EOS-Peptide-33

EOS Med Chem is one of TOP Med-chemical company, special in FDA 2015-2018 new API and Intermediates commercial & GMP production.

Use EOS Med Chem GMP & ISO plant, custom synthesis your need chemicals.

All Intermediates we could supply CMC & DMF OPEN list. Form change, Impurity research, Change route, Improve purity.

Welcome to Site Audit.

2018, EOS Med Chem got China TOP100 New Drug Manu.

Z-β-Ala-OH, CAS# 2304-94-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

Z-β-Ala-Val-OH, CAS# 14550-79-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α - CGRP-[Tyr0] ， [Tyr0] - α -CGRP， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α - CGRP-[Tyr0] ， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α- Bag Cell Peptide (1 - 8), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α Bag Cell Peptide (1-9), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α2β1 Integrin Recognition Sequence, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α3β1 Integrin Peptide Fragment (325)， amide;PRHRHMGAVFLLSQEAG-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 88.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Amylase from Aspergillus oryzae, CAS# 9001-19-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-ANF(1-28)， human, CAS# 91917-63-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-ANF(1-28)， human, CAS# 89213-87-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Bag Cell Peptide (1 - 7), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Bag Cell Peptide (1 - 9), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Bag Cell Peptide (1-7);APRLRFY, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Bag Cell Peptide (1-8);APRLRFYS, CAS# 87549-53-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Bag Cell Peptide (1-9);APRLRFYSL, CAS# 87549-52-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Calcitonin Gene Related Peptide， α-CGRP， rat;SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2(Disulfidebridge:2-7), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Casein (90-95), CAS# 83471-50-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Casein (90-96), CAS# 83471-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Casomorphin (1-2), CAS# 51871-47-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (19 - 37)， human, CAS# 101233-12-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 49.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (19-37) (huMan), CAS# 101233-12-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (19-37)， human;SGGVVKNNFVPTNVGSKAF-NH2, CAS# 101233-12-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (23-37) (human), CAS# 145459-33-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (29-37) (canine， mouse， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (29-37) (canine， Mouse， rat), CAS# 219991-19-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (29-37) (canine，mouse， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (30-37) (canine， mouse， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (30-37) (canine， Mouse， rat), CAS# 132917-49-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (31-37) (canine， mouse， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (31-37) (canine， mouse， rat), CAS# 110953-70-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (32-37) (canine， mouse， porcine， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (32-37) (canine， mouse， porcine， rat), CAS# 132917-48-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (32-37) (canine，mouse， porcine， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (33-37) (canine， mouse， porcine， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (33-37) (canine， mouse， porcine， rat), CAS# 132917-50-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (33-37) (canine，mouse， porcine， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (8-37) (canine， mouse， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (8-37) (canine， Mouse， rat) Calcitonin Gene-Related Peptide I (8-37) (canine， Mouse， rat)， CGRP-I (8-37) (canine， Mouse， rat), CAS# 129121-73-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (8-37) (huMan) Calcitonin Gene-Related Peptide I (8-37) (huMan)， CGRP-I (8-37) (huMan), CAS# 119911-68-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (canine， mouse， rat), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 76.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (canine， Mouse， rat), CAS# 83651-90-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-CGRP (huMan) CGRP-I (huMan), CAS# 90954-53-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Conotoxin EI, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Conotoxin GI, CAS# 76862-65-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Conotoxin GS, CAS# 115757-31-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Conotoxin IMI, CAS# 156467-85-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Conotoxin MI, CAS# 83481-45-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Conotoxin SI, CAS# 115797-06-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Conotoxin SIA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-cyclodextrin, CAS# 10016-20-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Defensin 6, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Defensin-1， human, CAS# 99287-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Dendrotoxin, CAS# 74811-93-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-D-Lactose monohydrate, CAS# 5989-81-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Endorphin / β-Lipotropin (61-76), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Galactosidase preparation from green coffee beans, CAS# 9025-35-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 75.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Gliadin (57–73), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Glucosidase, CAS# 9001-42-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Glycerophosphate dehydrogenase, CAS# 9075-65-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Helical CRF (12-41), CAS# 158535-55-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Helical CRF (9-41), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Helical CRF (9-41), CAS# 99658-03-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Mating Factor (1-6), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Mating Factor;WHWLQLKPGQPMY, CAS# 59401-28-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Melanocyte Stimulating Hormone (11-13)(MSHa), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 99.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Melanocyte Stimulating Hormone [Acetyl-D-Lys11， D-Val13] (11-13) (MSHa), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Melanocyte Stimulating Hormone [Met5， Pro6， D-Phe7， D-Trp9， Phe10] (5-13) (MSHa), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Melanocyte Stimulating Hormone [Met5， Pro6， D-Phe7，D-Trp9， Phe10] (5-13) (MSHa), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Melanocyte Stimulating Hormone， acetylated-[D-Val13] (11-13) (MSHa), CAS# 137359-89-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Melanocyte Stimulating Hormone， acetylated-[D-Val13](11-13) (MSHa), CAS# 137359-89-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Melanocyte StimulatingHormone [Acetyl-D-Lys11， DVal13] (11-13) (MSHa), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Melanotropin (human), CAS# 581-05-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Melanotropin (human) Acetate, CAS# 581-05-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-methyl-D-4-Fluorophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-methyl-D-Allylglycine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-methyl-D-Lysine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-methyl-D-Phe, CAS# 17350-84-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Methyl-D-phenylalanine, CAS# 17350-84-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-methyl-D-Propargylglycine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-methyl-L-4-Fluorophe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-methyl-L-Allylglycine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-methyl-L-Phe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-methyl-L-Propargylglycine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Methyl-L-tyrosine, CAS# 672-87-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH, CAS# 581-05-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH, CAS# 16182-15-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH (11-13), CAS# 125905-17-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 50.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH (11-13), CAS# 347870-98-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH (11-13) (free acid), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH (11-13) (free acid), CAS# 67727-97-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH (11-13) . 2 HCl, CAS# 347870-98-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH (11-13) · 2 HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH (free acid), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH (free acid)， Acetyl-ACTH (1-13), CAS# 10466-28-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 96g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH (PT-141), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH， amide;Ac-SYSMEHFRWGKPV-NH2, CAS# 9061-59-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH， Free Acid, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH-[Des-Acetyl], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-MSH-[Nle4， D-Phe7], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Naphtholbenzein, CAS# 145-50-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Neo-Endorphin (1-7), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Neoendorphin (1-8), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Neo-Endorphin (1-8)-[Arg8], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Neo-Endorphin Analog, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Neo-Endorphin， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

α-Substance IB, CAS# 60407-48-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (11-22), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (1-16), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (1-33), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (1-34), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (1-37), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 3.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (1-38), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (16-23), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (2-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (37- 43), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (4-10), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid (8-38), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- Amyloid Protein Precursor 770 (135 - 155), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β I probe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β II probe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β III probe, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β- MSH， porcine, CAS# 19941-13-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Alanine, CAS# 107-95-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Alanine ethyl ester HC1, CAS# 4244-84-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Alanine methyl ester hydrochloride, CAS# 3196-73-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amylase, CAS# 9000-91-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (10-20), CAS# 152286-31-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (10-35), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 42.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (11- 40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-11), CAS# 190436-05-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-14) ， mouse， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-15), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (12-20), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (12-28), CAS# 107015-83-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (12-28) – Cys, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-28), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (13-27), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-39), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-40), CAS# 131438-79-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-40)， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-40)， Ultra Pure， TFA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-40);UltraPure TFA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-42)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-42),human, CAS# 107761-42-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (1-49), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (15-21), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (16-20), CAS# 153247-40-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (16-26), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (17-21), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (17-40), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (17-42), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (18-28), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (22-35), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (25-35), CAS# 131602-53-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (30-16), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (31-35), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (32-35), CAS# 151151-30-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (35-25), CAS# 147740-73-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid (7-22), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 82.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid / A4 Protein Precusor (APP) (319-335), CAS# 148914-01-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid P Component (27 - 38)， amide, CAS# 180387-75-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid Peptide (1-42)， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid Precursor Protein (732-751), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid Protein Precursor (657 - 676), CAS# 158561-91-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid(1-16)， mouse， rat, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 92.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid(40-1), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 9.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid/A4 Protein Precursor (APP) (328 - 332), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid/A4 Protein Precursor (APP) (96-110)， analog, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid/A4 Protein Precursor 770 (394 - 410), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 41.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid/A4 Protein Precusor (APP) (319-335), CAS# 148914-01-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid: 1-40， amide?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid: 1-40， rat?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid: 1-42,human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid: 1-42，human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid: 1-43?, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid: 17-28, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Amyloid: 33-42, CAS# 178949-81-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Aspartame, CAS# 22839-47-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 51.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Aspartame， H-β-Asp-Phe-Ome, CAS# 22839-61-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-carotene, CAS# 7235-40-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casein (90-96), CAS# 83471-49-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-2), CAS# 51871-47-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-2) amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-2) amide, CAS# 145118-98-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 35.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-3), CAS# 72122-59-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-3) amide, CAS# 80705-23-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-3)amide-[D-Ala2], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-4) (bovine), CAS# 74171-19-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-4) amide (bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-4) amide (bovine)，Morphiceptin, CAS# 74135-04-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 69.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-4) amide (bovine)-[D-Ala2], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-4) amide (bovine)-[Val3], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-4)， amide (bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5) (bovine), CAS# 72122-63-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5) ， bovine ，amide-[D-Ala2，Met5]-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5) ，bovine， amide-[D-Pro2], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 43.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5) ，bovine-[D-Pro2], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5) amide (bovine), CAS# 83936-21-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5) amide (bovine)-[D-Ala2], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 39.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5) amide-[D-Ala2，Hyp4，Tyr5], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5)， amide，bovine-[D-Ala2，4，Tyr5], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 78.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5)， amide-[D-Ala2，DPro4，Tyr5], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5)， bovine-[D-Ala2，Met5], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-5)， bovine-[D-Ala2], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 10.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-6) (bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-6) (bovine), CAS# 77434-43-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-6)， bovine;YPFPGP, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-6)， bovine-[D-Ala2], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 87.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-7)， bovine;YPFPGPI, CAS# 72122-62-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin (1-7)， human;YPFVEPI, CAS# 102029-74-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 8.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-CasoMorphin (bovine), CAS# 72122-62-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-CasoMorphin (huMan), CAS# 102029-74-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin， bovine, CAS# 72122-62-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin， human, CAS# 102029-74-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin-5 (Bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 20.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Casomorphin-7 (Bovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 62g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-catenin peptide， (βCATp)??NEW;RTYTYEKL, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 70.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-CGRP (human), CAS# 90954-53-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-CGRP (huMan) CGRP-II (huMan), CAS# 101462-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-CGRP (human)，CGRP-II (human), CAS# 101462-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Cyclodextrin, CAS# 7585-39-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Defensin-1， human, CAS# 99287-08-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 48.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Defensin-2， human, CAS# 99287-07-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Defensin-3， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Defensin-4， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Dextranase, CAS# 9025-70-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 89.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-DPN, CAS# 53-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-DPNH, CAS# 606-68-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 12.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (1-17), CAS# 60893-02-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 55.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (1-26)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (1-27)， camel， bovine， ovine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 68.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (1-27)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (1-5)， (16-31)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (1-5)， (16-31)，human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (18-31) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (18-31) (human), CAS# 74216-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 98.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (18-31) (huMan) β-Lipotropin (76-89) (huMan), CAS# 74216-35-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (27-31) (human), CAS# 77875-70-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 61.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (28-31) (human), CAS# 72189-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (30-31) (bovine， camel， mouse， ovine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (30-31) (bovine， camel， mouse， ovine), CAS# 13115-71-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 91.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (30-31) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 45.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (30-31) (human), CAS# 7412-78-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (6-31) (human), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 40.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (6-31) (human), CAS# 77761-27-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (6-31)， human, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 85.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (bovine, camel, mouse), CAS# 59887-17-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (bovine， camel， mouse), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 22.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (bovine， camel， mouse), CAS# 59887-17-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 34g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (equine), CAS# 79495-86-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (Human), CAS# 59004-96-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (human), CAS# 61214-51-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (huMan) β-Lipotropin (59-89) (huMan)， Lipotropin C FragMent (huMan), CAS# 61214-51-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 63.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin (rat), CAS# 77367-63-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin， camel, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin， equine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin， human, CAS# 59004-96-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin， human;YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE, CAS# 59004-96-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin， porcine, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin， porcine;YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin， rat, CAS# 77367-63-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin， rat;YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ, CAS# 77367-63-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Endorphin，human-[Des-Tyr1], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Galactosidase from Escherichia coli, CAS# 2604851,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 54g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Glucosidase from almonds, CAS# 9001-22-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 79.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Glucuronidase, CAS# 9001-45-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 26.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Hydroxynorvaline, CAS# 34042-00-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Interleukin I (163-171)， human, CAS# 106021-96-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Interleukin II (44-56), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 44.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Lactoglobulin (142-148) (bovine， goat， ovine), CAS# 132160-04-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Lipotropin (1-10)， porcine, CAS# 77875-68-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Lipotropin (61-64), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 47.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Lipotropin (61-64), CAS# 60254-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 36.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Lipotropin (61-69), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 53.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Lipotropin (88-91), CAS# 72189-84-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 11.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH (Human), CAS# 17908-57-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 46.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH (Monkey), CAS# 17750-75-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 95.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH (Monkey) β-MSH (5-22) (huMan), CAS# 17750-75-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 33g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH (Porcine), CAS# 19941-13-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH (porcine) β-Lipotropin (41-58) (porcine), CAS# 19941-13-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH (porcine)-[Tyr9]-;β-Lipotropin (41-58)(porcine)-(Tyr49)-, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 2.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH， human, CAS# 17908-57-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 13.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH， human;AEKKDEGPYRMEHFRWGSPPKD, CAS# 17908-57-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 31g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH， monkey, CAS# 17750-75-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-MSH， porcine;DEGPYKMEHFRWGSPPKD, CAS# 19941-13-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Neo-Endorphin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Neo-Endorphin (Porcine), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 32.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Neoendorphin， Prodynorphin (175-183) (human， porcine), CAS# 77739-21-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Neuroprotectin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Secretase Substrate 5， Swedish Double Mutation Sequence;[HiLyteFluor?488-Glu-Val-Asn-Leu-Asp-Ala-Glu-Phe-Lys(QXL?520)-OH], CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 97.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Secretase Substrate I， Fluorogenic, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 81.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Sheet Breaker Peptide, CAS# 339990-32-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 60.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

β-Sitosterol, CAS# 83-46-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 18.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ- Bag Cell Peptide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 77.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ1-MSH, CAS# 72629-65-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 14.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ2 - MSH (41 - 58)， amide, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ2-MSH, CAS# 72711-43-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-2-MSH (41-58)， amide;YVMGHFRWDRFG-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 66.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-2-MSH (41-58);YVMGHFRWDRFG, CAS# 72711-43-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 57.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ3-MSH, CAS# 72629-64-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 67.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ3-MSH, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 21.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ3-MSH:GAMMA3-MSH, CAS# 72629-64-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Bag Cell Peptide;RLRFD, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Chloronorvaline.HCl, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Cyclodextrin, CAS# 17465-86-0,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 84.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Endorphin, CAS# 60893-02-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Endorphin / β-Lipotropin (61-77), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 27.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Endorphin β-Endorphin (1-17)， β-Lipotropin (59-75) (huMan), CAS# 60893-02-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Globulins from bovine blood, CAS# 9007-83-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 64.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Glu-Abu, CAS# 16869-42-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 72.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Glu-Gly-Gly, CAS# 13640-39-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 16.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-L-Glutamyl-α-naphthylamide, CAS# 81012-91-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-L-Glutamyl-β-naphthylamide, CAS# 14525-44-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-MSH (3-8), CAS# 98640-70-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 19.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-Neuropeptide， rabbit, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 59.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-TAC4 (30 - 61) - NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-TAC4 (30-61)-NH2??;TEAETWEGAGPSIQLQLQEVKTGKASQFFGLM-NH2, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 56.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

γ-TAC4 (32 - 50), CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 24.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ1-MSH， amide, CAS# 72629-65-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 73.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ-Aminovaleryl-(Pro9，N-Me-Leu10)-Substance P (7-11), CAS# 133156-06-6,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 29.5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ-Endorphin, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 52.7g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ-Endorphin (bovine， camel， mouse， ovine), CAS# 66954-40-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 80.3g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ-Endorphin (bovine， caMel， Mouse， ovine) Lipotropin C′ FragMent (caMel)， β-Lipotropin (41-67) (Mouse)， β-Lipotropin (61-87) (caMel， ovine)， β-Endorphin (1-27) (bovine， caMel， Mouse， ovine)， β-Lipotropin (63-89) (bovine), CAS# 66954-40-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ-Endorphin (human), CAS# 76622-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ-Endorphin (huMan) β-Lipotropin (59-85) (huMan)， β-Endorphin (1-27) (huMan)， Lipotropin C' FragMent (huMan), CAS# 76622-84-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ-Lactone, CAS# 64053-02-7,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 7.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ-MSH, CAS# 100930-04-9,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 71.6g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

δ-MSH, CAS# 16182-15-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 23.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ε- Aminocaproic acid, CAS# 60-32-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 4g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ε- TxIX12, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ε-TxIX12 ??;ECCEDGWCCTAA, CAS# ,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 93.2g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

μ-Conotoxin GIIIA, CAS# 129129-65-3,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 28.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

μ-Conotoxin GIIIB Geographutoxin II (GTXII), CAS# 140678-12-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 5g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ω-Agatoxin TK, CAS# 158484-42-5,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 90.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ω-Conotoxin GVIA, CAS# 106375-28-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 30.9g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ω-Conotoxin GVIA;CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY-NH2, CAS# 106375-28-4,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 6.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ω-Conotoxin MVIIA, CAS# 107452-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 15.1g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ω-Conotoxin MVIIA;CKGKGAKCSRLMYDCCTGSCRSGKC-NH2(Disulfidebridge:1-16，8-20，and15-25), CAS# 107452-89-1,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 37g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ω-Conotoxin MVIIC, CAS# 147794-23-8,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 74.8g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.

ω-Conotoxin SVIB, CAS# 150433-82-2,Apperance is White powder, HPLC is more than 99%, Water less than 1%, Stock more than 25g,Batch size 10-100g. COA, MSDS, ROS, MOA is ok. Solubility: soluble in water, most organic solvents. Packing specification: 10g aluminum foil bag or according to customer's requirements.Store at 2-8°C.