EOS-Peptide-14

EOS med chem is the only manufacturer that provides excellent quality chemistry products and services at affordable rates. The experts working here are highly trained to handle these chemicals used in the creation of medicines used for treating various life-threatening diseases. We are into the manufacturing of chemical products after doing a deep research for the same.

EOS team of experts holds the work experience of more than ten years, and therefore we can assure you about the quality and superiority of the products and services we offer to all our valued clients around the globe. At present, this organization is listed among the most leading pharmaceutical suppliers around the world. We always supply products keeping the affordability in mind.

Crustacean Cardioactive Peptide， CCAP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crustacean Erythrophore Concentrating Hormone, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cryptdin related sequence peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cryptdin-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cryptdin-5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cryptdin-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cryptonin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crystagen(Glu‐Asp‐Pro), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crystal violet, CAS# 548-62-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Crystalline, CAS# 65144-30-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CS1 Peptide, CAS# 107978-77-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CS4 Peptide, CAS# 107978-80-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CS5 Peptide, CAS# 107978-81-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CSF1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CSH 103, CAS# 135546-44-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CSM-ARG (POWDER), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CSM-ARG-URA (POWDER), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CSP, CAS# 7758-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Css54, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CT11-F， FAM labeled??;5-FAM-DLLRCRVLTSG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CTAG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Ct-AMP1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CTAP, CAS# 103429-32-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CTC, CAS# 64-72-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-telopeptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-terminal fragment， LL-37, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-terminal Proghrelin Isoform Peptide， mouse, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-terminal Proghrelin Isoform Peptide， mouse??;RRQLTSNHGQA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Terminally located anterior lobe peptide， lymnaea stagnalis, CAS# 144387-61-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CTFP of Rat Progastrin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CTNNB1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CTOP, CAS# 103429-31-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CTP37 peptide, CAS# 849146-37-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CTT, CAS# 244082-19-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CTX IV (6-12), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Type Natriuretic Peptide (1-22)， human, CAS# 127869-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Type Natriuretic Peptide (1-53) (human), CAS# 141294-77-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Type Natriuretic Peptide (1-53) (huMan) CNP-53 (huMan), CAS# 141294-77-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Type Natriuretic Peptide (1-53) (human)，CNP-53 (human), CAS# 141294-77-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Type Natriuretic Peptide (32-53) (huMan， porcine， rat) CNP-22 (huMan， porcine， rat), CAS# 127869-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Type Natriuretic Peptide (32-53)， human， porcine;GLSKGCFGLKLDRIGSMSGLGC(Disulfidebridge:6-22), CAS# 127869-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Type Natriuretic Peptide， Chicken, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

C-Type Natriuretic Peptide: 1-53， human, CAS# 141294-77-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CUCURBITACIN B, CAS# 6199-67-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cucurmoschin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Culekinin Depolarizing Peptide, CAS# 157536-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Culekinin depolarizing peptide II, CAS# 152846-72-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cullin-7 (1271-1279), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cullin-7 (915-923), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cupiennin-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cupiennin-1b, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cupiennin-1c, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cupiennin-1d*, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Curcumin, CAS# 458-37-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Curdlan, CAS# 54724-00-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Curvalicin-28a, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Curvalicin-28b, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Curvalicin-28c, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Curvaticin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

custom peptide,catalog peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CV-2-Nal-M, CAS# 158022-12-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CXCL5 protein， human, CAS# 136956-40-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cy-AMP1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cy-AMP2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyanazine, CAS# 21725-46-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyanea-RFamide I, CAS# 195208-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyanocobalamin, CAS# 68-19-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyanophlyctin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyanotemozolomide, CAS# 287964-59-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYCLANDELATE, CAS# 456-59-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYCLAZOSIN HYDROCHLORIDE, CAS# 146929-33-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclen, CAS# 294-90-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclic AMP, CAS# 60-92-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclic citrullinated peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclic citrullinated peptide; CCP, CAS# 39577-43-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclic dodecapeptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclic dodecapeptide precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclic GRGDSPA, CAS# 128857-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclic L27-11, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclic(glycyl-L-tyrosyl), CAS# 5845-66-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclin-A1 (271-279), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclin-A1 (385-395), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclin-dependent kinase 4 (924-932), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-d-Phe-Cys), CAS# 1055991-02-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-d-Phe-Lys), CAS# 756500-23-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-d-Tyr-Cys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-Phe-Cys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-Phe-Glu), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-Phe-Lys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-Phe-Val), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-Tyr-Cys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-Tyr-Glu), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-Tyr-Lys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Ala-Asp-Tyr-Val), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-d-Phe-Cys), CAS# 862772-11-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-d-Phe-Glu), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-D-Tyr-Cys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-d-Tyr-Lys(Biotin));c(RGDyK(Biotin));cyclo(RGDYK(Biotin)), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-Phe-Cys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-Phe-Glu), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-Phe-Lys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-Phe-Val), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-Tyr-Cys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-Tyr-Glu), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-Tyr-Lys), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo (Arg-Gly-Asp-Tyr-Val), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo [Arg-Gly-Asp-d-Phe-Lys(Biotin)], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo RGD Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Ala-Ala), CAS# 5845-61-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Ala-Arg-Gly-Asp-3-aminomethylbenzoyl), CAS# 153381-95-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Ala-Gln), CAS# 268221-76-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Ala-Glu), CAS# 16364-36-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Ala-Gly), CAS# 4526-77-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Ala-His), CAS# 54300-25-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Ala-Ser), CAS# 155225-26-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(aminoheptanoic acid-cyclo(cysteinyl-phenylalanyl-D-tryptophyl-lysyl-threonyl-cysteinyl)), CAS# 70706-79-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Ala-Asp-D-Phe-Cys), CAS# 1055991-02-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Ala-Asp-D-Phe-Lys), CAS# 756500-23-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Ala-Asp-D-Phe-Val), CAS# 137813-36-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Ala-Asp-D-Tyr-Lys), CAS# 1193347-53-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Gly-Asp-D-Phe-Cys), CAS# 862772-11-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo(Arg-Gly-Asp-D-Phe-Lys(Mpa)), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Gly-Asp-D-Phe-Lys), CAS# 161552-03-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Gly-Asp-D-Phe-N-Me-Val), CAS# 188968-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Gly-Asp-D-Phe-Val), CAS# 137813-35-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYCLO(ARG-GLY-ASP-D-Tyr-LYS(COCH2CH2SH)), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYCLO(ARG-GLY-ASP-D-Tyr-LYS(COCH2SH)), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYCLO(ARG-GLY-ASP-D-Tyr-LYS(Mpa)), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Gly-Asp-D-Tyr-Lys), CAS# 217099-14-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Arg-Pro), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Asp(OMe)-Asp(OMe)), CAS# 193287-70-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Asp-Asp), CAS# 35309-53-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Asp-Gly), CAS# 52661-97-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Asp-Phe), CAS# 1228222,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(atsptpal), CAS# 135329-52-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Ala-D-Ala), CAS# 23927-13-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(D-Ala-Pro), CAS# 36238-64-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Ala-Pro), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Ala-Val), CAS# 15136-27-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo(delta-Ala-Val), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Glu-Ala-D-allo-Ile-Leu-D-Trp), CAS# 136553-74-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-His-Pro), CAS# 75685-88-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Leu-D-Pro), CAS# 274680-11-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Phe-D-Phe), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Phe-GWAVGHLL), CAS# 143578-65-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Phe-His-Trp-Ala-Val-Gly-His-Leu-Leu), CAS# 143578-65-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Ser-Pro-D-Val-Leu-D-Trp), CAS# 153982-38-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Trp-D-Asp-Pro-D-Val-Leu), CAS# 136553-81-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Trp-Tyr), CAS# 852955-00-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Tyr-Arg-Gly-Asp-Cys(carboxymethyl)-OH), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-D-Tyr-Arg-Gly-Asp-Cys(carboxymethyl)-OH) sulfoxide, CAS# 143120-27-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gln-Gly), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gln-Trp-Phe-Gly-Leu-Met), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Glu-Glu), CAS# 16691-00-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Glu-Gly), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala), CAS# 128857-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Arg-Gly-Glu-Ser-Pro), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Phe- Phe-Asn-Tyr-Tyr-Trp-OH, CAS# 151308-34-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Val-Tyr- Phe-Ala-His-Leu-Asp-Ile-Ile-Trp-OH, CAS# 151308-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp)-Trp-Val-Tyr-Phe-Ala-His-Leu-Asp-Ile-Ile-Trp-OH, CAS# 151308-48-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Gln), CAS# 52662-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Glu), CAS# 16364-35-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Gly), CAS# 4202-74-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-His), CAS# 15266-88-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Phe), CAS# 10125-07-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Pro), CAS# 3705-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Ser), CAS# 52661-98-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Trp), CAS# 7451-73-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Tyr(H2PO3)-Val-Pro-Met-Leu), CAS# 158778-21-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Tyr(PO?H?)-Val-Pro-Met-Leu), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Gly-Tyr(PO3H2)-Val-Pro-Met-Leu), CAS# 158778-21-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-GRGDSP);GRGDSP，NtoCcyclized, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-His-D-Pro), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-His-His), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-His-Phe), CAS# 56586-95-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-His-Pro), CAS# 53109-32-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Hyp-Gly), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Leu-Gly), CAS# 5845-67-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Leu-Leu), CAS# 952-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(Leu-Phe), CAS# 7280-77-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Leu-Phe), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Leu-Pro), CAS# 2873-36-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(Leu-Trp), CAS# 15136-34-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Leu-Trp), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(lysyl-prolyl-glycyl-prolyl-glycyl-glutamyl-prolyl-glycyl-prolyl-glycyl)cyclo(1epsilon-6-gamma)glycine, CAS# 117178-64-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(Met-Met), CAS# 73037-51-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Met-Met), CAS# 73037-51-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Met-Pro), CAS# 53049-06-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Phe-D-Trp), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(phenylalanyl-tryptophyl-lysyl-threonyl-4-(aminomethyl)phenylacetic acid), CAS# 111011-00-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Phe-Phe), CAS# 2862-51-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(Phe-Pro), CAS# 14705-60-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Phe-Pro), CAS# 3705-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Phe-Ser), CAS# 35591-00-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Phe-Trp), CAS# 82597-82-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Phe-Tyr), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Pro-Gly), CAS# 3705-27-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Pro-Gly)3, CAS# 37783-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(Pro-Leu), CAS# 5654-86-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Pro-Thr), CAS# 227777-31-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Pro-Tyr), CAS# 967564,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Pro-Val), CAS# 2854-40-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-RGDfC)， avb3 Integrin Binding Cyclic RGD Peptide, CAS# 862772-11-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(Ser-Ser), CAS# 23409-30-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Ser-Ser), CAS# 23409-30-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Ser-Tyr), CAS# 21754-31-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Trp-D-Trp), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Trp-Trp), CAS# 20829-55-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Trp-Tyr), CAS# 20829-53-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo(Tyr-Ala), CAS# 21754-26-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

cyclo(Tyr-Asp), CAS# 22840-04-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYCLO(TYR-ILE-GLN-ASN-ASU)-PRO-ARG-GLY-NH2, CAS# 35375-13-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Tyr-Leu), CAS# 82863-65-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Tyr-Tyr), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(-Val-Val), CAS# 19943-16-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo(valyl-prolyl-glycyl-valyl-prolyl), CAS# 76911-61-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo[-FLLR-K(Dap)];Cyclo[-FLLR-K(Dap)], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo[Phe-Tyr-Lys(iPr)-D-Arg-2-Nal-Gly-D-Glu]-Lys(iPr)-NH2, CAS# 1088715-84-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo[-RGDfK(Ac-SCH2CO)];Cyclo[-RGDfK(Ac-SCH2CO)], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclobutane-1，2，3，4-tetracarboxylic dianhydride, CAS# 4415-87-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclochlorotine, CAS# 12663-46-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclofenil, CAS# 2624-43-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclohexylacetyl-FRSVQ-NH2, CAS# 113584-01-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2, CAS# 113584-01-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclokallidin, CAS# 75690-91-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclolinopeptide A, CAS# 33302-55-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclolinopeptide B, CAS# 193139-41-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclopenthiazide, CAS# 742-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclopentylglycine, CAS# 933-95-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclopeptide E, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclopeptide F, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclophosphamide monohydrate, CAS# 6055-19-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclopropanecarboxylic acid, CAS# 1759-53-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclopropanesulfonamide, 1-methyl- (9CI), CAS# 669008-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclopropylglycine, CAS# 49607-01-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclopsychotride-A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo-RGDfK, CAS# 161552-03-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo-Somatostatin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclo-Somatostatin, CAS# 84211-54-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclosporin A, CAS# 59865-13-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclosporin B, CAS# 63775-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclosporin C, CAS# 59787-61-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclosporin D, CAS# 63775-96-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclosporin H, CAS# 83602-39-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclosulfamuron, CAS# 136849-15-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclotetrapeptide-24 aminocyclohexane carboxylate, CAS# 197172-76-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclotheonamide A, CAS# 129033-04-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclotide C， partial, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclotide vibi-E, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyclotide vibi-H, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin H2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin H3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin H4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O13, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O14, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O15, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O16, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O17, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O18, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O19, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O20, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O21, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O22, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O23, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O24, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O25, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin O8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin Y1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin Y2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin Y3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin Y4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin Y5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolacin-O2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolin-A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolin-B, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolin-C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloviolin-D, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cycloxydim, CAS# 101205-02-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyfluthrin, CAS# 68359-37-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyhalofop-butyl, CAS# 122008-85-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyhalothrin, CAS# 91465-08-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyhalothrin, CAS# 68085-85-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cymoxanil, CAS# 57966-95-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cypemycin, CAS# 154277-21-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cypermethrin, CAS# 52315-07-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyproconazole, CAS# 94361-06-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyprodinil, CAS# 121552-61-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyproheptadine hydrochloride, CAS# 41354-29-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyproterone acetate, CAS# 427-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyromazine, CAS# 66215-27-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys - TAT (48 - 60), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys(Npys) Antennapedia (43-58) Peptide， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys(Npys) Antennapedia Peptide， amide;C(Npys)-RQIKIWFQNRRMKWKK-NH2, CAS# 220337-24-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys(Npys)-(D-Arg)9, CAS# 1676104-79-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys(Npys)-(D-Arg)9;C(Npys)rrrrrrrrr-NH2, CAS# 1676104-79-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys(NPys)-Antennapedia Homeobox (43-58) amide, CAS# 220337-24-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys(Npys)-TAT (47 - 57), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys(Npys)-TAT (47-57)， FAM-labeled;C(Npys)YGRKKRRQRRR-K(FAM)-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys(Npys)-TAT (47-57);C(Npys)YGRKKRRQRRR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYS7, CAS# 136684-54-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Amyloid Precursor Protein (APP) (751-770), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYS-ASP-PRO-GLY-TYR-ILE-GLY-SER-ARG, CAS# 110590-60-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-beta-Amyloid (1-11), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-beta-Amyloid (1-12), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-beta-Amyloid (12-28), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-beta-Amyloid (12-28);CVHHQKLVFFAEDVGSNK, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-beta-Amyloid (1-40);CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-beta-Amyloid (25-35), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-beta-Amyloid (4-10), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-CD36 (139-155), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Gly-His-Gly-Asn-Lys-Ser-Amyloid -Protein (33-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Gly-His-Gly-Asn-Lys-Ser-Amyloid β-Protein (33-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Gly-Lys-Arg-Amyloid - β Protein (1-42), CAS# 1802086-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42), CAS# 1802086-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (33-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (35-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-GM-CSF (17-31), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Kemptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Laminin A chain (2091-2108), CAS# 123063-31-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cyslized-Boc-Arg(Z)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-Pro-pNA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYS-SER-ARG-ALA-ARG-LYS-GLN-ALA-ALA-SER- ILE-LYS-VA, CAS# 123063-31-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-TAT (47-57);CYGRKKRRQRRR-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cystatin C， N-terminal octapeptide, CAS# 132512-75-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cystatin C， N-terminal tetrapeptide, CAS# 103745-46-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cystatin-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cysteine-rich antifungal protein 1 (Bn-AFP1), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cysteine-rich antifungal protein 1 (Br-AFP1), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cysteine-rich antifungal protein 2 (Bn-AFP2), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cysteine-rich antifungal protein 2 (Br-AFP2), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cysteine-rich protein 2 isoform 2 (133-147), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cysteinyl-glutamyl-asparaginyl-prolyl-serinyl-glutaminyl-phenylalanyl-tyrosyl-glutamyl-aspartyl-leucine, CAS# 98813-21-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cystinyl-aspartyl-prolyl-glycyl-tyrosyl-isoleucyl-glycyl-seryl-arginyl-NH2, CAS# 110590-61-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYS-TYR-ILE-GLN-ASN-CYS-PRO-ARG-GLY-NH2, CAS# 113-80-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYS-TYR-PHE-GLN-ASN-CYS-PRO-ARG (DISULFIDE BRIDGE:CYS1-CYS6), CAS# 37552-33-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-β- Amyloid (1 - 40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cys-β- Amyloid (12 - 28), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytarabine, CAS# 147-94-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytidine, CAS# 65-46-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYTIDINE 5'-DIPHOSPHOCHOLINE, CAS# 987-78-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytidine 5'-monophosphate disodium salt, CAS# 1774143,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytidine-5'-triphosphate disodium salt dihydrate, CAS# 81012-87-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytidine-5'-triphosphoric acid disodium salt, CAS# 18423-42-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytidylic acid, CAS# 63-37-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

CYTISINE, CAS# 485-35-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytochalasin B, CAS# 14930-96-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytochrome C, CAS# 9007-43-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytochrome C (88-104) (domestic pigeon), CAS# 86579-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytochrome p450 1B1 (239-248), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytochrome P450 2D6, CAS# 330597-62-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytochrome P450 2E1, CAS# 330196-93-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytochrome P450 CYP3A4， human;VKRMKESRLEDTQKHRVDFLQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytolysin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytotoxic linear peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytotoxic linear peptide IsCT, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytotoxic linear peptide IsCT precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Cytotoxic linear peptide IsCT2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D(-)-Arginine, CAS# 157-06-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(-)-Arginine hydrochloride, CAS# 627-75-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(-)-Gulonic acid gamma-lactone, CAS# 1615286,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(-)Salicin, CAS# 138-52-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(-)-THREO-2-AMINO-1-(4-NITROPHENYL)-1，3-PROPANEDIOL, CAS# 716-61-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(?)-Arabinose, CAS# 10323-20-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D(+)-2-Amino-1-Butanol, CAS# 5856-62-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D(+)-Arabitol, CAS# 488-82-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(+)-Galacturonic acid, CAS# 91510-62-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(+)-Gluconic acid δ-lactone, CAS# 90-80-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(+)-Melezitose monohydrate, CAS# 10030-67-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(+)-Raffinose pentahydrate, CAS# 17629-30-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-(+)-Trehalose dihydrate, CAS# 6138-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D，D-Carbasomatostatin, CAS# 59983-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D，L-a-Ketoisoleucine Calcium, CAS# 66872-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-1，2，3，4-Tetrahydroisoquinoline-3-carboxylic acid, CAS# 103733-65-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-1，2，3，4-Tetrahydroisoquinoline-3-carboxylic acid-t-butyl ester · HCl, CAS# 103733-29-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-1，2，3，4-Tetrahydronorharman-3-carboxylic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-1，2，3，4-tetrahydronorharmane-3-carboxylic acid, CAS# 72002-54-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-1-N-Boc-prolinamide, CAS# 35150-07-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-(5-Bromothienyl)alanine, CAS# 264903-54-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-(5-Bromothienyl)alanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2，3-Diaminopropionic acid, CAS# 1915-96-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2，3-Diaminopropionic acid hydrochloride, CAS# 6018-56-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2，4，5-Trifluorophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2，4-Diaminobutyric acid, CAS# 26908-94-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2，4-Dichlorophe, CAS# 114872-98-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2，4-Difluorophe, CAS# 266360-60-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2，4-Dinitrophe, CAS# 1217849-53-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D28, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Amino-4-bromo-4-pentenoic acid, CAS# 264903-49-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Amino-5-phenyl-pentanoic acid, CAS# 2046-19-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Aminobutyric acid, CAS# 2623-91-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-aminoheptanedioic acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Aminomethylphe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Aminoundecanoic acid, CAS# 35237-36-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Bromophe, CAS# 267225-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Bromophenylalanine, CAS# 267225-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Carbamoylphe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Chloro-4-fluorophe, CAS# 1212966-63-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Chlorophe, CAS# 80126-50-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Cyanophe, CAS# 263396-41-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Fluoro-4-chlorophe, CAS# 947615-61-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Fluorophe, CAS# 97731-02-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Fluorophenylalanine, CAS# 97731-02-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Furylalanine, CAS# 110772-46-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Hydroxy-5-nitro-Phenylalanine, CAS# 1241677-95-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Hydroxykynurenine, CAS# 1858273-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Hydroxypentanedioic acido2Na+, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Indanylglycine, CAS# 181227-46-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Iodotyrosine, CAS# 1241675-93-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Methyl-4-fluorophe, CAS# 1213186-81-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Methylphe, CAS# 80126-54-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Methylserine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Nitrophe, CAS# 169383-17-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Pal-OH·2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Thienylalanine, CAS# 62561-76-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-2-Trifluoromethylphe, CAS# 130930-49-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-(2-Naphthyl)-alanine, CAS# 76985-09-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-(2-Pyridyl)-alanine, CAS# 37535-52-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-(3-Benzoburanyl)-alanine, CAS# 793717-08-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-(3-Pyridyl)-alanine, CAS# 70702-47-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3，3-Diphenylalanine, CAS# 149597-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3，4-Difluorophenylalanine, CAS# 249649-08-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Aminobutyric acid, CAS# 3775-73-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Aminomethylphe, CAS# 1217607-94-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Benzothienylalanine., CAS# 111139-55-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Bromophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Carbamoylphe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Cyanophe, CAS# 263396-43-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Fluorophenylalanine, CAS# 110117-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Methylphe, CAS# 114926-39-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Nitrophe, CAS# 169530-97-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Nitrophenylalanine, CAS# 169530-97-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Pal-OH·2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Thienylalanine, CAS# 152612-26-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Thiolisoleucine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Thiolnorvaline, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-3-Trifluoromethylphe, CAS# 82317-79-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4，4'-Biphenylalanine, CAS# 170080-13-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4，4'-Biphenylphenylalanine, CAS# 170080-13-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Acetamidophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Acetylphe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Aminomethylphe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Aminophe, CAS# 102281-45-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Benzoylphenylalanine, CAS# 201466-03-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Bromophenylalanine, CAS# 62561-74-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Br-Phe-OH.HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Carbamoylphe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Chlorophenylalanine, CAS# 14091-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Cyanophe, CAS# 263396-44-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Cyanophenylalanine, CAS# 263396-44-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4F peptide, CAS# 595579-88-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Fluorophenylglycine, CAS# 93939-74-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Hydroxyphenylglycine, CAS# 22818-40-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Hydroxyphenylglycine methyl ester HCl, CAS# 57591-61-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Iodophenylalanine, CAS# 62561-75-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Methoxyphenylglycine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Pal-OH·2HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Pyridylalanine, CAS# 37535-50-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-tert-butyl-Phe, CAS# 274262-82-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Thiazolylalanine, CAS# 131896-42-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-4-Trifluoromethylphe, CAS# 114872-99-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-7-Hydroxy-Tic, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-9-AnthrylaAlanine, CAS# 135092-49-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DA-6, CAS# 10369-83-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-AAAA, CAS# 926-78-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-AAAAA, CAS# 10491-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-AAAAAA, CAS# 286842-36-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-AAO, CAS# 9000-88-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAB, CAS# 91-95-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAB, CAS# 868272-85-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAB, CAS# 167684-17-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAB, CAS# 7411-49-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-(Asn670，Leu671)-Amyloid β/A4 Protein Precursor770 (661-675)-EDANS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-(Asn670，Leu671)-Amyloid β/A4 Protein Precursor770 (667-675)-EDANS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-(Asn670，Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-EDANS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-(Nle1077)-Collagen Type III α1 chain (1070-1077)-EDANS (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-Arg-Gly-Val-Val-Asn-Ala-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-Asn670，Leu671-Amyloid b/A4 Protein Precursor770: 661-675-EDANS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-Asn670，Leu671-Amyloid b/A4 Protein Precursor770: 667-675-EDANS, CAS# 1802078-36-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-Asn670，Leu671-Amyloid β/A4 Protein Precursor770: 669-674-EDANS, CAS# 1802078-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-beta-Amyloid (11-22)-EDANS;DABCYL-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-EDANS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-GAMMA-ABU-SER-GLN-ASN-TYR-PRO-ILE-VAL-GLN-EDANS, CAS# 127134-13-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-GLU-ARG-NLE-PHE-LEU-SER-PHE-PRO-EDANS, CAS# 263718-22-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-KTEEISEVNLDAEF-EDANS;DABCYL-KTEEISEVNLDAEF-EDANS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS, CAS# 730985-86-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-TNF-α-EDANS (-4 to +6) (human), CAS# 396716-14-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-Tyr-Val-Ala-Asp-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-y-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-YVADAPV-EDANS, CAS# 161877-70-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-γ-Abu-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Glu(EDANS)-Ala-Lys-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-γ-Abu-IHPFHLVIHT-EDANS, CAS# 142988-22-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-γ-Abu-PQGL-Glu(EDANS)-AK-NH2, CAS# 193475-71-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-γ-Abu-Pro-Gln-Gly-Leu-Glu(EDANS)-Ala-Lys-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-γ-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DABCYL-γ-Abu-SQNYPIVQ-EDANS, CAS# 127134-13-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dabigatran, CAS# 211914-51-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dabigatran etexilate, CAS# 211915-06-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dabigatran etexilate mesylate, CAS# 872728-81-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dabrafenib (GSK2118436), CAS# 1195765-45-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dabrafenib Mesylate(GSK-2118436B), CAS# 1195768-06-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Abu-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Abu-OtBu·HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dacarbazine, CAS# 891986,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Daclatasvir, CAS# 1009119-64-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Daclatasvir, CAS# 1009119-83-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Daclatasvir (BMS-790052), CAS# 1214735-16-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dacomitinib, CAS# 1110813-31-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAGO, CAS# 78123-71-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAHK, CAS# 111543-77-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein 4.1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein 4.2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein 4.3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein 5.1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein 5.2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein 5.3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein 5.4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein 5.5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein 5.6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein-1.1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dahlein-1.2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dak 16, CAS# 9050-15-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dakh peptide, CAS# 129204-82-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAKLI, CAS# 118428-10-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 38.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Ala-AA, CAS# 5874-89-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Ala-D-Ala, CAS# 923-16-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Ala-D-β-Nal-Ala-Trp-D-Phe-Lys-NH2, CAS# 158861-67-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Ala-Gly-Phe-Met-NH2, CAS# 100929-65-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Ala-Leu, CAS# 67113-60-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Alanine, CAS# 338-69-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Alanine Methyl Ester Hydrochloride, CAS# 14316-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Alaninol, CAS# 35320-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dalantercept, CAS# 1186210-24-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Ala-ol, CAS# 35320-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DALARGIN, CAS# 81733-79-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DALARGIN Enkephalin-Arg [D-Ala2]-Leu, CAS# 81733-79-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dalargin，(D-Ala2)-Leu-Enkephalin-Arg;H-Tyr-D-Ala-Gly-Phe-Leu-Arg-OH, CAS# 81733-79-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dalbavancin, CAS# 171500-79-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-allethrin, CAS# 28434-00-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-allo-Ile, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Allo-Ile-Ol, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-allo-isoleucine, CAS# 1509-35-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-allo-Threonine, CAS# 24830-94-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Allylglycine, CAS# 108412-04-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Allylglycine, CAS# 54594-06-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Allylglycine, CAS# 1069-48-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Allylglycine hydrochloride, CAS# 108412-04-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-alpha-Hydroxyisocaproic acid, CAS# 20312-37-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-alpha-Hydroxyisovaleric acid, CAS# 17407-56-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Daminozide, CAS# 1596-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAMME, CAS# 64854-64-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dansyl-Ala-Arg-OH, CAS# 87687-46-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dansyl-D-Ala-Gly-4-nitro-Phe-Gly-OH, CAS# 83960-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dansyl-Glu-Gly-Arg-chloromethylketone, CAS# 69024-84-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dansyl-Gly-Cys-Val-Leu-Ser-OH, CAS# 143744-88-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

dansyl-Lys(Ac)-D-Ala-D-Ala, CAS# 111290-37-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dansyl-Y-V-G, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dantrolene sodium salt, CAS# 14663-23-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAOS, CAS# 83777-30-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAP10 Signaling Fragment, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAP10 Signaling Fragment;PAQEDGKVYINMPGRG, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAPAGLIFLOZIN, CAS# 461432-26-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAPI, CAS# 28718-90-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dapiclermin, CAS# 444069-80-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAPK Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAPK2 protein (1-9), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAPM, CAS# 208255-51-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dapoxetine hydrochloride, CAS# 119356-77-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dapoxetine hydrochloride, CAS# 129938-20-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAPSONE, CAS# 80-08-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DAPT, CAS# 208255-80-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Daptomycin, CAS# 103060-53-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Darbufelone, CAS# 139226-28-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-ARG-[HYP3，THI5，8， D-PHE7--BRADYKININ, CAS# 103412-42-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Arg9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Arginine, CAS# 157-06-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Darifenacin, CAS# 133099-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Darifenacin Hydrobromide, CAS# 133099-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Darifenacin Hydrobromide, CAS# 133099-07-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Darunavir, CAS# 206361-99-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Darunavir ethanolate, CAS# 635728-49-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dasatinib, CAS# 302962-49-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dasatinib monohydrate, CAS# 863127-77-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Asparagine Monohydrate, CAS# 2058-58-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Aspartic Acid, CAS# 1783-96-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Aspartic acid dimethyl ester hydrochloride, CAS# 69630-50-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Aspartic acid α-amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Datucin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Daunchinain-B1 antimicrobial peptide precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Daunchinain-D1 antimicrobial peptide precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Daunorubicin, CAS# 20830-81-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Daunorubicin hydrochloride, CAS# 23541-50-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Davunetide, CAS# 211439-12-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-azetidine-2-carboxylic acid, CAS# 7729-30-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dazomet, CAS# 533-74-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DBI;diazepam binding inhibitor human, CAS# 95237-86-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Biotin, CAS# 58-85-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Biotin-OSu, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DBU, CAS# 6674-22-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dby HY Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Camphorsulfonic acid, CAS# 3144-16-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DCC, CAS# 538-75-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DCC-2036 (Rebastinib), CAS# 1020172-07-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-cellbiose, CAS# 528-50-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cha-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cit-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Citrulline, CAS# 13594-51-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cyclobutylalanine, CAS# 174266-00-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cyclobutylglycine, CAS# 49607-10-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cyclohexylalanine, CAS# 58717-02-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cyclohexylglycine, CAS# 14328-52-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cyclohexylglycine hydrochloride, CAS# 61367-40-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cyclopentylalanine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cyclopentylglycine, CAS# 2521-86-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cyclopropylalanine, CAS# 121786-39-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cyclopropylglycine, CAS# 49607-01-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cycloserine, CAS# 68-41-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cycoloserine, CAS# 68-41-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-cyphenothrin, CAS# 39515-40-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cysteine, CAS# 921-01-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-CYSTEINE HYDROCHLORIDE, CAS# 207121-46-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cysteine hydrochloride monohydrate, CAS# 32443-99-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Cystine, CAS# 349-46-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Dab.2HCl, CAS# 26908-94-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DDAVP ACETATE, CAS# 16789-98-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-D-D-D-D, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-D-D-D-D-D, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-D-Dab(Aloc)-OH, CAS# 1263046-79-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-D-Dab(Fmoc)-OH, CAS# 1263046-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-D-Dap(Fmoc)-OH, CAS# 1263046-87-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-D-Lys(Fmoc)-OH, CAS# 1301706-71-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-L-Dab(Fmoc)-OH, CAS# 1263045-85-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-L-Dap(Aloc)-OH, CAS# 1263045-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-L-Dap(Fmoc)-OH, CAS# 1263046-98-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-L-Lys(Aloc)-OH*DCHA, CAS# 264230-73-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-Lys(Dde)-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dde-Lys(Fmoc)-OH, CAS# 156648-40-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-DiPhenylalanine, CAS# 149597-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DDM, CAS# 69227-93-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-dopachrome decarboxylase (89-97), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEAD (Asp-Glu-Ala-Asp) box polypeptide 53 (502-513), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEAD/H box polypeptide 11 like 12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deamino-histidine, CAS# 1074-59-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Death Associated Protein Kinase， (DAPK)， Substrate, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Death-inducer obliterator 1 (941-951), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decahydroquinoline, CAS# 2051-28-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decanoyl-Arg-Arg-Leu-Leu-chloromethylketone, CAS# 911379-57-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decanoyl-Arg-Val-Arg-Lys-chloromethylketone, CAS# 534615-50-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decanoyl-Arg-Val-Lys-Arg-chloromethylketone, CAS# 150113-99-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-11, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-12, CAS# 137665-91-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-12, Lumixyl, CAS# 137665-91-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-12/ Lumixyl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-13, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-14, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-15, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-16, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-17, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-18, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-19, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-20, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-21, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-22, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-23, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-24, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-25, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-26, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-27, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-28, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-29, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-30, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-31, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-32, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decapeptide-9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decetaxel anhydrous, CAS# 114977-28-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decitabine, CAS# 2353-33-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DECLOXIZIN HYDROCHLORIDE, CAS# 3733-63-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decoquinate, CAS# 18507-89-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decoralin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decorinyl/Tripeptide-10 citrulline, CAS# 960531-53-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decorsin ，Leech, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decorsin， Leech, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decursinol, CAS# 23458-02-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decyl-β-D-1-thioglucopyranoside, CAS# 98854-16-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 100g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Decyl-β-D-glucopyranoside, CAS# 58846-77-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEFA1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Def-Aaa From The Insect Anopheles Gambiae, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Def-Acaa, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEFB30, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Def-Bat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Def-Bbb, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Def-Daa, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defense protein 4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defense protein 6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin (human) HNP-2, CAS# 99287-07-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin 2-2， partial, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin 2a, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin 4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin ARD1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin D, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin D1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin D5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin D6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin D7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin HNP-2 (huMan) HuMan Neutrophil Peptide-2， HNP-2, CAS# 120721-97-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin HNP-2 (human)，Human Neutrophil Peptide-2， HNP-2, CAS# 120721-97-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin HNP-3 (human), CAS# 136661-76-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin HNP-3 (huMan) HuMan Neutrophil Peptide-3， HNP-3, CAS# 136661-76-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin HNP-3 (human)，Human Neutrophil Peptide-3， HNP-3, CAS# 136661-76-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin MGD-1 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin NP-1 - rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

defensin protein， Aeshna cyanea, CAS# 144855-46-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin related cryptdin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin Tk-AMP-D3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin Tk-AMP-D4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin， beta 107A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin， isoforms B, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-1 (human) HNP-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-1 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-A, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-A1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-A2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-A3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-A4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-B, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-B1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-B2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-B3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-B5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-C, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-like peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-like protein 10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-NV, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin 16 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin 2 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin 3 precursor, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin 4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-11, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-13, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-14, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-15, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-17, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-20, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-21, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-22, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-23, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-24, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-25, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-26, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-related sequence 12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-related sequence 2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-related cryptdin-related sequence 7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defensin-relatedcryptdin-10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deferasirox, CAS# 201530-41-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEFERIDONE, CAS# 30652-11-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEFEROXAMINE MESYLATE, CAS# 138-14-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defibrase, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deflazacort, CAS# 14484-47-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEFLAZACORT, CAS# 13649-88-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Defr1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Degarelix, CAS# 214766-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Degarelix acetate, CAS# 214766-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Degarelix; Degarelix Acetate, CAS# 214766-78-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dehydrocholic acid, CAS# 81-23-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dehydroepiandrosterone, CAS# 53-43-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dehydroepiandrosterone enanthate, CAS# 23983-43-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dehydronandrolon, CAS# 2590-41-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

dek-can?fusion protein (342-357), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delicious Peptide, CAS# 73984-05-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delimotecan, CAS# 187852-63-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

delmadinone acetate, CAS# 13698-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delorazepam, CAS# 2894-67-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delta (Phospho) Sleep Inducing Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delta Sleep Inducing Peptide, CAS# 62568-57-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delta Sleep-Inducing Peptide, CAS# 69431-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

delta Sleep-inducing peptide phosphate, CAS# 70754-23-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

delta Sleep-inducing peptide， isoasp(5)-, CAS# 82602-88-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

delta Sleep-inducing peptide， N-tyr-, CAS# 65908-45-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

delta Sleep-inducing peptide， trp(1)-, CAS# 77739-16-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delta: Phospho Sleep Inducing Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

delta-Aminovaleryl-(Pro9，N-Me-Leu10)-Substance P (7-11), CAS# 133156-06-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delta-lysin I, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 17.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delta-MSH, CAS# 100930-04-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Delta-Sleep Inducing Peptide DSIP, CAS# 62568-57-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

delta-Sleep-inducing peptide (1-6), CAS# 103122-89-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

delta-Sleep-inducing peptide amine， ala(4)-, CAS# 65908-44-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

delta-Sleep-inducing peptide， cyclo-gly-, CAS# 85758-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deltorphin, CAS# 119975-64-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deltorphin Deltorphin A， DerMenkephalin， DerMorphin Gene-Associated Peptide (DGAP), CAS# 119975-64-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deltorphin I, CAS# 122752-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deltorphin I - [DAla2], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deltorphin I Deltorphin C, CAS# 122752-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deltorphin II, CAS# 122752-16-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deltorphin II Deltorphin B, CAS# 122752-16-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Demeclocycline hydrochloride, CAS# 64-73-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Demeton-s-Methyl?sulphone, CAS# 17040-19-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Demidefensin-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Denatonium benzoate, CAS# 3734-33-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Denatonium saccharide, CAS# 90823-38-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dendroaspis Natriuretic Peptide, CAS# 255721-52-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dendroaspis natriuretic peptide, CAS# 143863-92-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dendroaspis Natriuretic Peptide DNP, CAS# 255721-52-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dendrocin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dengue Virus Type 4 NS3 Protein (500-508), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DENOPAMINE, CAS# 71771-90-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deoxyarbutin, CAS# 53936-56-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deoxycholic acid, CAS# 83-44-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deoxycorticosterone acetate, CAS# 56-47-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deoxymulundocandin, CAS# 138626-63-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deoxyribonucleic acid (honeybee clone mcd-1 mast cell degranulating peptide messenger RNA-complementary plus 5'-and 3'-flanking region fragment), CAS# 168257-20-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEPBT, CAS# 165534-43-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Depelestat, CAS# 506433-25-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Depofemin, CAS# 313-06-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Depreotide, CAS# 161982-62-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deracoxib, CAS# 169590-41-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermadistinctin-L, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermadistinctin-M, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermadistinctin-Q1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermadistinctin-Q2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin, CAS# 136033-70-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin - H3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin AA-2-5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin AA-3-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin AA-3-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin AA-3-4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin AA-3-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin B1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin B2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin DA4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin DRG1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin DRG2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin DRS-DI4-like peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin DS VIII-like peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin H4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin III-like peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin PD-2-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin PD-3-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin PD-3-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin PD-3-7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-01, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 83.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DermaseptinAA-1-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-B3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-B4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-B5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-B6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-B8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-C3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-H15, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-H2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-H5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J10, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J5, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-J9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-L1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-LI1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-like PBN2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-like peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-like precursor DRP-AC-1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-like precursor DRP-AC-2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-like precursor DRP-AC-3, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 94.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-S11, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-S12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-S13, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-S6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-S7, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-S8, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermaseptin-S9, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermatoxin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermatoxin A1, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermenkephalin, CAS# 119975-64-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermorphin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermorphin, CAS# 77614-16-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dermorphin Analog, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-erythro-3-hydroxyglutamic acid, CAS# 6208-99-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-erythro-4-hydroxyglutamic acid, CAS# 6148-21-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Erythro-Sphingosine Hydrochloride, CAS# 19316-52-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Erythruronolactone acetonide, CAS# 85254-46-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Des His1， Glu8 Exendin-4, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Des[Gln18，Ser19，Gly20，22，Leu21] ANP (4-23)， amide， rat, CAS# 111863-73-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desamido-neuropeptide Y, CAS# 101994-11-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desaminopancreozymin octapeptide, CAS# 67436-51-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desaminotyrosylfibrinopeptide A, CAS# 83437-30-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deserpidine, CAS# 131-01-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desirudin, CAS# 120993-53-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desloratadine, CAS# 100643-71-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deslorelin, CAS# 57773-65-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deslorelin Acetate, CAS# 57773-65-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deslorelin Acetate, CAS# 57773-65-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deslorelin; Deslorelin Acetate, CAS# 57773-65-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 58.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deslorenlin, CAS# 57773-65-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Deslorenlin, CAS# 57773-65-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desmedipham, CAS# 13684-56-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desmethyl Erlotinib, CAS# 183320-51-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desmopressin, CAS# Desmopressin,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desmopressin, CAS# 16789-98-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desmopressin, CAS# 16679-58-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DesMopressin Acetate, CAS# 16789-98-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desmopressin Acetate, CAS# 16679-58-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desmopressin Acetate, CAS# 62288-83-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desmopressin Acetate impurity, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desonide, CAS# 638-94-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desoximetasone, CAS# 382-67-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Destomycin, CAS# 14918-35-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Desvenlafaxine succinate, CAS# 386750-22-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dexamethasone, CAS# 18296,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dexamethasone 21-phosphate disodium salt, CAS# 2392-39-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dexamethasone palmitate, CAS# 14899-36-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dexamethasone sodium phosphate, CAS# 55203-24-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dexamethasone-17-acetate, CAS# 1177-87-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dexamethasonevalerate, CAS# 33755-46-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEXIBUPROFEN, CAS# 51146-56-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dexketoprofen trometamol, CAS# 156604-79-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DEXMEDETOMIDINE HCL, CAS# 145108-58-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dexrazoxane, CAS# 24584-09-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dexrazoxane hydrochloride, CAS# 149003-01-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dextran, CAS# 9004-54-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dextrin, CAS# 9004-53-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dextromethorphan Hydrobromide, CAS# 125-69-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dextromethorphan hydrobromide monohydrate, CAS# 6700-34-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dextronatrin, CAS# 114752-42-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DF-2, CAS# 13433-09-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DF-2-NH2, CAS# 5241-71-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Fructose, CAS# 57-48-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-fructose 1，6-bis(dihydrogen phosphate), CAS# 488-69-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Galactosamine HC1, CAS# 1772-03-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Galactose, CAS# 59-23-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-GlcNAc, CAS# 7512-17-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Gln-OH, CAS# 5959-95-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Glu.2OMe.HCl, CAS# 27025-25-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Glucosamine HC1, CAS# 66-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Glucose anhydrous, CAS# 50-99-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Glucose monohydrate, CAS# 14431-43-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Glucurone, CAS# 32449-92-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Glucuronic acid, CAS# 1700908,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Glutamic acid, CAS# 6893-26-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Glutamic acid α-amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-GlutaMic acid γ-benzyl ester, CAS# 2578-33-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Glutamine, CAS# 5959-95-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DHA, CAS# 520-45-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Histidine, CAS# 351-50-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Histidine methyl ester dihydrochloride, CAS# 4467-54-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Histidine monohydrochloride monohydrate, CAS# 6341-24-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Homocysteine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-Homocysteine thiolactone.HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-HomoPhenylalanine, CAS# 82795-51-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

D-HomoPhe-OH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DHP HM Resin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DHP Linker, CAS# 3749-36-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Diabetes-associated Peptide (DAP) Amide， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Diacetonefructose, CAS# 20880-92-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 65.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Diafenthiuron, CAS# 80060-09-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DIALIFOS, CAS# 10311-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DIAMINE OXIDASE, CAS# 9001-53-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Diaminopropionoyl Tripeptide-33, CAS# 1199495-15-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Diammonium glycyrrhizinate, CAS# 79165-06-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dianexin, CAS# 1352413-49-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Diaphorase, CAS# 9001-18-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Diazepam-Binding Inhibitor Fragment， human, CAS# 104360-70-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 86.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dibekacin sulfate, CAS# 58580-55-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dibenzoyl-L-tartaric acid, CAS# 2743-38-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

DIBOC，BOC, CAS# 24424-99-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Dibucaine hydrochloride, CAS# 22616,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.