corazonin， American Cockroach， Periplaneta americana;Pyr-TFQYSRGWTN-NH2, CAS# 122929-08-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cordycepin, CAS# 73-03-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corifollitropin alfa, CAS# 195962-23-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortagen AEDP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin, CAS# 103220-14-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin 1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CORTICOSTATIN I, CAS# 113255-28-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin I (rabbit), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin， rabbit, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin-3 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin-4 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin-related peptide LCRP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticostatin-related peptide RK-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticosteron, CAS# 50-22-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin, CAS# 12427-33-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin, CAS# 9002-60-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor (12-41)， cyclic lactam， human， rat， [D-Phe12， Nle21&38， Glu30， Lys33]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor (12-41)， human， rat， [D-Phe12， Nle21&38， C-α-Me-Leu37]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor (12-41)， α-Helical, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor (6-33) Amide， human， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor (9-41)， α -Helical, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor (CRF) and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor， bovine, CAS# 92307-52-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor， CRF， ovine;SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2, CAS# 9015-71-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor， human， rat, CAS# 86784-80-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor， human， rat， [Tyr0]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor， ovine, CAS# 9015-71-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin Releasing Factor， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Corticotropin-like intermediate lobe peptide, CAS# 53917-42-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortisone acetate, CAS# 18357,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin 14 (mouse， rat), CAS# 186901-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin 17， human, CAS# 189450-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin 29, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin 29 (1-13), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin-14 (Mouse， rat) (Des-Ala1，Pro2，Ser12)-SoMatostatin-14-Lys, CAS# 186901-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin-17 (huMan), CAS# 189450-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin-17(Human), CAS# 189450-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin-17， human, CAS# 189450-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin-29 (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin-29 (rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cortistatin-29 (Rat， 1-13), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cosyntropin, CAS# 16960-16-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coumafuryl, CAS# 117-52-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coumarin, CAS# 91-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Coxsackie B3 Virus Epitope, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPA-Ⅲ, CAS# 1914-99-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPA-I, CAS# 85561-96-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPA-mA, CAS# 86167-87-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPA-mN, CAS# 77350-04-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide (1-35)， human， [Tyr0]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide (dog), CAS# 39016-05-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide (huMan) Insulin Precursor (57-87) (huMan), CAS# 33017-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide 1 (rat), CAS# 41475-27-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide 1 (rat) Preproinsulin 1 (57-87) (rat)， Insulin 1 Precursor (57-87) (rat)， Proinsulin 1 (33-63) (rat), CAS# 41475-27-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide 1 (rat)，Proinsulin 1 (33-63) (rat), CAS# 41475-27-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide 2 (rat), CAS# 41594-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide 2 (rat) Proinsulin 2 (33-63) (rat)， Insulin 2 Precursor (57-87) (rat)， Preproinsulin 2 (57-87) (rat), CAS# 41594-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide 2 (rat)，Preproinsulin 2 (57-87) (rat), CAS# 41594-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide and Related Peptides, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide(57-87),Human, CAS# 33017-11-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-peptide， dog;EVEDLQVRDVELAGAPGEGGLQPLALEGALQ, CAS# 39016-05-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Peptide， dogs, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-AM1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-AM4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-B1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-C1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-L1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-L2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-P2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-P3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-P4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-P5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-PG1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-SE1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-SE2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-St4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-St5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-St6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPF-St7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CPK, CAS# 9001-15-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CP-OSu, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cp-thionin II, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CQDSETRTFY, CAS# 94040-53-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CR665 (H-D-Phe-D-Phe-D-Nle-D-Arg-NH-4-Picolyl), CAS# 228546-92-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crabrolin, CAS# 93207-22-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cr-ACP1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRAMP (mouse), CAS# 376364-36-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRAMP-18 (mouse), CAS# 256639-17-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Reactive Protein (CRP) (174-185), CAS# 160369-86-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Reactive Protein (CRP) (174-185) RS-83277, CAS# 160369-86-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Reactive Protein (CRP) (201-206), CAS# 130348-99-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Reactive Protein (CRP) (77-82), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Reactive Protein (CRP) (77-82), CAS# 130349-01-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREATINE CITRATE, CAS# 177024-62-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Creatine ethyl ester hydrochloride, CAS# 15366-32-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Creatine Gluconate, CAS# 306274-45-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREATINE HYDROCHLORIDE, CAS# 17050-09-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREATINE MALATE, CAS# 196-07-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Creatine Monohydrate, CAS# 6020-87-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Creatine Nitrate, CAS# 89695-59-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Creatine phosphate, CAS# 24655,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Creatine phosphate disodium salt, CAS# 922-32-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREATINE PHOSPHATE DISODIUM SALT TETRAHYDRATE, CAS# 71519-72-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREATINEOROTATE, CAS# 768386-56-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Creatininase amidohydrolase, CAS# 9025-13-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Creatinine, CAS# 60-27-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREATINOLO-PHOSPHATE, CAS# 6903-79-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREB2 (91-116)??;ESEDSQESVDSVTDSQKRREILSRRP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREB327 (113 - 126), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREB327 (113-126)??;ILSRRPSYRKILND, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREBtide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREBtide [KRREILSRRPSYR]， 5-FAM labeled;5-FAM-KRREILSRRPSYR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREBtide [KRREILSRRPSYR]， 5-TMR labeled;5-TMR-KRREILSRRPSYR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREBtide [KRREILSRRPSYR]， Biotinylated;Biotin-KRREILSRRPSYR, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREBtide [KRREILSRRPSYR]， Phosphorylated， C-term K;KRREILSRRPS-pY-RK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREBtide [KRREILSRRPSYR]， Phosphorylated， C-term KC;KRREILSRRP-pS-YRKC, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREBtide， FAM-labeled??;5-FAM-GEILSRRPSYRK-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CREBtide??;GEILSRRPSYRK-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crenolanib, CAS# 670220-93-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crenolanib (CP-868596), CAS# 670220-88-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cresol Red, CAS# 1733-12-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cresol Red sodium salt, CAS# 62625-29-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cresyl Violet acetate, CAS# 10510-54-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (12-41)， cyclic lactam， human， rat， [D-Phe12， Nle21&38， Glu30， Lys33]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (12-41)， human， rat， [D-Phe12， Nle21&38， C-α-Me-Leu37]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (12-41)， α-Helical, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (12-41)-[D-Phe12，Nle21，38], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (6-33) (human， rat), CAS# 120066-38-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (9-41)， α-Helical, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (bovine), CAS# 92307-52-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (Human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (human, rat) Acetate, CAS# 86784-80-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (human， rat) Acetate, CAS# 86784-80-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (huMan， rat) CRF-41， CRH， Corticoliberin， Corticorelin, CAS# 86784-80-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (human， rat)，CRF-41， CRH， Corticoliberin， Corticorelin, CAS# 86784-80-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (Human， Rat)-Tyrosyl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (ovine) Acetate 100 μg/vial (Clinalfa basic), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (ovine) Corticorelin (ovine), CAS# 121249-14-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (ovine) Trifluoacetate, CAS# 79804-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (ovine) Trifluoroacetate, CAS# 79804-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF (ovine)，Corticorelin (ovine), CAS# 79804-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF Antagonist [Alpha-Helical CRF(9-41)], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRF(Ovine)Trifluoroacetate, CAS# 79804-71-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRH, CAS# 37340-58-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cripto-1， CR-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cripto-1， CR-1;CPPSFYGRNCEHDVRKE, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRO&CMO, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crosstide [GRPRTSSFAEG]， 5-FAM labeled;5-FAM-GRPRTSSFAEG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crosstide [GRPRTSSFAEG]， 5-TMR labeled;5-TMR-GRPRTSSFAEG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crosstide [GRPRTSSFAEG]， Biotinylated;Biotin-GRPRTSSFAEG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crosstide [GRPRTSSFAEG];GRPRTSSFAEG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crotamiton, CAS# 483-63-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crotonic acid, CAS# 107-93-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crozotinib, CAS# 877399-52-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRS4C-1a, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRS4C-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRS4C-3a, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRS4C-3c, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CRS4C-3d, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crustacean Cardioactive Peptide (CCAP)， amide, CAS# 107090-96-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.